Q969J3 BORC5_HUMAN
Gene name: BORCS5
Protein name: BLOC-1-related complex subunit 5
List of terms from Generic GO subset, which this protein is a part of:
- cytoskeleton-dependent intracellular transport GO:0030705
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q02363 | ID2 | 0.90348 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 2 | Q8TAG5 | VSTM2A | 0.90286 | cell differentiation GO:0030154 cell population proliferation GO:0008283 |
| 3 | P15907 | ST6GAL1 | 0.90016 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 4 | Q16445 | GABRA6 | 0.89443 | cell-cell signaling GO:0007267 nervous system process GO:0050877 signal transduction GO:0007165 ... |
| 5 | Q9NPH3 | IL1RAP | 0.89004 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 6 | Q7Z7C7 | STRA8 | 0.88822 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 7 | P59773 | MINAR2 | 0.87416 | |
| 8 | P28336 | NMBR | 0.87179 | signal transduction GO:0007165 |
| 9 | Q9ULD0 | OGDHL | 0.86824 | carbohydrate metabolic process GO:0005975 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 10 | C9JLW8 | MCRIP1 | 0.86521 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
20 40 60 80 100 AA: MGSEQSSEAESRPNDLNSSVTPSPAKHRAKMDDIVVVAQGSQASRNVSNDPDVIKLQEIPTFQPLLKGLLSGQTSPTNAKLEKLDSQQVLQLCLRYQDHL STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D....DD....DDDDD..D...............D..D...DDDDDD.................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................... RICH_[S]: SeqSSeaeSrpndlnSSvtpS
120 140 160 180 AA: HQCAEAVAFDQNALVKRIKEMDLSVETLFSFMQERQKRYAKYAEQIQKVNEMSAILRRIQMGIDQTVPLLDRLNSMLPEGERLEPFSMKPDRELRL STMI: DO_DISOPRED3: ...............................................................................................D DO_IUPRED2A: ................................................................................DDDDD..D........ DO_SPOTD: ........................................................................................DDDDDDDD CONSENSUS: ...............................................................................................D CONSENSUS_MOBI: ................................................................................................