Q99878 H2A1J_HUMAN
Gene name: H2AC14
Protein name: Histone H2A type 1-J
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- chromosome organization GO:0051276
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q16777 | H2AC20 | 0.99085 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 2 | Q96KK5 | H2AC12 | 0.97456 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 3 | Q6FI13 | H2AC18 | 0.87857 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 4 | Q7L7L0 | H2AW | 0.87065 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 ... |
| 5 | Q8IUE6 | H2AC21 | 0.86974 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 6 | P16104 | H2AX | 0.82947 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 7 | A8MYJ7 | TTC34 | 0.74187 | |
| 8 | P62318 | SNRPD3 | 0.70901 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 9 | Q96EU6 | RRP36 | 0.69905 | cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 |
| 10 | Q9ULN7 | PNMA8B | 0.68244 |
20 40 60 80 100 AA: MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGK STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDD................................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDD.DD...................................................D......DD................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. RICH_[AG]: GrGkqGGkArAkAktrssrA RICH_[AK]: KqggKArAKAKtrssrA RICH_[AR]: RgkqggkARAkAktRssRA RICH_[K]: KqggKaraKaK RICH_[R]: RgkqggkaRakaktRssR RICH_[GK]: GrGKqGGKaraKaK RICH_[GR]: GRGkqGGkaRakaktRssR RICH_[KR]: RgKqggKaRaKaKtRssR RICH_MOBI_[AG]: GrGkqGGkArAkAktrssrA RICH_MOBI_[AK]: KqggKArAKAKtrssrA RICH_MOBI_[AR]: RgkqggkARAkAktRssRA RICH_MOBI_[K]: KqggKaraKaK RICH_MOBI_[R]: RgkqggkaRakaktRssR RICH_MOBI_[GK]: GrGKqGGKaraKaK RICH_MOBI_[GR]: GRGkqGGkaRakaktRssR RICH_MOBI_[KR]: RgKqggKaRaKaKtRssR
120 AA: VTIAQGGVLPNIQAVLLPKKTESHHKTK STMI: DO_DISOPRED3: ....................DDDDDDDD DO_IUPRED2A: ..................DDDDDDDDDD DO_SPOTD: ..................DDDDDDDDDD CONSENSUS: ..................DDDDDDDDDD CONSENSUS_MOBI: ............................ RICH_[K]: KKteshhKtK RICH_[HK]: KKtesHHKtK