Q9BUF7 CRUM3_HUMAN

Gene name: CRB3
Protein name: Protein crumbs homolog 3

List of terms from Generic GO subset, which this protein is a part of:
- cell junction organization GO:0034330
- cellular component assembly GO:0022607

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q4KMG9 TMEM52B 0.7438
2 Q96FZ7 CHMP6 0.73181 biological process involved in symbiotic interaction GO:0044403
catabolic process GO:0009056
cell cycle GO:0007049
...
3 P54725 RAD23A 0.68372 biological process involved in symbiotic interaction GO:0044403
catabolic process GO:0009056
cell cycle GO:0007049
...
4 Q9BT04 FUZ 0.67845 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
5 Q9NVE4 CCDC87 0.67791 cell differentiation GO:0030154
reproduction GO:0000003
6 O15520 FGF10 0.65134 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
7 P31358 CD52 0.65113 homeostatic process GO:0042592
8 Q9NRW7 VPS45 0.64765 protein transport GO:0015031
response to stress GO:0006950
transport GO:0006810
...
9 Q16531 DDB1 0.64765 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
...
10 Q8TBY0 RBM46 0.6348 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
catabolic process GO:0009056
...

                                           20                  40                  60                  80                 100
AA:                      MANPGLGLLLALGLPFLLARWGRAWGQIQTTSANENSTVLPSSTSSSSDGNLRPEAITAIIVVFSLLAALLLAVGLALLVRKLREKRQTEGTYRPSSEEQ
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSSSS                                 MMMMMMMMMMMMMMMMMMMMM                    
DO_DISOPRED3:            DDDDDDDDDDDDDD.........................DDDDDDDDDDD..................DDDD............................
DO_IUPRED2A:             ..................................DDDDDDDDDDDDDD........................................DDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                         ........DDDDDDDDDDDDDDDD.........                     ........DDDDDDDDDDDD
CONSENSUS_MOBI:                                    .................................                     ......DDDDDDDDDDDDDD
RICH_[S]:                                                    StvlpSStSSSS                                                    
RICH_[EP]:                                                                                                                EEq
RICH_fLPS_[S]:                                             enStvlpSStSSSSd