Q7L7L0 H2A3_HUMAN

Gene name: H2AW
Protein name: Histone H2A type 3

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- chromosome organization GO:0051276
- DNA metabolic process GO:0006259
- response to stress GO:0006950

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8IUE6 H2AC21 0.98061 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
2 P16104 H2AX 0.96665 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
3 Q99878 H2AC14 0.87065 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
4 Q16777 H2AC20 0.86086 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
5 Q96KK5 H2AC12 0.76925 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
6 Q9BTM1 H2AJ 0.74688 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
7 Q6FI13 H2AC18 0.70239 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
8 O14490 DLGAP1 0.62907 cell-cell signaling GO:0007267
9 Q6PF06 TRMT10B 0.61931 cellular nitrogen compound metabolic process GO:0034641
10 P17861 XBP1 0.61639 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...

                                           20                  40                  60                  80                 100
AA:                      MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGR
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDD...................................................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDD..D......................................................D.D....DD.................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDD.............................................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDD................................................................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDD..............................................................................
RICH_[AK]:                    KqggKArAKAK                                                                                    
RICH_[K]:                     KqggKaraKaK                                                                                    
RICH_[GK]:                 GrGKqGGKaraKaK                                                                                    
RICH_MOBI_[AG]:            GrGkqGGkArAkAksrssrA                                                                              
RICH_MOBI_[AK]:               KqggKArAKAKsrssrA                                                                              
RICH_MOBI_[AR]:             RgkqggkARAkAksRssRA                                                                              
RICH_MOBI_[K]:                KqggKaraKaK                                                                                    
RICH_MOBI_[R]:              RgkqggkaRakaksRssR                                                                               
RICH_MOBI_[GK]:            GrGKqGGKaraKaK                                                                                    
RICH_MOBI_[GR]:            GRGkqGGkaRakaksRssR                                                                               
RICH_MOBI_[KR]:             RgKqggKaRaKaKsRssR                                                                               

                                          120          
AA:                      VTIAQGGVLPNIQAVLLPKKTESHHKAKGK
STMI:                                                  
DO_DISOPRED3:            ....................DDDDDDDDDD
DO_IUPRED2A:             ...................DD.DDDDDDDD
DO_SPOTD:                ..................DDDDDDDDDDDD
CONSENSUS:               ...................DDDDDDDDDDD
CONSENSUS_MOBI:          ..............................
RICH_[HK]:                                  KtesHHKaKgK