Q6UXN7 TO20L_HUMAN
Gene name: TOMM20L
Protein name: TOMM20-like protein 1
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- membrane organization GO:0061024
- protein targeting GO:0006605
- protein transport GO:0015031
- protein-containing complex assembly GO:0065003
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O60762 | DPM1 | 0.78087 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 small molecule metabolic process GO:0044281 |
| 2 | Q9H7R5 | ZNF665 | 0.77324 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 3 | P33681 | CD80 | 0.76194 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 4 | Q5JQF7 | LINC01556 | 0.7581 | |
| 5 | Q15036 | SNX17 | 0.7581 | anatomical structure development GO:0048856 catabolic process GO:0009056 protein transport GO:0015031 ... |
| 6 | Q9UNQ2 | DIMT1 | 0.75593 | cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 |
| 7 | Q6UXT8 | ALKAL1 | 0.71347 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular protein modification process GO:0006464 ... |
| 8 | Q9NRR3 | CDC42SE2 | 0.70711 | anatomical structure development GO:0048856 cell morphogenesis GO:0000902 signal transduction GO:0007165 ... |
| 9 | Q9NUL7 | DDX28 | 0.70711 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 ribonucleoprotein complex assembly GO:0022618 ... |
| 10 | O00339 | MATN2 | 0.68519 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
20 40 60 80 100 AA: MPSVRSLLRLLAAAAACGAFAFLGYCIYLNRKRRGDPAFKRRLRDKRRAEPQKAEEQGTQLWDPTKNKKLQELFLQEVRMGELWLSRGEHRMGIQHLGNA STMI: MMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDD................................................................................. DO_IUPRED2A: .......................................DDDDDDDDDDDDDDDDDDDDDDDD..................................... DO_SPOTD: DDDDDDDDDDD.............................DDDDDDDDDDDDDDDDDDDDDDDDDD.................................. CONSENSUS: DDDDDDDDD ...........DDDDDDDDDDDDDDDDDDDDDDD..................................... CONSENSUS_MOBI: ......... .............DDDDDDDDDDDDDDDDDDDD...................................... RICH_fLPS_[R]: RRlRdkRRae
120 140 AA: LLVCEQPRELLKVFKHTLPPKVFEMLLHKIPLICQQFEADMNEQDCLEDDPD STMI: DO_DISOPRED3: ......................................DDDDDDDDDDDDDD DO_IUPRED2A: ...........................................DDDDDDDDD DO_SPOTD: .....................................DDDDDDDDDDDDDDD CONSENSUS: ......................................DDDDDDDDDDDDDD CONSENSUS_MOBI: ....................................................