Q8IZ96 CKLF1_HUMAN

Gene name: CMTM1
Protein name: CKLF-like MARVEL transmembrane domain-containing protein 1

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P15941 MUC1 0.94492 biosynthetic process GO:0009058
cell adhesion GO:0007155
cell cycle GO:0007049
...
2 Q9NQ31 AKIP1 0.89443 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
3 P56746 CLDN15 0.88492 cell adhesion GO:0007155
cell junction organization GO:0034330
cellular component assembly GO:0022607
...
4 Q96GV9 MACIR 0.87416 cellular component assembly GO:0022607
protein transport GO:0015031
response to stress GO:0006950
...
5 A6NH21 SERINC4 0.81373 biosynthetic process GO:0009058
6 O43555 GNRH2 0.81347 anatomical structure development GO:0048856
reproduction GO:0000003
signal transduction GO:0007165
7 Q93038 TNFRSF25 0.80779 cell death GO:0008219
signal transduction GO:0007165
8 O14531 DPYSL4 0.79947 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
9 Q69YG0 TMEM42 0.78087
10 Q14164 IKBKE 0.76877 biological process involved in symbiotic interaction GO:0044403
cell death GO:0008219
cellular protein modification process GO:0006464
...

                                           20                  40                  60                  80                 100
AA:                      MDPEHAKPESSEAPSGNLKQPETAAALSLILGALACFIITQANESFITITSLEICIVVFFILIYVLTLHHLLTYLHWPLLDLTNSIITAVFLSVVAILAM
STMI:                                         MMMMMMMMMMMMMMMMMMMMM   MMMMMMMMMMMMMMMMMMMMM            MMMMMMMMMMMMMMMMMMMMM 
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDD.D......................................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDD....................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D.....DDDDDDDDDDDDDDDDD.......................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDD                     ...                     ............                     .
CONSENSUS_MOBI:          .....................                     ...                     ............                     .

                                          120                 140                 160           
AA:                      QEKKRRHLLYVGGSLCLTAVIVCCIDAFVVTTKMRTNLKRFLGVEVERKLSPAKDAYPETGPDAPQRPA
STMI:                             MMMMMMMMMMMMMMMMMMMMM                                       
DO_DISOPRED3:            .............................................DDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ........................................................DDDDDDDDDDDDD
DO_SPOTD:                .........................................DDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               .........                     ...............DDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .........                     .......................................
RICH_[AP]:                                                                  PAkdAyPetgPdAPqrPA