P55064 AQP5_HUMAN
Gene name: AQP5
Protein name: Aquaporin-5
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cellular component assembly GO:0022607
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9UKJ5 | CHIC2 | 1 | |
| 2 | Q9UI26 | IPO11 | 0.99941 | nucleocytoplasmic transport GO:0006913 protein transport GO:0015031 transport GO:0006810 |
| 3 | P42857 | NSG1 | 0.99746 | cell death GO:0008219 cell-cell signaling GO:0007267 cellular component assembly GO:0022607 ... |
| 4 | Q07817 | BCL2L1 | 0.99388 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 ... |
| 5 | Q86XI2 | NCAPG2 | 0.98995 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 6 | Q9BTA0 | FAM167B | 0.98058 | |
| 7 | Q13049 | TRIM32 | 0.98058 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 8 | Q8NEV9 | IL27 | 0.97823 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell population proliferation GO:0008283 ... |
| 9 | Q96M32 | AK7 | 0.95506 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 10 | Q9GZL7 | WDR12 | 0.95506 | cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 ... |
20 40 60 80 100 AA: MKKEVCSVAFLKAVFAEFLATLIFVFFGLGSALKWPSALPTILQIALAFGLAIGTLAQALGPVSGGHINPAITLALLVGNQISLLRAFFYVAAQLVGAIA STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMM DO_DISOPRED3: DDD................................................................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDD................................................................................................ CONSENSUS: DDD......... ... .............................. CONSENSUS_MOBI: D........... ... ..............................
120 140 160 180 200 AA: GAGILYGVAPLNARGNLAVNALNNNTTQGQAMVVELILTFQLALCIFASTDSRRTSPVGSPALSIGLSVTLGHLVGIYFTGCSMNPARSFGPAVVMNRFS STMI: MMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................. .............. .................. CONSENSUS_MOBI: .................. .............. ..................
220 240 260 AA: PAHWVFWVGPIVGAVLAAILYFYLLFPNSLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTTR STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ..............................................DDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ...............................................DDDDDDDDDDDDDDDDDD DO_SPOTD: .........................................DDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ..... ....................DDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ..... .....................D.......DDDDDDDDDD RICH_[E]: EdwEEqrEErkktmE RICH_fLPS_[E]: EdwEEqrEErkktmE