Q9UJW9 SRTD3_HUMAN

Gene name: SERTAD3
Protein name: SERTA domain-containing protein 3

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- growth GO:0040007

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q06495 SLC34A1 0.79155 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cellular nitrogen compound metabolic process GO:0034641
...
2 O14931 NCR3 0.75706 immune system process GO:0002376
response to stress GO:0006950
signal transduction GO:0007165
3 Q7Z449 CYP2U1 0.74368 catabolic process GO:0009056
small molecule metabolic process GO:0044281
4 Q9NVV9 THAP1 0.70313 biosynthetic process GO:0009058
cell cycle GO:0007049
cell population proliferation GO:0008283
...
5 P27986 PIK3R1 0.69585 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
6 O75147 OBSL1 0.69465 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell cycle GO:0007049
...
7 P17405 SMPD1 0.69055 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
8 O14543 SOCS3 0.6883 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
9 Q14164 IKBKE 0.68714 biological process involved in symbiotic interaction GO:0044403
cell death GO:0008219
cellular protein modification process GO:0006464
...
10 Q9NYA1 SPHK1 0.67737 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...

                                           20                  40                  60                  80                 100
AA:                      MVGGLKRKHSDLEEEEERWEWSPAGLQSYQQALLRISLDKVQRSLGPRAPSLRRHVLIHNTLQQLQAALRLAPAPALPPEPLFLGEEDFSLSATIGSILR
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDD.......................................................DDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ....DDDD.D..DDDDDD..D...............................................DDD......D.D.DD.................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDD................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDD................................................D......DDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDD...............................................................................
RICH_[EF]:                                                                                              EplFlgEEdF           
RICH_[FL]:                                                                                                LFLgeedFsL         
RICH_fLPS_[E]:                krkhsdlEEEEErwE                                                                                
RICH_fLPS_MOBI_[E]:                dlEEEEErwE                                                                                

                                          120                 140                 160                 180    
AA:                      ELDTSMDGTEPPQNPVTPLGLQNEVPPQPDPVFLEALSSRYLGDSGLDDFFLDIDTSAVEKEPARAPPEPPHNLFCAPGSWEWNELDHIMEIILGS
STMI:                                                                                                                    
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................DDDDDDDDDDDDDDDDDD...............
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDD.D.....D.....................DDDDDDDDDDDDDDDDDD.DD..................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........DDDDDDDDDDDDDDDDDDDDDDD..................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............DDDDDDDDDDDDDDDDDDDDD..................
CONSENSUS_MOBI:          ...DDDDDDDDDDDDDDDDDDDDDD.......................................................................
RICH_[AP]:                                                                        AvekePArAPPePPhnlfcA                   
RICH_[P]:                          PPqnPvtPlglqnevPPqPdP                               ParaPPePPhnlfcaP                  
RICH_[LP]:                                PLgLqnevPPqPdPvfLeaL                                                           
RICH_fLPS_[P]:                     PPqnPvtPlglqnevPPqPdP