Q9UI72 YE014_HUMAN

Gene name: PRO0255
Protein name: Putative uncharacterized protein PRO0255

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O15078 CEP290 0.60232 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
2 P35610 SOAT1 0.60158 biosynthetic process GO:0009058
cell differentiation GO:0030154
cellular component assembly GO:0022607
...
3 Q5VSR9 SPANXN1 0.58092
4 Q96A44 SPSB4 0.57588 catabolic process GO:0009056
cellular protein modification process GO:0006464
signal transduction GO:0007165
5 Q9H2X9 SLC12A5 0.56375 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell-cell signaling GO:0007267
...
6 Q9Y252 RNF6 0.56353 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
7 P49768 PSEN1 0.56317 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
8 O60825 PFKFB2 0.56171 carbohydrate metabolic process GO:0005975
catabolic process GO:0009056
cell-cell signaling GO:0007267
...
9 Q9NZY2 FAM30A 0.55201
10 Q9P2E3 ZNFX1 0.55115 cellular component assembly GO:0022607
chromosome organization GO:0051276
protein-containing complex assembly GO:0065003

                                           20                  40                  60           
AA:                      MGMALELYWLCGFRSYWPLGTNAENEGNRKENRRQMQSRNERGCNVRQTKTYRDREADRHIHGIACLLF
STMI:                                                                                         
DO_DISOPRED3:            D....................................................................
DO_IUPRED2A:             .......................DDDDDDDDDDDDDDDDDDDDDDDDDDD...................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               D......................DDDDDDDDDDDDDDDDDDDDDDDDDDD...................
CONSENSUS_MOBI:          ......................DDDDDDDDDDDDDDDDDDDDDDDD.......................
RICH_[N]:                                        NegNrkeNrrqmqsrNergcN                        
RICH_[R]:                                            RkenRRqmqsRneRgcnvR                      
RICH_[EN]:                                      ENEgNrkENrrqmqsrNE                            
RICH_[ER]:                                      EnEgnRkEnRRqmqsRnER                           
RICH_[NR]:                                       NegNRkeNRRqmqsRNeRgcNvR                      
RICH_MOBI_[N]:                                   NegNrkeNrrqmqsrNergcN                        
RICH_MOBI_[R]:                                       RkenRRqmqsRneR                           
RICH_MOBI_[EN]:                                 ENEgNrkENrrqmqsrNE                            
RICH_MOBI_[ER]:                                 EnEgnRkEnRRqmqsRnER                           
RICH_MOBI_[NR]:                                  NegNRkeNRRqmqsRNeRgcN