Q9UF11 PKHB1_HUMAN
Gene name: PLEKHB1
Protein name: Pleckstrin homology domain-containing family B member 1
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P0C879 | n/a | 0.55126 | |
| 2 | P04818 | TYMS | 0.53241 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 3 | O75388 | GPR32 | 0.52967 | homeostatic process GO:0042592 immune system process GO:0002376 response to stress GO:0006950 ... |
| 4 | Q8IUK8 | CBLN2 | 0.518 | anatomical structure development GO:0048856 cell junction organization GO:0034330 cell-cell signaling GO:0007267 ... |
| 5 | Q8TEF2 | C10orf105 | 0.51755 | |
| 6 | Q6P5S7 | RNASEK | 0.50327 | |
| 7 | Q8N7L0 | FAM216B | 0.50227 | |
| 8 | Q8NCU8 | MTLN | 0.48237 | cellular component assembly GO:0022607 homeostatic process GO:0042592 protein-containing complex assembly GO:0065003 |
| 9 | Q7Z340 | ZNF551 | 0.48112 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 10 | P42679 | MATK | 0.48104 | cell population proliferation GO:0008283 cellular protein modification process GO:0006464 signal transduction GO:0007165 |
20 40 60 80 100 AA: MSPAAPVPPDSALESPFEEMALVRGGWLWRQSSILRRWKRNWFALWLDGTLGYYHDETAQDEEDRVLIHFNVRDIKIGPECHDVQPPEGRSRDGLLTVNL STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDD.................................................................................... DO_IUPRED2A: DDDDDDDDDDDD....................................................................DDDDDDDDD..DDDD..... DO_SPOTD: DDDDDDDDDDDDDDD..................................................................................... CONSENSUS: DDDDDDDDDDDDDDD..................................................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[AP]: PAAPvPPdsA
120 140 160 180 200 AA: REGGRLHLCAETKDDALAWKTALLEANSTPAPAGATVPPRSRRVCSKVRCVTRSWSPCKVERRIWVRVYSPYQDYYEVVPPNAHEATYVRSYYGPPYAGP STMI: DO_DISOPRED3: ..............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDD..DDDDDDDDDDDDDDDDDDDDDDDD.. DO_IUPRED2A: .............................DDDDDDDD............................................................... DO_SPOTD: ............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................... CONSENSUS: .............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................... CONSENSUS_MOBI: .................................................................................................... RICH_[PR]: PaPagatvPPRsRRvcskvR RICH_[AP]: PAPAgAtvPP RICH_[C]: CskvrCvtrswspC RICH_[RV]: VppRsRRVcskVRcVtR RICH_[R]: RsRRvcskvRcvtR RICH_[V]: VpprsrrVcskVrcV RICH_[CR]: RsRRvCskvRCvtRswspC RICH_[CV]: VpprsrrVCskVrCVtrswspC
220 240 AA: GVTHVIVREDPCYSAGAPLAMGMLAGAATGAALGSLMWSPCWF STMI: DO_DISOPRED3: ........................................... DO_IUPRED2A: ........................................... DO_SPOTD: .....................................DDDDDD CONSENSUS: ........................................... CONSENSUS_MOBI: ...........................................