Q9H082 RB33B_HUMAN
Gene name: RAB33B
Protein name: Ras-related protein Rab-33B
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- catabolic process GO:0009056
- cellular component assembly GO:0022607
- protein transport GO:0015031
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | A8MW99 | MEI4 | 0.65454 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell differentiation GO:0030154 ... |
| 2 | Q8WVD5 | RNF141 | 0.64655 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 |
| 3 | Q6UX06 | OLFM4 | 0.63795 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 4 | Q13641 | TPBG | 0.60045 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell junction organization GO:0034330 ... |
| 5 | Q8TBY0 | RBM46 | 0.59864 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 catabolic process GO:0009056 ... |
| 6 | Q86WI1 | PKHD1L1 | 0.59837 | immune system process GO:0002376 |
| 7 | Q9NRW7 | VPS45 | 0.59837 | protein transport GO:0015031 response to stress GO:0006950 transport GO:0006810 ... |
| 8 | P31358 | CD52 | 0.59418 | homeostatic process GO:0042592 |
| 9 | O15520 | FGF10 | 0.59339 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 10 | Q7Z7C7 | STRA8 | 0.58154 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
20 40 60 80 100 AA: MAEEMESSLEASFSSSGAVSGASGFLPPARSRIFKIIVIGDSNVGKTCLTYRFCAGRFPDRTEATIGVDFRERAVEIDGERIKIQLWDTAGQERFRKSMV STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDD........................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDD........................................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[S]: SSleaSfSSSgavSgaS RICH_[EM]: MaEEMEsslE RICH_[ES]: EEmESSlEaSfSSSgavS RICH_[FS]: SFSSSgavSgaSgF RICH_[GS]: SSGavSGaSG RICH_fLPS_[S]: eSSleaSfSSSgavS
120 140 160 180 200 AA: QHYYRNVHAVVFVYDMTNMASFHSLPSWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLK STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .........................................................................DDDDDDD.................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 AA: SHKPLMLSQPPDNGIILKPEPKPAMTCWC STMI: DO_DISOPRED3: .....DDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: .........DDDDD.D............. DO_SPOTD: ...DDDDDDDDDDDDDDDDDDDDDDDD.. CONSENSUS: .....DDDDDDDDDDDDDDDDDDDDDD.. CONSENSUS_MOBI: ............................. RICH_[IP]: PPdngIIlkPePkP