Q9P2W6 CK021_HUMAN

Gene name: C11orf21
Protein name: Uncharacterized protein C11orf21

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q96HR3 MED30 0.55018 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
2 Q8WTV0 SCARB1 0.50655 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
3 Q01581 HMGCS1 0.49775 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
...
4 Q8N531 FBXL6 0.49605 catabolic process GO:0009056
5 O95208 EPN2 0.49039 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
membrane organization GO:0061024
...
6 P48067 SLC6A9 0.4803 cell-cell signaling GO:0007267
circulatory system process GO:0003013
transport GO:0006810
7 Q8N884 CGAS 0.47553 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
cell-cell signaling GO:0007267
...
8 Q5SXM8 DNLZ 0.46725 protein folding GO:0006457
protein targeting GO:0006605
protein transport GO:0015031
...
9 P0DKB6 MPC1L 0.46649 transmembrane transport GO:0055085
transport GO:0006810
10 Q2NL68 PROSER3 0.4607

                                           20                  40                  60                  80                 100
AA:                      MGRTWCGMWRRRRPGRRSAVPRWPHLSSQSGVEPPDRWTGTPGWPSRDQEAPGSMMPPAAAQPSAHGALVPPATAHEPVDHPALHWLACCCCLSLPGQLP
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDD....................................DDDDDDDDDD.......................................
DO_IUPRED2A:             ................D.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................
CONSENSUS_MOBI:          ................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........................
RICH_[PW]:                                   PrWPhlssqsgvePPdrW                                                              
RICH_[AM]:                                                                 ApgsMMppAAAqpsA                                   
RICH_[AP]:                                                        PgwPsrdqeAPgsmmPPAAAqPsAhgA                                
RICH_[A]:                                                                  ApgsmmppAAAqpsAhgA                                
RICH_[RW]:                 RtWcgmWRRRRpgRRsavpRW                                                                             
RICH_[R]:                  RtwcgmwRRRRpgRRsavpR                                                                              
RICH_[W]:                    WcgmWrrrrpgrrsavprW                                                                             
RICH_[MR]:               MgRtwcgMwRRRR                                                                                       
RICH_fLPS_[R]:             RtwcgmwRRRRpgRRsavpR                                                                              
RICH_fLPS_[RW]:            RtWcgmWRRRRpgRRsavpRW                                                                             
RICH_fLPS_[W]:              tWcgmWrrrrpgrrsavprW                                                                             
RICH_MOBI_[AM]:                                                            ApgsMMppAAAqpsAhgAlvppA                           
RICH_MOBI_[A]:                                                             ApgsmmppAAAqpsAhgA                                
RICH_MOBI_[W]:                                 WphlssqsgveppdrW                                                              
RICH_MOBI_[MW]:                                               WtgtpgWpsrdqeapgsMM                                            
RICH_fLPS_MOBI_[A]:                                                                AAAqpsAhgAlvppA                           

                                          120        
AA:                      LAIRLGWDLDLEAGPSSGKLCPRARRWQPLPS
STMI:                                                    
DO_DISOPRED3:            ...............................D
DO_IUPRED2A:             ..................DDDDDDD......D
DO_SPOTD:                .............DDDDDD.....DD.DDDDD
CONSENSUS:               ..................D.....D......D
CONSENSUS_MOBI:          ................................