Q6UX65 DRAM2_HUMAN
Gene name: DRAM2
Protein name: DNA damage-regulated autophagy modulator protein 2
List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- cell death GO:0008219
- homeostatic process GO:0042592
- nervous system process GO:0050877
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q15669 | RHOH | 0.70711 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 2 | Q16820 | MEP1B | 0.64018 | response to stress GO:0006950 transport GO:0006810 |
| 3 | Q5MNV8 | FBXO47 | 0.57869 | |
| 4 | Q15546 | MMD | 0.57735 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular protein modification process GO:0006464 |
| 5 | Q13103 | SPP2 | 0.55601 | anatomical structure development GO:0048856 cellular protein modification process GO:0006464 transport GO:0006810 ... |
| 6 | Q7Z6M3 | MILR1 | 0.53916 | immune system process GO:0002376 signal transduction GO:0007165 transport GO:0006810 ... |
| 7 | Q13418 | ILK | 0.48507 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 8 | Q6ZSC3 | RBM43 | 0.4575 | |
| 9 | Q8IZ08 | GPR135 | 0.39764 | |
| 10 | Q9UI72 | PRO0255 | 0.35292 |
20 40 60 80 100 AA: MWWFQQGLSFLPSALVIWTSAAFIFSYITAVTLHHIDPALPYISDTGTVAPEKCLFGAMLNIAAVLCIATIYVRYKQVHALSPEENVIIKLNKAGLVLGI STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDD.DD............................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDD............................................................................................ CONSENSUS: DDDDDDD ........................ .............. CONSENSUS_MOBI: ....... ........................ ..............
120 140 160 180 200 AA: LSCLGLSIVANFQKTTLFAAHVSGAVLTFGMGSLYMFVQTILSYQMQPKIHGKQVFWIRLLLVIWCGVSALSMLTCSSVLHSGNFGTDLEQKLHWNPEDK STMI: MMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ......... ..................... .................... CONSENSUS_MOBI: ......... ..................... ....................
220 240 260 AA: GYVLHMITTAAEWSMSFSFFGFFLTYIRDFQKISLRVEANLHGLTLYDTAPCPINNERTRLLSRDI STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ............................................DDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: .................................................................. DO_SPOTD: .................................................DDDDDDDDDDDDDDDDD CONSENSUS: ...... ......................DDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ...... ....................................... RICH_[NR]: NNeRtRllsR