Q9Y2V2 CHSP1_HUMAN

Gene name: CARHSP1
Protein name: Calcium-regulated heat-stable protein 1

List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- cellular nitrogen compound metabolic process GO:0034641
- nucleobase-containing compound catabolic process GO:0034655
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P51512 MMP16 0.83201 anatomical structure development GO:0048856
catabolic process GO:0009056
cell population proliferation GO:0008283
...
2 Q2PZI1 DPY19L1 0.81325 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
3 O43516 WIPF1 0.76241 anatomical structure development GO:0048856
cell morphogenesis GO:0000902
cellular component assembly GO:0022607
...
4 Q96L33 RHOV 0.75841 anatomical structure development GO:0048856
cell morphogenesis GO:0000902
cellular component assembly GO:0022607
...
5 Q9NYG8 KCNK4 0.75188 nervous system process GO:0050877
transmembrane transport GO:0055085
transport GO:0006810
6 A0A1B0GUX0 ATP6V1FNB 0.74702
7 P04180 LCAT 0.74231 biosynthetic process GO:0009058
cellular component assembly GO:0022607
homeostatic process GO:0042592
...
8 Q9H606 PRORY 0.72397
9 P30793 GCH1 0.7193 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
10 Q9HD15 SRA1 0.71049 anatomical structure development GO:0048856
cell cycle GO:0007049
cell death GO:0008219
...

                                           20                  40                  60                  80                 100
AA:                      MSSEPPPPPQPPTHQASVGLLDTPRSRERSPSPLRGNVVPSPLPTRRTRTFSATVRASQGPVYKGVCKCFCRSKGHGFITPADGGPDIFLHISDVEGEYV
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................
RICH_[PR]:                                      PRsReRsPsPlRgnvvPsPlP                                                        
RICH_[RT]:                                                 RgnvvpsplpTRRTRTfsaTvR                                            
RICH_[P]:                    PPPPPqPPthqasvglldtP                                                                            
RICH_[R]:                                        RsReRspsplR                                                                 
RICH_[T]:                                                            TrrTrTfsaT                                              
RICH_fLPS_[P]:           mssePPPPPqPPthqasvglldtP                                                                            
RICH_MOBI_[P]:               PPPPPqPPthqasvglldtP                                                                            
RICH_MOBI_[R]:                                   RsReRspsplR                                                                 
RICH_fLPS_MOBI_[P]:      mssePPPPPqPPthq                                                                                     

                                          120                 140             
AA:                      PVEGDEVTYKMCSIPPKNEKLQAVEVVITHLAPGTKHETWSGHVISS
STMI:                                                                   
DO_DISOPRED3:            ..........................................DD.DD
DO_IUPRED2A:             .........................................DD....
DO_SPOTD:                ..........................................DDDDD
CONSENSUS:               ..........................................DDDDD
CONSENSUS_MOBI:          ...............................................