Q9BYS1 KRA15_HUMAN
Gene name: KRTAP1-5
Protein name: Keratin-associated protein 1-5
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8IUG1 | KRTAP1-3 | 0.86894 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 2 | Q9UK05 | GDF2 | 0.826 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 3 | Q9Y3D2 | MSRB2 | 0.8259 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 protein-containing complex assembly GO:0065003 ... |
| 4 | Q07627 | KRTAP1-1 | 0.82554 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 5 | Q8WW36 | ZCCHC13 | 0.82554 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 6 | Q9Y263 | PLAA | 0.82554 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
| 7 | Q9NZ38 | IDI2-AS1 | 0.82554 | |
| 8 | Q8NHA8 | OR1F12 | 0.80125 | signal transduction GO:0007165 |
| 9 | Q6ZTR6 | ZNF516-DT | 0.75022 | |
| 10 | P04632 | CAPNS1 | 0.72835 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell death GO:0008219 ... |
20 40 60 80 100 AA: MTCCQTSFCGYPSFSISGTCGSSCCQPSCCETSCCQPRSCQTSFCGFPSFSTSGTCSSSCCQPSCCETSCCQPSCCETSCCQPSCCQISSCGTGCGIGGG STMI: DO_DISOPRED3: .............................................................................................D...DD. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: .............................................................................................DDDDDDD CONSENSUS_MOBI: .................................................................................................... RICH_[G]: GcGiGGG RICH_[GI]: GcGIGGG RICH_fLPS_[G]: GcGiGGG
120 140 160 AA: ISYGQEGSSGAVSTRIRWCRPDSRVEGTYLPPCCVVSCTPPSCCQLHHAQASCCRPSYCGQSCCRPVCCCEPTC STMI: DO_DISOPRED3: DDDDDD.D.................................................................. DO_IUPRED2A: .......................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDD.... CONSENSUS: DDDDDDDD.................................................................. CONSENSUS_MOBI: .......................................................................... RICH_[G]: isyGqeG RICH_[GI]: IsyGqeG RICH_fLPS_[G]: isyGqeGs