Q96EH5 RL39L_HUMAN

Gene name: RPL39L
Protein name: 60S ribosomal protein L39-like

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- reproduction GO:0000003
- translation GO:0006412

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q59GN2 RPL39P5 0.88717 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
translation GO:0006412
2 P62891 RPL39 0.75894 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
3 A8MT65 ZNF891 0.73
4 O95340 PAPSS2 0.65094 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
...
5 Q9HBE4 IL21 0.59192 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
6 Q92466 DDB2 0.58858 cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
7 Q9NV72 ZNF701 0.58005 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
8 O14981 BTAF1 0.57991 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
9 Q15388 TOMM20 0.5731 catabolic process GO:0009056
cellular component assembly GO:0022607
cellular protein modification process GO:0006464
...
10 Q8WV37 ZNF480 0.57283 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641

                                           20                  40         
AA:                      MSSHKTFTIKRFLAKKQKQNRPIPQWIQMKPGSKIRYNSKRRHWRRTKLGL
STMI:                                                                       
DO_DISOPRED3:            D..................................................
DO_IUPRED2A:             D......DDDDDDDD..DDDDDDDDDDDDDDDDDDDDDDDDDDD.D.DDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               D......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ...................................................
RICH_[RW]:                                        WiqmkpgskiRynskRRhWR      
RICH_[I]:                                      IpqwIqmkpgskI                
RICH_[K]:                         KrflaKKqKqnrpipqwiqmKpgsK                 
RICH_[Q]:                                QkQnrpipQwiQ                       
RICH_[R]:                                                   RynskRRhwRR     
RICH_[W]:                                         WiqmkpgskirynskrrhW       
RICH_[IQ]:                               QkQnrpIpQwIQ                       
RICH_[KQ]:                        KrflaKKQKQnrpipQwiQmKpgsK                 
RICH_[KR]:                                            KpgsKiRynsKRRhwRRtK