Q8WWZ3 EDAD_HUMAN

Gene name: EDARADD
Protein name: Ectodysplasin-A receptor-associated adapter protein

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O95273 CCNDBP1 0.66214 cell cycle GO:0007049
2 Q53TN4 CYBRD1 0.65814 homeostatic process GO:0042592
3 Q9NZJ9 NUDT4 0.62813 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...
4 Q9NS00 C1GALT1 0.59843 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
5 P16284 PECAM1 0.55992 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...
6 Q96GC9 VMP1 0.54101 anatomical structure development GO:0048856
catabolic process GO:0009056
cell adhesion GO:0007155
...
7 Q9NV23 OLAH 0.54091
8 P49768 PSEN1 0.53937 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
9 P25101 EDNRA 0.52792 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
10 Q92851 CASP10 0.52658 cell death GO:0008219
signal transduction GO:0007165

                                           20                  40                  60                  80                 100
AA:                      MGLRTTKQMGRGTKAPGHQEDHMVKEPVEDTDPSTLSFNMSDKYPIQDTELPKAEECDTITLNCPRNSDMKNQGEENGFPDSTGDPLPEISKDNSCKENC
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDD..DD.......................................D....DDDDDDDDDDD.................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........D..DDDDDDDDDDDDDDDDDDDDDDDDDDD.........
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................DDDDDDDDDDDDDDDDDDDDDDDDD..............
RICH_[D]:                                             DtDpstlsfnmsDkypiqD                                                    
RICH_[N]:                                                                              NcprNsdmkNqgeeN                       
RICH_[DH]:                                HqeDHmvkepveDtD                                                                    
RICH_MOBI_[N]:                                                                         NcprNsdmkNqgeeN                       
RICH_MOBI_[DH]:                           HqeDHmvkepveDtD                                                                    
RICH_MOBI_[GM]:          MGlrttkqMGrGtkapG                                                                                   
RICH_fLPS_MOBI_[N]:                                                                    NcprNsdmkNqgeeN                       

                                          120                 140                 160                 180                 200
AA:                      TCSSCLLRAPTISDLLNDQDLLDVIRIKLDPCHPTVKNWRNFASKWGMSYDELCFLEQRPQSPTLEFLLRNSQRTVGQLMELCRLYHRADVEKVLRRWVD
STMI:                                                                                                                        
DO_DISOPRED3:            ....................................................................................................
DO_IUPRED2A:             ..................................................................DD................................
DO_SPOTD:                ....................................................................................................
CONSENSUS:               ....................................................................................................
CONSENSUS_MOBI:          ....................................................................................................

                              
AA:                      EEWPKRERGDPSRHF
STMI:                                   
DO_DISOPRED3:            .........DDDDDD
DO_IUPRED2A:             .........D...DD
DO_SPOTD:                ......DDDDDDDDD
CONSENSUS:               .........DDDDDD
CONSENSUS_MOBI:          ...............