Q9BQA9 CYBC1_HUMAN
Gene name: CYBC1
Protein name: Cytochrome b-245 chaperone 1
List of terms from Generic GO subset, which this protein is a part of:
- immune system process GO:0002376
- response to stress GO:0006950
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q02363 | ID2 | 0.90348 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 2 | Q8TAG5 | VSTM2A | 0.90286 | cell differentiation GO:0030154 cell population proliferation GO:0008283 |
| 3 | P15907 | ST6GAL1 | 0.90016 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 4 | Q16445 | GABRA6 | 0.89443 | cell-cell signaling GO:0007267 nervous system process GO:0050877 signal transduction GO:0007165 ... |
| 5 | Q9NPH3 | IL1RAP | 0.89004 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 6 | Q7Z7C7 | STRA8 | 0.88822 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 7 | P59773 | MINAR2 | 0.87416 | |
| 8 | P28336 | NMBR | 0.87179 | signal transduction GO:0007165 |
| 9 | Q9ULD0 | OGDHL | 0.86824 | carbohydrate metabolic process GO:0005975 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 10 | C9JLW8 | MCRIP1 | 0.86521 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
20 40 60 80 100 AA: MYLQVETRTSSRLHLKRAPGIRSWSLLVGILSIGLAAAYYSGDSLGWKLFYVTGCLFVAVQNLEDWEEAIFDKSTGKVVLKTFSLYKKLLTLFRAGHDQV STMI: MMMMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ................... .......................................................... CONSENSUS_MOBI: ................... ..........................................................
120 140 160 180 AA: VVLLHDVRDVSVEEEKVRYFGKGYMVVLRLATGFSHPLTQSAVMGHRSDVEAIAKLITSFLELHCLESPTELSQSSDSEAGDPASQS STMI: DO_DISOPRED3: .....................................................................DDDDDDDDDDDDDDDDDD DO_IUPRED2A: .......................................................................DDDDDDDDDDDDDDDD DO_SPOTD: ..................................................................DDDDDDDDDDDDDDDDDDDDD CONSENSUS: .....................................................................DDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ....................................................................................... RICH_[S]: SqSSdSeagdpaSqS