Q9P0N8 MARH2_HUMAN
Gene name: MARCHF2
Protein name: E3 ubiquitin-protein ligase MARCHF2
List of terms from Generic GO subset, which this protein is a part of:
- cellular protein modification process GO:0006464
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6UXN8 | CLEC9A | 0.7594 | cell-cell signaling GO:0007267 protein transport GO:0015031 transport GO:0006810 ... |
| 2 | Q9HBK9 | AS3MT | 0.7402 | small molecule metabolic process GO:0044281 |
| 3 | P61225 | RAP2B | 0.67535 | cell adhesion GO:0007155 cellular protein modification process GO:0006464 immune system process GO:0002376 ... |
| 4 | Q9UC07 | ZNF69 | 0.67535 | |
| 5 | Q9H4E5 | RHOJ | 0.67315 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell morphogenesis GO:0000902 ... |
| 6 | Q96GX9 | APIP | 0.67304 | biosynthetic process GO:0009058 cell death GO:0008219 cellular component assembly GO:0022607 ... |
| 7 | Q14525 | KRT33B | 0.63175 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 |
| 8 | P60409 | KRTAP10-7 | 0.61905 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 9 | Q8N1N5 | CRIPAK | 0.61062 | cellular protein modification process GO:0006464 cytoskeleton organization GO:0007010 signal transduction GO:0007165 |
| 10 | P60411 | KRTAP10-9 | 0.60437 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
20 40 60 80 100 AA: MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLSS STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................ CONSENSUS_MOBI: .................................................................................................... RICH_[C]: CChlpgslCdC RICH_[V]: VVeatglgppqyVaqV RICH_fLPS_[C]: mttgdCChlpgslCdCsgsp
120 140 160 180 200 AA: SNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCCDMVCFLFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLVSFRYH STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .......................DDDDD........................................................................ DO_SPOTD: .................................................................................................... CONSENSUS: ..................................... ................ ..... CONSENSUS_MOBI: ..................................... ................ .....
220 240 AA: CQLYSEWRKTNQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV STMI: DO_DISOPRED3: ......................DDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: .................DDDD......................... DO_SPOTD: ....................DDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ....................DDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: .............................................. RICH_[AL]: LAAgLLkkvA