Q6IC83 CV042_HUMAN
Gene name: C22orf42
Protein name: Uncharacterized protein C22orf42
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P55058 | PLTP | 0.54445 | biosynthetic process GO:0009058 reproduction GO:0000003 small molecule metabolic process GO:0044281 ... |
| 2 | Q9NYP9 | MIS18A | 0.50198 | cell cycle GO:0007049 cell division GO:0051301 cellular component assembly GO:0022607 ... |
| 3 | Q8NGA4 | GPR32P1 | 0.49333 | homeostatic process GO:0042592 immune system process GO:0002376 response to stress GO:0006950 ... |
| 4 | Q9NZN1 | IL1RAPL1 | 0.49071 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 5 | Q8WY50 | PLAC4 | 0.46486 | |
| 6 | Q9H5L6 | THAP9 | 0.46486 | cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 |
| 7 | Q9UKW6 | ELF5 | 0.46486 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 8 | Q96IR2 | ZNF845 | 0.45476 | |
| 9 | Q9NYT0 | PLEK2 | 0.43468 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 signal transduction GO:0007165 |
| 10 | Q8WWH5 | TRUB1 | 0.43437 | cellular nitrogen compound metabolic process GO:0034641 |
20 40 60 80 100 AA: MGSKLTCCLGPSGGLNCDCCRPDVGPCHECEIPETVAATAPASTTAKPAKLDLKAKKAQLMQYLSLPKTPKMLKMSKGLDARSKRWLKIIWRRHGIWPLE STMI: DO_DISOPRED3: DDD.D..DDD.DDDD.D..................D....DD.......................................................... DO_IUPRED2A: .....................................DDDDDDDDDDDDDDD.....................DD......................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: DDDDDDDDDDDDDDDDD..................DDDDDDDDDDDDDDDDD.....................DD......................... CONSENSUS_MOBI: .................................................................................................... RICH_[AT]: AATApAsTTA RICH_[A]: AAtApAsttAkpA RICH_[C]: CClgpsgglnC RICH_[CG]: CClGpsGGlnC
120 140 160 180 200 AA: NIGPTEDVQASAHGGVEENMTSDIEIPEAKHDHRPTEDVQVSAHGGVEENITSDIEISEAKHDHHLVEDLSESLSVCLEDFMTSDLSESLSVSLEDFMTS STMI: DO_DISOPRED3: .....................DD...........DD...D............................................................ DO_IUPRED2A: .DDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....DDDD..D.......................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............. CONSENSUS: .DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....DDDDDDD.......................................... CONSENSUS_MOBI: .................................................................................................... RICH_[H]: HdHrptedvqvsaH RICH_[EI]: EEnmtsdIEI RICH_[HI]: IeIpeakHdH
220 240 AA: GLSESLSVSLEDLMTPEMAKERYEDYLCWVKMARSRLNEPISSQVLGLLRL STMI: DO_DISOPRED3: ............................................DDD...D DO_IUPRED2A: .......DD.D..D..................................... DO_SPOTD: ........................................D.DDDDDDDDD CONSENSUS: ............................................DDDDDDD CONSENSUS_MOBI: ...................................................