Q59GN2 R39L5_HUMAN

Gene name: RPL39P5
Protein name: Putative 60S ribosomal protein L39-like 5

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- translation GO:0006412

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q96EH5 RPL39L 0.88717 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
reproduction GO:0000003
...
2 P62891 RPL39 0.76807 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
3 A8MT65 ZNF891 0.64594
4 Q8IZU8 DSEL 0.59887 biosynthetic process GO:0009058
small molecule metabolic process GO:0044281
5 Q92466 DDB2 0.59628 cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
6 Q9HBE4 IL21 0.59524 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
7 Q15388 TOMM20 0.59117 catabolic process GO:0009056
cellular component assembly GO:0022607
cellular protein modification process GO:0006464
...
8 Q9NV72 ZNF701 0.55251 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
9 O14981 BTAF1 0.54589 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
10 P62753 RPS6 0.54467 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...

                                           20                  40         
AA:                      MSSHKTFKIKQFLAKKQKQNRPIPQWIRMKTGNKIRYNSKRRHWKRTKLGL
STMI:                                                                       
DO_DISOPRED3:            D..................................................
DO_IUPRED2A:             D.....DDDDDDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               D.....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ...................................................
RICH_[RW]:                                        WiRmktgnkiRynskRRhW       
RICH_[I]:                                      IpqwIrmktgnkI                
RICH_[K]:                       KiKqflaKKqKqnrpipqwirmKtgnK                 
RICH_[Q]:                          QflakkQkQnrpipQ                          
RICH_[R]:                                           RmktgnkiRynskRRhwkR     
RICH_[W]:                                         WirmktgnkirynskrrhW       
RICH_[FK]:                     FKiKqFlaKKqK                                 
RICH_[FQ]:                     FkikQFlakkQkQ                                
RICH_[IQ]:                       IkQflakkQkQnrpI                            
RICH_[KQ]:                      KiKQflaKKQKQnrpipQwirmK                     
RICH_[KR]:                                          RmKtgnKiRynsKRRhwKRtK   
RICH_[KW]:                                        WirmKtgnKirynsKrrhWK      
RICH_[NR]:                                               NkiRyNskRR