Q9BSK0 MALD1_HUMAN
Gene name: MARVELD1
Protein name: MARVEL domain-containing protein 1
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell cycle GO:0007049
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q969L2 | MAL2 | 0.83844 | anatomical structure development GO:0048856 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 2 | Q5JST6 | EFHC2 | 0.73106 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 3 | Q96HD1 | CRELD1 | 0.70711 | anatomical structure development GO:0048856 |
| 4 | Q8N5S1 | SLC25A41 | 0.70711 | |
| 5 | Q9NYA1 | SPHK1 | 0.70711 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 6 | O14543 | SOCS3 | 0.6585 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 7 | Q0P6H9 | TMEM62 | 0.65583 | |
| 8 | P17405 | SMPD1 | 0.64594 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 9 | Q9NVV9 | THAP1 | 0.64035 | biosynthetic process GO:0009058 cell cycle GO:0007049 cell population proliferation GO:0008283 ... |
| 10 | P04180 | LCAT | 0.61495 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 homeostatic process GO:0042592 ... |
20 40 60 80 100 AA: MLPPPPRQPPPQARAARGAVRLQRPFLRSPLGVLRLLQLLAGAAFWITIATSKYQGPVHFALFVSVLFWLLTLGLYFLTLLGKHELVPVLGSRWLMVNVA STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDD.................................................................................. DO_IUPRED2A: DDDDDDDDDDDDDDD..................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDD................................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDD........... ......... .............. CONSENSUS_MOBI: ............................. ......... .............. RICH_fLPS_[P]: mlPPPPrqPPPqara
120 140 160 AA: HDVLAAALYGAATGIMSDQMQRHSYCNLKDYPLPCAYHAFLAAAVCGGVCHGLYLLSALYGCGRRCQGKQEVA STMI: MMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .....................................................................DDDD DO_IUPRED2A: ......................................................................... DO_SPOTD: ...................................................................DDDDDD CONSENSUS: ....................... ..........DDDD CONSENSUS_MOBI: ....................... ..............