Q96NT0 CC115_HUMAN
Gene name: CCDC115
Protein name: Coiled-coil domain-containing protein 115
List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- cellular component assembly GO:0022607
- homeostatic process GO:0042592
- protein-containing complex assembly GO:0065003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q8NCU8 | MTLN | 0.78087 |
cellular component assembly
GO:0022607 homeostatic process GO:0042592 protein-containing complex assembly GO:0065003 |
2 | P42679 | MATK | 0.75926 |
cell population proliferation
GO:0008283 cellular protein modification process GO:0006464 signal transduction GO:0007165 |
3 | P04053 | DNTT | 0.75569 |
cellular nitrogen compound metabolic process
GO:0034641 DNA metabolic process GO:0006259 response to stress GO:0006950 |
4 | Q6PB30 | CSAG1 | 0.7514 | |
5 | Q2M3D2 | EXOC3L2 | 0.73106 |
transport
GO:0006810 vesicle-mediated transport GO:0016192 |
6 | Q9NRG7 | SDR39U1 | 0.72761 | |
7 | O75173 | ADAMTS4 | 0.7231 |
anatomical structure development
GO:0048856 extracellular matrix organization GO:0030198 |
8 | Q86VU5 | COMTD1 | 0.72214 | |
9 | O15235 | MRPS12 | 0.70711 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
10 | P31321 | PRKAR1B | 0.70353 |
cell-cell signaling
GO:0007267 cellular protein modification process GO:0006464 homeostatic process GO:0042592 ... |
20 40 60 80 100
AA: MAALDLRAELDSLVLQLLGDLEELEGKRTVLNARVEEGWLSLAKARYAMGAKSVGPLQYASHMEPQVCLHASEAQEGLQKFKVVRAGVHAPEEVGPREAG
STMI:
DO_DISOPRED3: DDDDD..........................................................................................DDDDD
DO_IUPRED2A: .....................................................................D.....................DDDDDDDDD
DO_SPOTD: DD........................................................................DDDDDD.....DDDDDDDDDDDDDDD
CONSENSUS: DD.........................................................................................DDDDDDDDD
CONSENSUS_MOBI: ...........................................................................................DDDDDDDDD
RICH_[PR]: PReag
120 140 160
AA: LRRRKGPTKTPEPESSEAPQDPLNWFGILVPHSLRQAQASFRDGLQLAADIASLQNRIDWGRSQLRGLQEKLKQLEPGAA
STMI:
DO_DISOPRED3: DDDDDDDDDDDDDDDD............................................................DDDD
DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDD.............................................D.DDDDDDDDDD
DO_SPOTD: DDDDDDDDDDDDDDDDDDDD...........................................D..DDDDDDDDDDDDDD
CONSENSUS: DDDDDDDDDDDDDDDDDDDD................................................DDDDDDDDDDDD
CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDD..........................................................
RICH_[PR]: lRRRkgPtktPeP