Q9BRU2 TCAL7_HUMAN

Gene name: TCEAL7
Protein name: Transcription elongation factor A protein-like 7

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8WVF5 KCTD4 0.71848 cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
2 P53985 SLC16A1 0.68675 cell cycle GO:0007049
cell-cell signaling GO:0007267
circulatory system process GO:0003013
...
3 Q7Z4B0 LINC00305 0.68098
4 Q5T9S5 CCDC18 0.67454
5 A6NCM1 IQCA1L 0.67166
6 Q9Y2G8 DNAJC16 0.67164
7 Q14690 PDCD11 0.66977 cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
ribosome biogenesis GO:0042254
8 P26358 DNMT1 0.66894 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell death GO:0008219
...
9 A8MZ26 EFCAB9 0.662 anatomical structure development GO:0048856
cell differentiation GO:0030154
developmental maturation GO:0021700
...
10 Q96EA4 SPDL1 0.66188 cell cycle GO:0007049
cell division GO:0051301
chromosome organization GO:0051276
...

                                           20                  40                  60                  80
AA:                      MQKPCKENEGKPKCSVPKREEKRPYGEFERQQTEGNFRQRLLQSLEEFKEDIDYRHFKDEEMTREGDEMERCLEEIRGLRKKFRALHSNHRHSRDRPYPI
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........................................................DDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDD..............DDDDDD...DD.DDDDD..........DDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............DD.....DD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................D......DDDDD..........DDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................
RICH_[C]:                    CkenegkpkC                                                                                      
RICH_[E]:                                   EEkrpygEfErqqtE                                                                  
RICH_[K]:                  KpcKenegKpKcsvpKreeK                                                                              
RICH_[R]:                                  ReekRpygefeRqqtegnfR                                                              
RICH_[CE]:                   CkEnEgkpkCsvpkrEE                                                                               
RICH_[CK]:                 KpCKenegKpKCsvpKreeK                                                                              
RICH_[EK]:                 KpcKEnEgKpKcsvpKrEEKrpygEfE                                                                       
RICH_[ER]:                                 REEkRpygEfERqqtEgnfR                                                              
RICH_[FQ]:                                          FerQQtegnFrQ                                                             
RICH_[HR]:                                                                                                     HsnHRHsRdR    
RICH_MOBI_[C]:               CkenegkpkC                                                                                      
RICH_MOBI_[E]:                              EEkrpygEfErqqtE                                                                  
RICH_MOBI_[K]:             KpcKenegKpKcsvpKreeK                                                                              
RICH_MOBI_[CE]:              CkEnEgkpkCsvpkrEE                                                                               
RICH_MOBI_[CK]:            KpCKenegKpKCsvpKreeK                                                                              
RICH_MOBI_[EK]:            KpcKEnEgKpKcsvpKrEEKrpygEfE