A6NDN8 UBIML_HUMAN

Protein name: Putative ubiquitin-like protein FUBI-like protein ENSP00000310146

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9P015 MRPL15 0.75947 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
translation GO:0006412
2 P62263 RPS14 0.72136 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
3 Q96S16 JMJD8 0.70387 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
carbohydrate metabolic process GO:0005975
...
4 Q8NFD4 n/a 0.70131
5 Q96CU9 FOXRED1 0.69693 cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
6 A6PVI3 NCBP2L 0.66539 cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
7 P62633 CNBP 0.66014 biosynthetic process GO:0009058
cell population proliferation GO:0008283
cellular nitrogen compound metabolic process GO:0034641
...
8 B2CW77 KLLN 0.65828 cell cycle GO:0007049
cell death GO:0008219
9 Q9Y5R4 HEMK1 0.64225 cellular nitrogen compound metabolic process GO:0034641
DNA metabolic process GO:0006259
10 A0A1B0GTL2 C20orf204 0.63884

                                           20                  40                  60                  80                 100
AA:                      MRGRRRAWRGAWRGGGAADLSLLCPQVAYVRARELHTLEVTGLETVAQSKAHVASLEGLIPEDKVVLLAGSPLQNEATLGQCGVEALTTLEVVGRRLGVH
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDD..................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDD................................................................................D
CONSENSUS:               DDDDDDDDDDDDDDDDDD..................................................................................
CONSENSUS_MOBI:          ....................................................................................................
RICH_[RW]:                RgRRRaWRgaWR                                                                                       
RICH_[G]:                  GrrrawrGawrGGG                                                                                    
RICH_[R]:                 RgRRRawRgawR                                                                                       
RICH_[GR]:                RGRRRawRGawRGGG                                                                                    
RICH_[GW]:                 GrrraWrGaWrGGG                                                                                    
RICH_fLPS_[R]:           mRgRRRawRgawRgg                                                                                     

                                           
AA:                      NV
STMI:                      
DO_DISOPRED3:            DD
DO_IUPRED2A:             ..
DO_SPOTD:                DD
CONSENSUS:               DD
CONSENSUS_MOBI:          ..