Q9BWD3 RTL8A_HUMAN
Gene name: RTL8A
Protein name: Retrotransposon Gag-like protein 8A
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9BTZ2 | DHRS4 | 0.73994 | protein targeting GO:0006605 protein transport GO:0015031 small molecule metabolic process GO:0044281 ... |
| 2 | Q9UFN0 | NIPSNAP3A | 0.73994 | |
| 3 | Q9BXJ7 | AMN | 0.73994 | anatomical structure development GO:0048856 protein transport GO:0015031 small molecule metabolic process GO:0044281 ... |
| 4 | Q92185 | ST8SIA1 | 0.67267 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cell population proliferation GO:0008283 ... |
| 5 | Q86Y38 | XYLT1 | 0.66227 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 developmental maturation GO:0021700 ... |
| 6 | Q8TDX6 | CSGALNACT1 | 0.66182 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 7 | Q17RB0 | RTL8B | 0.62313 | |
| 8 | Q96DB5 | RMDN1 | 0.61858 | |
| 9 | Q14088 | RAB33A | 0.61212 | immune system process GO:0002376 protein transport GO:0015031 signal transduction GO:0007165 ... |
| 10 | Q8TAQ9 | SUN3 | 0.59526 | membrane organization GO:0061024 |
20 40 60 80 100 AA: MDGRVQLMKALLAGPLRPAARRWRNPIPFPETFDGDTDRLPEFIVQTSSYMFVDENTFSNDALKVTFLITRLTGPALQWVIPYIRKESPLLNDYRGFLAE STMI: DO_DISOPRED3: .......DDDDDDDDDDDDDDDDD............................................................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDD........................................................................... CONSENSUS: .......DDDDDDDDDDDDDDDDD............................................................................ CONSENSUS_MOBI: .................................................................................................... RICH_[AL]: ALLAgpLrpAA RICH_[AR]: AgplRpAARR
AA: MKRVFGWEEDEDF STMI: DO_DISOPRED3: ............D DO_IUPRED2A: ............. DO_SPOTD: ........DDDDD CONSENSUS: ............D CONSENSUS_MOBI: .............