Q86XR5 PRIMA_HUMAN

Gene name: PRIMA1
Protein name: Proline-rich membrane anchor 1

List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q12851 MAP4K2 0.94008 cell cycle GO:0007049
cellular protein modification process GO:0006464
immune system process GO:0002376
...
2 Q9UGP5 POLL 0.89828 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
...
3 A0A1B0GUC4 MYOCOS 0.87174
4 P20809 IL11 0.86143 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
5 Q8IVF7 FMNL3 0.8489 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell morphogenesis GO:0000902
...
6 Q9Y330 ZBTB12 0.84438 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
immune system process GO:0002376
7 A0A1B0GUX0 ATP6V1FNB 0.84368
8 Q5BKX5 C19orf54 0.84333
9 Q96PY5 FMNL2 0.84071 anatomical structure development GO:0048856
cell morphogenesis GO:0000902
cytoskeleton organization GO:0007010
10 Q9NSA1 FGF21 0.84029 biosynthetic process GO:0009058
catabolic process GO:0009056
cell death GO:0008219
...

                                           20                  40                  60                  80                 100
AA:                      MLLRDLVLRRGCCWSSLLLHCALHPLWGFVQVTHGEPQKSCSKVTDSCRHVCQCRPPPPLPPPPPPPPPPRLLSAPAPNSTSCPTEESWWSGLVIIIAVC
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS                                                         MMMMMMMM
DO_DISOPRED3:            DDDDDDDDDDD..........................................D.DDDDDDDDDDDDDDDDDDDD.........................
DO_IUPRED2A:             ..........................................................DDDDDDDDDDDDDDDDDDDD......................
DO_SPOTD:                DDDDDDD.........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................
CONSENSUS:                                                  ..................DDDDDDDDDDDDDDDDDDDDDDDDD..............        
CONSENSUS_MOBI:                                             .......................DDDDDDDDDDDDDDDDDDDDD.............        
RICH_[P]:                                                                       PPPPlPPPPPPPPPPrllsaPaP                      
RICH_fLPS_[P]:                                                                  PPPPlPPPPPPPPPPrllsaPaP                      
RICH_MOBI_[P]:                                                                     PlPPPPPPPPPPrllsaPaP                      
RICH_MOBI_[LP]:                                                                    PLPPPPPPPPPPrLL                           
RICH_fLPS_MOBI_[P]:                                                                PlPPPPPPPPPPrllsaPaP                      

                                          120                 140       
AA:                      CASLVFLTVLVIICYKAIKRKPLRKDENGTSVAEYPMSASQSNKGVDVNNAVV
STMI:                    MMMMMMMMMMMMM                                        
DO_DISOPRED3:            ..........................................DDDDDDDDDDD
DO_IUPRED2A:             .........................D.DDDDDDDDDDDDD.............
DO_SPOTD:                ......................DDDDDDDDDDDD.DDDDDDDDDDDDDDDDDD
CONSENSUS:                            ............D.DDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:                       ........................................
RICH_[NV]:                                                         NkgVdVNNaVV