O14508 SOCS2_HUMAN
Gene name: SOCS2
Protein name: Suppressor of cytokine signaling 2
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell death GO:0008219
- cell differentiation GO:0030154
- cellular protein modification process GO:0006464
- growth GO:0040007
- signal transduction GO:0007165
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8WW01 | TSEN15 | 0.98613 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 |
| 2 | Q96CM4 | NXNL1 | 0.9824 | homeostatic process GO:0042592 |
| 3 | P17342 | NPR3 | 0.98094 | anatomical structure development GO:0048856 cell population proliferation GO:0008283 circulatory system process GO:0003013 ... |
| 4 | Q8TDH9 | BLOC1S5 | 0.97549 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cytoskeleton-dependent intracellular transport GO:0030705 ... |
| 5 | Q9Y5Y6 | ST14 | 0.97013 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell death GO:0008219 ... |
| 6 | O96011 | PEX11B | 0.9607 | signal transduction GO:0007165 |
| 7 | Q6P575 | GUSBP11 | 0.9297 | carbohydrate metabolic process GO:0005975 catabolic process GO:0009056 small molecule metabolic process GO:0044281 |
| 8 | P50895 | BCAM | 0.91262 | cell adhesion GO:0007155 signal transduction GO:0007165 |
| 9 | Q6ZRY4 | RBPMS2 | 0.90782 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell population proliferation GO:0008283 ... |
| 10 | Q8N9U9 | SPANXA2-OT1 | 0.90647 | cell cycle GO:0007049 cell death GO:0008219 reproduction GO:0000003 |
20 40 60 80 100 AA: MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQ STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ DO_IUPRED2A: .DDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDDD...............................D............................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................... RICH_[G]: GnGGeGtrsqwGtaG RICH_fLPS_[G]: GnGGeGtrsqwGtaG RICH_MOBI_[G]: GnGGeGtrsqwGtaG RICH_fLPS_MOBI_[G]: GnGGeGtrsqwGtaG
120 140 160 180 AA: DGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV STMI: DO_DISOPRED3: .................................................................................................. DO_IUPRED2A: ............................................D..................................................... DO_SPOTD: .................................................................................................. CONSENSUS: .................................................................................................. CONSENSUS_MOBI: ...................................DDDDDDDDDD.....................................................