Q9UMS0 NFU1_HUMAN
Gene name: NFU1
Protein name: NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- protein maturation GO:0051604
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9GZT3 | SLIRP | 0.85749 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
| 2 | Q9Y3D7 | PAM16 | 0.75174 | catabolic process GO:0009056 cell death GO:0008219 cellular nitrogen compound metabolic process GO:0034641 ... |
| 3 | Q92185 | ST8SIA1 | 0.70711 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cell population proliferation GO:0008283 ... |
| 4 | Q9Y697 | NFS1 | 0.70711 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular protein modification process GO:0006464 ... |
| 5 | Q86Y38 | XYLT1 | 0.69617 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 developmental maturation GO:0021700 ... |
| 6 | Q8ND94 | LRRN4CL | 0.68599 | |
| 7 | P01138 | NGF | 0.64453 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 8 | Q8N2K0 | ABHD12 | 0.6412 | catabolic process GO:0009056 cellular protein modification process GO:0006464 response to stress GO:0006950 |
| 9 | Q8TAQ9 | SUN3 | 0.62573 | membrane organization GO:0061024 |
| 10 | Q96EQ8 | RNF125 | 0.6108 | catabolic process GO:0009056 cellular protein modification process GO:0006464 immune system process GO:0002376 ... |
20 40 60 80 100 AA: MAATARRGWGAAAVAAGLRRRFCHMLKNPYTIKKQPLHQFVQRPLFPLPAAFYHPVRYMFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLA STMI: TTTTTTTTT DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................. DO_IUPRED2A: .......................................................................DDDD......................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................ CONSENSUS_MOBI: ........................................................................................... RICH_[AR]: AAvAAglRRR RICH_fLPS_[A]: gAAAvAAglr
120 140 160 180 200 AA: RQLFRIEGVKSVFFGPDFITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPSGEAGSEEDDEVVAMIKELLDTRIRPTVQEDGGDVIYKGFEDG STMI: DO_DISOPRED3: ...........................................................DD....................................... DO_IUPRED2A: ......................................................DDDDDDDDDDDD.................................. DO_SPOTD: ......................................................DDDDDDDDDD.................................... CONSENSUS: ......................................................DDDDDDDDDD.................................... CONSENSUS_MOBI: ....................................................................................................
220 240 AA: IVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQVMDDESDEKEANSP STMI: DO_DISOPRED3: ........................................D.DDDDDDDDDDDD DO_IUPRED2A: ......................................DDDDDDDDDDDDDDDD DO_SPOTD: ..........................................DDDDDDDDDDDD CONSENSUS: ........................................DDDDDDDDDDDDDD CONSENSUS_MOBI: ......................................................