Q9BTM1 H2AJ_HUMAN
Gene name: H2AJ
Protein name: Histone H2A.J
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- chromosome organization GO:0051276
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O75129 | ASTN2 | 0.7931 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 2 | Q6FI13 | H2AC18 | 0.76868 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 3 | Q8IUE6 | H2AC21 | 0.76211 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 4 | A0A087WUL8 | NBPF19 | 0.74902 | |
| 5 | Q7L7L0 | H2AW | 0.74688 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 ... |
| 6 | P16104 | H2AX | 0.72993 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 7 | O00755 | WNT7A | 0.72191 | |
| 8 | Q15050 | RRS1 | 0.72062 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell differentiation GO:0030154 ... |
| 9 | Q8IV32 | CCDC71 | 0.71374 | |
| 10 | P0DPF2 | NBPF20 | 0.70276 |
20 40 60 80 100 AA: MSGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGK STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDD................................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDD.D.........................................................D......D.................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDD............................................................................. CONSENSUS: DDDDDDDDDDDDDDDDD................................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDD................DDDDDDDD...................................................... RICH_[GK]: GKqGGKvraK RICH_MOBI_[K]: KqggKvraKaK RICH_MOBI_[R]: RgkqggkvRakaksRssR RICH_MOBI_[GK]: GrGKqGGKvraKaK RICH_MOBI_[GR]: GRGkqGGkvRakaksRssR RICH_MOBI_[KR]: RgKqggKvRaKaKsRssR
120 AA: VTIAQGGVLPNIQAVLLPKKTESQKTKSK STMI: DO_DISOPRED3: ....................DDDDDDDDD DO_IUPRED2A: ...................DD.DDDDDDD DO_SPOTD: ..................DDDDDDDDDDD CONSENSUS: ...................DDDDDDDDDD CONSENSUS_MOBI: ............................. RICH_[K]: KtesqKtKsK