Q9BWD3 RTL8A_HUMAN

Gene name: RTL8A
Protein name: Retrotransposon Gag-like protein 8A

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9BTZ2 DHRS4 0.73994 protein targeting GO:0006605
protein transport GO:0015031
small molecule metabolic process GO:0044281
...
2 Q9UFN0 NIPSNAP3A 0.73994
3 Q9BXJ7 AMN 0.73994 anatomical structure development GO:0048856
protein transport GO:0015031
small molecule metabolic process GO:0044281
...
4 Q92185 ST8SIA1 0.67267 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
cell population proliferation GO:0008283
...
5 Q86Y38 XYLT1 0.66227 anatomical structure development GO:0048856
biosynthetic process GO:0009058
developmental maturation GO:0021700
...
6 Q8TDX6 CSGALNACT1 0.66182 anatomical structure development GO:0048856
biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
...
7 Q17RB0 RTL8B 0.62313
8 Q96DB5 RMDN1 0.61858
9 Q14088 RAB33A 0.61212 immune system process GO:0002376
protein transport GO:0015031
signal transduction GO:0007165
...
10 Q8TAQ9 SUN3 0.59526 membrane organization GO:0061024

                                           20                  40                  60                  80                 100
AA:                      MDGRVQLMKALLAGPLRPAARRWRNPIPFPETFDGDTDRLPEFIVQTSSYMFVDENTFSNDALKVTFLITRLTGPALQWVIPYIRKESPLLNDYRGFLAE
STMI:                                                                                                                        
DO_DISOPRED3:            .......DDDDDDDDDDDDDDDDD............................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDD...........................................................................
CONSENSUS:               .......DDDDDDDDDDDDDDDDD............................................................................
CONSENSUS_MOBI:          ....................................................................................................
RICH_[AL]:                        ALLAgpLrpAA                                                                                
RICH_[AR]:                           AgplRpAARR                                                                              

                                
AA:                      MKRVFGWEEDEDF
STMI:                                 
DO_DISOPRED3:            ............D
DO_IUPRED2A:             .............
DO_SPOTD:                ........DDDDD
CONSENSUS:               ............D
CONSENSUS_MOBI:          .............