Q96DE5 APC16_HUMAN
Gene name: ANAPC16
Protein name: Anaphase-promoting complex subunit 16
List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- cell cycle GO:0007049
- cell division GO:0051301
- cellular protein modification process GO:0006464
- mitotic cell cycle GO:0000278
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q00978 | IRF9 | 0.86218 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 immune system process GO:0002376 ... |
| 2 | Q17RH7 | TPRXL | 0.78918 | |
| 3 | Q9UGV2 | NDRG3 | 0.789 | cell differentiation GO:0030154 growth GO:0040007 reproduction GO:0000003 ... |
| 4 | Q15517 | CDSN | 0.77058 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell death GO:0008219 ... |
| 5 | O43462 | MBTPS2 | 0.75215 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 6 | Q5VYK3 | ECPAS | 0.74457 | catabolic process GO:0009056 cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 ... |
| 7 | P31358 | CD52 | 0.72997 | homeostatic process GO:0042592 |
| 8 | O15520 | FGF10 | 0.72994 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 9 | Q13278 | RIG | 0.72812 | |
| 10 | Q8TBH0 | ARRDC2 | 0.72812 | protein transport GO:0015031 transport GO:0006810 |
20 40 60 80 100 AA: MAASSSSSSAGGVSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVFSYQVASTLKQVKHDQQVARMEKLAGLVEELEADEWRFKPIE STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDD.................................................................................... DO_IUPRED2A: DD..DDD..DDD...........................D............................................................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................. CONSENSUS: DDDDDDDDDDDDDDDD.......................D............................................................ CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................. RICH_[S]: SSSSSSaggvSgS RICH_[GS]: SSSSaGGvSGS RICH_fLPS_[S]: aaSSSSSSaggvSgS RICH_MOBI_[G]: GGvsGssvtGsG RICH_MOBI_[S]: SSSSSSaggvSgSSvtgSgfSvS RICH_MOBI_[SV]: SaggVSgSSVtgSgfSVS RICH_MOBI_[GS]: SSSSSSaGGvSGSSvtGSGfSvS RICH_MOBI_[GV]: GGVsGssVtGsGfsV RICH_fLPS_MOBI_[S]: SSSSSSaggvSgSSvtgSgfSvS
AA: QLLGFTPSSG STMI: DO_DISOPRED3: ........DD DO_IUPRED2A: .......... DO_SPOTD: .DDDDDDDDD CONSENSUS: ........DD CONSENSUS_MOBI: .......DDD