Q96GL9 F163A_HUMAN

Gene name: FAM163A
Protein name: Protein FAM163A

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q6ZQY2 LRRC74B 0.90847
2 Q96HF1 SFRP2 0.67845 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
3 Q9ULJ1 ODF2L 0.67845 cellular component assembly GO:0022607
4 P0C2L3 FAM163B 0.62701
5 Q9BTA0 FAM167B 0.61155
6 Q13049 TRIM32 0.61155 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
7 Q8NEV9 IL27 0.61151 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell population proliferation GO:0008283
...
8 Q86XI2 NCAPG2 0.61061 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
9 Q07817 BCL2L1 0.60925 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
catabolic process GO:0009056
...
10 P42857 NSG1 0.60669 cell death GO:0008219
cell-cell signaling GO:0007267
cellular component assembly GO:0022607
...

                                           20                  40                  60                  80                 100
AA:                      MTAGTVVITGGILATVILLCIIAVLCYCRLQYYCCKKSGTEVADEEEEREHDLPTHPRGPTCNACSSQALDGRGSLAPLTSEPCSQPCGVAASHCTTCSP
STMI:                         MMMMMMMMMMMMMMMMMMMMM                                                                          
DO_DISOPRED3:            DD.....D................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........
DO_IUPRED2A:             ............................................DDDDDDDDDDDD............................................
DO_SPOTD:                DD...................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDDD
CONSENSUS:               DD...                     ..............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........
CONSENSUS_MOBI:          .....                     ..........................................................................
RICH_[E]:                                                        EvadEEEErE                                                  
RICH_[CE]:                                                            EEErEhdlpthprgptCnaC                                   
RICH_[EH]:                                                           EEEErEHdlptH                                            
RICH_fLPS_[E]:                                                   EvadEEEErEhdlpt                                             

                                          120                 140                 160             
AA:                      YSSPFYIRTADMVPNGGGGERLSFAPTYYKEGGPPSLKLAAPQSYPVTWPGSGREAFTNPRAISTDV
STMI:                                                                                       
DO_DISOPRED3:            ...................................................................
DO_IUPRED2A:             ................D......DDD.........D...DDDDDDD..DDDDD..DDDDDDDDDD..
DO_SPOTD:                DDDDDD..DDDDDDDDDDDDD.........DDDDDDDD.............DDDDD....DD.DDDD
CONSENSUS:               ................D..................D...............DDDDD....DDDDD..
CONSENSUS_MOBI:          ...................................................................