Q96A26 F162A_HUMAN

Gene name: FAM162A
Protein name: Protein FAM162A

List of terms from Generic GO subset, which this protein is a part of:
- cell death GO:0008219
- response to stress GO:0006950
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q02790 FKBP4 0.94868 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular component assembly GO:0022607
...
2 Q8IWX7 UNC45B 0.89443 anatomical structure development GO:0048856
cell differentiation GO:0030154
protein folding GO:0006457
3 Q9NZJ6 COQ3 0.87416 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
small molecule metabolic process GO:0044281
4 O43681 GET3 0.79035 membrane organization GO:0061024
protein targeting GO:0006605
protein transport GO:0015031
...
5 Q149M9 NWD1 0.78935 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
6 P11055 MYH3 0.75425 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
7 Q9BPX5 ARPC5L 0.73994 cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
protein-containing complex assembly GO:0065003
8 Q9H0Q3 FXYD6 0.72726 circulatory system process GO:0003013
transmembrane transport GO:0055085
transport GO:0006810
9 Q8N6S4 ANKRD13C 0.71554 biosynthetic process GO:0009058
cell death GO:0008219
10 Q4W5N1 ABCA11P 0.7088

                                           20                  40                  60                  80                 100
AA:                      MGSLSGLRLAAGSCFRLCERDVSSSLRLTRSSDLKRINGFCTKPQESPGAPSRTYNRVPLHKPTDWQKKILIWSGRFKKEDEIPETVSLEMLDAAKNKMR
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDD...............DDDD.D.DD..DDDDD..DDDDDDDDDDDDDDDDD..........................................
DO_IUPRED2A:             ...............................................DD.DDDDDDDDD.........................................
DO_SPOTD:                DDDDD..............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................D......DDD
CONSENSUS:               DDDDD..................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........................................
CONSENSUS_MOBI:          ....................................................................................................

                                          120                 140      
AA:                      VKISYLMIALTVVGCIFMVIEGKKAAQRHETLTSLNLEKKARLKEEAAMKAKTE
STMI:                      MMMMMMMMMMMMMMMMMM                                  
DO_DISOPRED3:            ...................................D.......DDDDDDDDDDD
DO_IUPRED2A:             ..............................DD.............D.DDDDD.D
DO_SPOTD:                DDDD....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ..                  ..........DDDDDD.......DDDDDDDDDDD
CONSENSUS_MOBI:          ..                  ..................................
RICH_[AE]:                                                           EEAAmkAktE