Q9NZH4 PTTG3_HUMAN

Gene name: PTTG3P
Protein name: Putative pituitary tumor-transforming gene 3 protein

List of terms from Generic GO subset, which this protein is a part of:
- cell cycle GO:0007049
- chromosome organization GO:0051276
- chromosome segregation GO:0007059
- mitotic cell cycle GO:0000278
- mitotic nuclear division GO:0140014
- reproduction GO:0000003

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9BYG3 NIFK 0.92831 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
2 Q92963 RIT1 0.92084 signal transduction GO:0007165
3 Q9Y324 FCF1 0.90631 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
4 P24844 MYL9 0.8917 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
5 Q16363 LAMA4 0.89069 anatomical structure development GO:0048856
cell adhesion GO:0007155
embryo development GO:0009790
...
6 Q8ND07 BBOF1 0.88787 cellular component assembly GO:0022607
7 Q9H0A0 NAT10 0.88309 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
...
8 Q9NZH5 PTTG2 0.87399 cell cycle GO:0007049
chromosome organization GO:0051276
chromosome segregation GO:0007059
...
9 A8MYV0 DCDC2C 0.86803 signal transduction GO:0007165
10 Q1ED39 KNOP1 0.86261

                                           20                  40                  60                  80                 100
AA:                      MATLIYVDKENEEPGILVATKDGLKLGSGPSIKALDGRSQVSISCFGKTFDAPTSLPKATRKALGTVNRATEKSVKTNGPLKQKQPSFSAKKMTEKTVKA
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             .................DDDD.......DD...........................DD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDD
DO_SPOTD:                DDDD....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDD....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ....................................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[AT]:                                                                  ApTslpkATrkAlgTvnrAT                             
RICH_[K]:                                                                         KatrKalgtvnrateKsvK     KqKqpsfsaKKmteKtvKa
RICH_[T]:                                                                TfdapTslpkaTrkalgT                                  
RICH_[KT]:                                                                        KaTrKalgTvnraTeKsvKT                       
RICH_fLPS_[K]:                                                                                            KqKqpsfsaKKmteKtvKa
RICH_MOBI_[K]:                                                                                   KsvKtngplKqKqpsfsaKKmteKtvKa
RICH_fLPS_MOBI_[K]:                                                                                       KqKqpsfsaKKmteKtvKa

                                          120                 140                 160                 180                 200
AA:                      KNSVPASDDGYPEIEKLFPFNPLGFESFDLPEEHQIAHLPLSEVPLMILDEERELEKLFQLGPPSPLKMPSPPWKSNLLQSPLSILLTLDVELPPVCSDI
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDD..........................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....
DO_IUPRED2A:             DDDDDD....................................................DDDDD..DD..DDDDD..........................
DO_SPOTD:                DDDDDDDDDD.......................................................................................DDD
CONSENSUS:               DDDDDDD..........................................................DDDDDDDDD..........................
CONSENSUS_MOBI:          DDDDDD..............................................................................................
RICH_[K]:                K                                                                                                   
RICH_fLPS_[K]:           K                                                                                                   
RICH_MOBI_[K]:           K                                                                                                   
RICH_fLPS_MOBI_[K]:      K                                                                                                   

                                           
AA:                      DI
STMI:                      
DO_DISOPRED3:            ..
DO_IUPRED2A:             ..
DO_SPOTD:                DD
CONSENSUS:               ..
CONSENSUS_MOBI:          ..