List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

#	UniProt Accession	Gene Name	Cosine Similarity	Generic GO terms
1	Q96NT0	CCDC115	0.7514	catabolic process GO:0009056 cellular component assembly GO:0022607 homeostatic process GO:0042592 ...
2	Q8NCU8	MTLN	0.58674	cellular component assembly GO:0022607 homeostatic process GO:0042592 protein-containing complex assembly GO:0065003
3	P42679	MATK	0.5705	cell population proliferation GO:0008283 cellular protein modification process GO:0006464 signal transduction GO:0007165
4	P04053	DNTT	0.56782	cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 response to stress GO:0006950
5	Q2M3D2	EXOC3L2	0.54931	transport GO:0006810 vesicle-mediated transport GO:0016192
6	Q9NRG7	SDR39U1	0.54672
7	O75173	ADAMTS4	0.54334	anatomical structure development GO:0048856 extracellular matrix organization GO:0030198
8	Q86VU5	COMTD1	0.54262
9	O15235	MRPS12	0.53132	biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412
10	P31321	PRKAR1B	0.52863	cell-cell signaling GO:0007267 cellular protein modification process GO:0006464 homeostatic process GO:0042592 ...

                                           20                  40                  60  
AA:                      MSATTACWPAFTVLGEARGDQVDWSRLYRDTGLVKMSRKPRASSPFSNNHPSTPKRFPRQPRREKGPVKEVPGTKGSP
STMI:                    SSSSSSSSSSSSSSSSSSS                                                           
DO_DISOPRED3:            DDDD............................................D...DD...........DDDDDDDDDDDDD
DO_IUPRED2A:             ..........D..........D..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDD...........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                  ...........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:                             ...............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[PR]:                                                           PfsnnhPstPkRfPRqPRRekgPvkevP      
RICH_[NS]:                                                         SSpfSNNhpS                          
RICH_MOBI_[FR]:                                                       FsnnhpstpkRFpRqpRR               
RICH_MOBI_[NS]:                                                    SSpfSNNhpS