Q8NFD4 YI018_HUMAN

Protein name: Uncharacterized protein FLJ76381

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 A6NDN8 n/a 0.70131
2 P62263 RPS14 0.59018 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
3 O43508 TNFSF12 0.57634 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
catabolic process GO:0009056
...
4 Q96CU9 FOXRED1 0.57011 cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
5 Q8NFW8 CMAS 0.53862 cellular nitrogen compound metabolic process GO:0034641
small molecule metabolic process GO:0044281
6 P52198 RND2 0.53082 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
7 Q9Y5X5 NPFFR2 0.5244 cellular protein modification process GO:0006464
signal transduction GO:0007165
8 Q08462 ADCY2 0.52096 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
9 B2CW77 KLLN 0.51339 cell cycle GO:0007049
cell death GO:0008219
10 Q9P015 MRPL15 0.50347 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
translation GO:0006412

                                           20                  40                  60                  80                 100
AA:                      MGGFGSRFWQEGVWDRDLEKSTRLEEDAMESEPLAGTKTRGRGRRRWEARHGWTLPAHASQPSPRTVVATATGAEVSACAGRSAGTRVARPESQLSHLYG
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDD...............................................................................................
DO_IUPRED2A:             ...................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D..........
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDDD.DD.DDDDDDD.................DDDDDD..............
CONSENSUS:               DDDDD..............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................DDDDDD..............
CONSENSUS_MOBI:          ..................DDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................
RICH_[RW]:                                                      RgRgRRRWeaRhgW                                               
RICH_[R]:                                                       RgRgRRRweaR                                                  
RICH_[GR]:                                                  GtktRGRGRRRweaRhG                                                
RICH_[GW]:                                                  GtktrGrGrrrWearhGW                                               
RICH_[HW]:                                                             WearHgWtlpaH                                          
RICH_fLPS_[R]:                                         seplagtktRgRgRRRweaR                                                  
RICH_MOBI_[E]:                             EkstrlEEdamEsE                                                                    
RICH_MOBI_[GR]:                                             GtktRGRGRR                                                       

                                          120                 140       
AA:                      WDKYSNPRPSRRARAVARVHALEQAPILCRALRWGLTQFLRGTSPVTQSVPFS
STMI:                                                                         
DO_DISOPRED3:            ............DDD....................................DD
DO_IUPRED2A:             .........DDDDDDDD.................................DDD
DO_SPOTD:                ............................................DDDDDDDDD
CONSENSUS:               ............DDD...................................DDD
CONSENSUS_MOBI:          .....................................................