Q6UXT8 ALKL1_HUMAN

Gene name: ALKAL1
Protein name: ALK and LTK ligand 1

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- cellular protein modification process GO:0006464
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9UNQ2 DIMT1 0.7266 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
2 Q6UXN7 TOMM20L 0.71347 cellular component assembly GO:0022607
membrane organization GO:0061024
protein targeting GO:0006605
...
3 Q9Y2E5 MAN2B2 0.71347 carbohydrate metabolic process GO:0005975
catabolic process GO:0009056
cellular protein modification process GO:0006464
...
4 Q86WS5 TMPRSS12 0.60955
5 Q6IWH7 ANO7 0.57779 membrane organization GO:0061024
plasma membrane organization GO:0007009
transmembrane transport GO:0055085
...
6 Q9NVD3 SETD4 0.57438 cellular protein modification process GO:0006464
7 Q9NS28 RGS18 0.57339 signal transduction GO:0007165
8 A8K010 LINC00473 0.56954 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
9 P59020 DSCR9 0.56195
10 O60762 DPM1 0.55712 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
small molecule metabolic process GO:0044281

                                           20                  40                  60                  80                 100
AA:                      MRPLKPGAPLPALFLLALALSPHGAHGRPRGRRGARVTDKEPKPLLFLPAAGAGRTPSGSRSAEIFPRDSNLKDKFIKHFTGPVTFSPECSKHFHRLYYN
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSSSSS                                                                         
DO_DISOPRED3:            DDDDDDDD.............DDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................
DO_IUPRED2A:             DDD.....................DDDDDDDDDDDDDDDD.......DDDDD.....DDDDDDDD...................................
DO_SPOTD:                DDDDDDDDDDDDDD.....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................
CONSENSUS:                                          DDDDDDDDDDDDDDDDDDDDDDDDD.....DDDD.......................................
CONSENSUS_MOBI:                                     DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................................
RICH_fLPS_[R]:                                      RpRgRRgaRv                                                               
RICH_MOBI_[AG]:                                                           AAGAGrtpsG                                         
RICH_fLPS_MOBI_[R]:                                 RpRgRRgaRv                                                               

                                          120           
AA:                      TRECSTPAYYKRCARLLTRLAVSPLCSQT
STMI:                                                 
DO_DISOPRED3:            ............................D
DO_IUPRED2A:             .............................
DO_SPOTD:                ..........................DDD
CONSENSUS:               ............................D
CONSENSUS_MOBI:          .............................