Q9NVP2 ASF1B_HUMAN
Gene name: ASF1B
Protein name: Histone chaperone ASF1B
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- cellular component assembly GO:0022607
- chromosome organization GO:0051276
- embryo development GO:0009790
- protein-containing complex assembly GO:0065003
- reproduction GO:0000003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9Y3E2 | BOLA1 | 0.68305 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 2 | Q6PL45 | BRICD5 | 0.63486 | cell population proliferation GO:0008283 |
| 3 | Q8IZJ1 | UNC5B | 0.6019 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell death GO:0008219 ... |
| 4 | Q86X76 | NIT1 | 0.59916 | |
| 5 | Q9UF12 | PRODH2 | 0.59355 | catabolic process GO:0009056 small molecule metabolic process GO:0044281 |
| 6 | Q9BV87 | CNPPD1 | 0.57616 | cell cycle GO:0007049 cellular protein modification process GO:0006464 |
| 7 | Q9BXL8 | CDCA4 | 0.53472 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 8 | Q9NXV2 | KCTD5 | 0.53374 | biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 cellular component assembly GO:0022607 ... |
| 9 | Q5SWW7 | C10orf55 | 0.52413 | |
| 10 | O75333 | TBX10 | 0.49377 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
20 40 60 80 100 AA: MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCT STMI: DO_DISOPRED3: D................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200 AA: YHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMD STMI: DO_DISOPRED3: ............................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ......................DD...DD....DD................................................................. DO_SPOTD: .......................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ............................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ......................................................DDDD.......................................... RICH_[G]: GlGlpGcipG RICH_[CG]: GCGlplnCtpikGlGlpGCipG RICH_[CL]: LgCgLpLnCtpikgLgLpgCipgLL RICH_[CP]: PslgCglPlnCtPikglglP RICH_[GI]: IkGlGlpGcI RICH_[GL]: LGcGLpLnctpikGLGLpGcipGLL RICH_[GP]: PslGcGlPlnctPikGlGlP RICH_[LP]: PsLgcgLPLnctPikgLgLP
AA: CI STMI: DO_DISOPRED3: DD DO_IUPRED2A: .. DO_SPOTD: DD CONSENSUS: DD CONSENSUS_MOBI: ..