Citrus Sinensis ID: 000128


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------1450------1460------1470------1480------1490------1500------1510------1520------1530------1540------1550------1560------1570------1580------1590------1600------1610------1620------1630------1640------1650------1660------1670------1680------1690------1700------1710------1720------1730------1740------1750------1760------1770------1780------1790------1800------1810------1820------1830------1840------1850------1860------1870------1880------1890------1900------1910------1920------1930------1940------1950------1960------1970------1980------1990------2000------2010------2020------2030------2040------2050------2060------2070------2080------2090------2100------2110------2120---
MGGEDANVNSIIELSYNFLESEEAKSLFRLCGLLNGGSQIPIDALMRCGMGLGLLKGVYTLQEARKRVHMLVNFLKASRLLLDGDAEECLKMHDIIHSIAASVATEELMFNMQNVADLKEELDKKTHKDPTAISIPFRGIYEFPERLECPKLKLFVLFSENLSLRIPDLFFEGMTELRVLSFTGFRFPSLPSSIGCLISLRTLTLESCLLGDVATIGDLKKLEILSLRHSDVEELPGEIGQLTRLKLLDLSNCMKLKVIRPNVISSLSRLEELYMGNSFTEWEIEGQSNASLVELKQLSRLTTLEVHIPDAQVMPQDLLSVELERYRICIGDVWSWSGEHETSRRLKLSALNKCIYLGYGMQMLLKGIEDLYLDELNGFQNALLELEDGEVFPLLKHLHVQNVCEILYIVNLVGWEHCNAFPLLESLFLHNLMRLEMVYRGQLTEHSFSKLRIIKVCQCDNLKHLFSFPMARNLLQLQKLKVSFCESLKLIVGKESSETHNVHEIINFTQLHSLTLQCLPQLTSSGFDLERPLLSPTISATTLAFEEVIAEDDSDESLFNNKVIFPNLEKLKLSSINIEKIWHDQYPLMLNSCSQNLTNLTVETCSRLKFLFSYSMVDSLVRLQQLEIRKCESMEAVIDTTDIEINSVEFPSLHHLRIVDCPNLRSFISVNSSEEKILHTDTQPLFDEKLVLPRLEVLSIDMMDNMRKIWHHQLALNSFSKLKALEVTNCGKLANIFPANIIMRRRLDRLEYLKVDGCASVEEIIGETSSNGNICVEEEEDEEARRRFVFPRLTWLNLSLLPRLKSFCPGVDISEWPLLKSLGVFGCDSVEILFASPEYFSCDSQRPLFVLDPKVAFPGLKELELNKLPNLLHLWKENSQLSKALLNLATLEISECDKLEKLVPSSVSLENLVTLEVSKCNELIHLMTLSTAESLVKLNRMNVIDCKMLQQIILQVGEEVKKDCIVFGQFKYLGLHCLPCLTSFCLGNFTLEFPCLEQVIVRECPKMKIFSQGVLHTPKLQRLHLREKYDEGLWEGSLNSTIQKLFEEMVGYHDKACLSLSKFPHLKEIWHGQALPVSFFINLRWLVVDDCRFMSGAIPANQLQNLINLKTLEVRNCYFLEQVFHLEEQNPIGQFRSLFPKLRNLKLINLPQLIRFCNFTGRIIELPSLVNLWIENCRNMKTFISSSTPVIIAPNKEPQQMTSQENLLADIQPLFDEKVKLPSLEVLGISQMDNLRKIWQDRLSLDSFCKLNCLVIQRCKKLLSIFPWNMLQRLQKLEKLEVVYCESVQRISELRALNYGDARAISVAQLRETLPICVFPLLTSLKLRSLPRLKCFYPGVHISEWPMLKYLDISGCAELEILASKFLSLGETHVDGQHDSQTQQPFFSFDKVAFPSLKELRLSRLPKLFWLCKETSHPRNVFQNECSKLDILVPSSVSFGNLSTLEVSKCGRLMNLMTISTAERLVNLERMNVTDCKMIQQIIQQVGEVEKDCIVFSQLKYLGLHCLPSLKSFCMGNKALEFPCLEQVIVEECPKMKIFSQGVLHTPKLRRLQLTEEDDEGRWEGNLNSTIQKLFVEMVGFCDLKCLKLSLFPNLKEIWHVQPLPVSFFSNLRSLVIDDCMNFSSAIPANLLRSLNNLEKLEVTNCDSLEEVFHLEEPNADEHYGSLFPKLRKLKLKDLPKLKRFCYFAKGIIELPFLSFMWIESCPNMVTFVSNSTFAHLTATEAPLEMIAEENILADIQPLFDEKVGLPSLEELAILSMDSLRKLWQDELSLHSFYNLKFLGVQKCNKLLNIFPCNMLERLQKLQKLQVLYCSSVREIFELRALSGRDTHTIKAAPLRESDASFVFPQLTSLSLWWLPRLKSFYPQVQISEWPMLKKLDVGGCAEVEIFASEVLSLQETHVDSQHNIQIPQYLFFVDKVAFPSLEELMLFRLPKLLHLWKGNSHPSKVFPNLASLKLSECTKLEKLVPSSMSFQNLTTLEVSKCDGLINLVTCSTAESMVKLVRMSITDCKLIEEIIHPIREDVKDCIVFSQLKYLGLHCLPTLTSFCLGNYTLEFPSLEQVIVMDCLKMMTFSQGALCTPKLHRLQLTEEDDEGCWDGNLNNTIQQLFKRVNFQNSNEED
cccccccccHHHHccccccccccHHHHHcccccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccccccccEEEEccHHHHHHHHHHHcccEEEEEccccccccccccEEEcEEEEEccccccccccccccccccEEEEEccccccccccHHHHcccccEEEEEccccccccccccccccccccEEEcccccccccccccccccccEEcccccccccccHHHcccccccEEEEcccccccccccccccccccccEEEccccccEEEEcccccccHHHHcccccccEEEEEcccccccHHccHHHHcccccccccccccccccccccccEEEcccccccccccccccccccccccEEcccccccccccccccccccccccEEEEEccccEEEEEcccccccccccccccEEEccccccccEEEEccccccccccccEEEEccccccccccccccccccccccEEEEEEcccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccEEEEEccccccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEcccccccccccccccccccccccccEEEEEccccccccccccccccHHcccccccccccccccccccEEEEcccccccHHccccccccccccccEEEEEccccccccccccHHHccccccccEEEEEccccccEEEcccccccccccccccHHHHHcccccccccEEEEccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccEEEcccccccccccccccHHHHccccccEEEEccccccccccccccccccccEEEEccccccccccccccccccccccEEEcccccHHHHHHHcccccccccccccccccEEEEEEccccccccccccccccccccEEEEEcccccccccccccccccccEEEEccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEEEEcccccccccccccccccccccEEEEEccccccEEEcccccccccccccccccccEEEEEccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccEEEEccccccccccccHHccccccccEEEEEEccccccccccccccccccccHHcccccccccccccccccEEEEEcccccccccccccccccccccEEEEcccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEcccccHHHHHcccccccccccccccccEEEEEEcccccEEcccccccccccccEEEEEcccccccccccccccccccEEEEccccccccccccccccHHHHHHHHccccccccccccccccccEEcccccccccccccEEEEEEEccccccccccHHHHcccccccEEEEEccccccEEccccccccccccccccccccEEEEcccccccccccccccccccccccEEEEcccccccEEcccccccccccccccHHHHHHHHcccccccccccccccccccEEEEcccccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEEcccccEEccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccEEcccccccccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccccEEEEcccccccEEccccccccccccccccccEEEEccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEccccccccccccHHHHHHHHHHHcccccccccc
cccccccccHHEEEcHcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccccccccccEEEHHHHHHHHHHHHHcccEEEEEEccccccccccccccccEEEEEEEcccccccccHccccccEEEEEccccccccccHHHHHHHccEEEEEEcccccccccccHHccHcccEEEcccccccccccHccccccEEEEEcccccHHccHHHHccHcccEEEccccccccccccHHHHHHHHccEEEEEcccccccccccccccHHHHHccccccEEEEEcccccccHHHHHHHHHHHccccccccccccccccccccEEEEEcccccccccccccccccccEEEEcccccccccccccccccccccccEEEEEccccEEEcccccccccccccccccEEEEcccHcHHHccccccccccccccEEEEEccccHHcccccccHHcccccccEEEEcccccHHHccccccccccccccccccccccEEEEcccccccccccccccccccHHHHccccccHHHcccccccccccccccccccccEEEEccccHHHHcccccccccccccccccEEEEcccccHHccccccHccccccccEEEEcccccHHcccccccccccccccccccEEEEcccccccEcccccccHHHHHHcccccccccccccccccEEEEcccccccHcccccccccccccccEEEEcccHHHHcccccccccccccccccEEEEcccccHHHccHHcccHHHHHHHHccccccccccccccccEEEEcccccHccccccccccccccccEEEEcccccHHHccHHHccccHccHccccccccccccccccEEEEEcccccHHccccccccccccccccEEEEcccccHccccccccccccccEEEEcccHHHHccccccHHHccHcccEEEEccccccEEccccccccccccccccccccEEEEcccHHHHHccccccccccccccEEEEcccccccEccccccccccccEEEccccccHcccccccccccHHccccHcccccHHHcHHHccccHHHccccccccccccccccEEEEcccHHHHccccHHHHcccccccEEEEcccccHHHcccHccccccccccccccccccccccccHHHHccccccccccccccccEEEEcccccccccccccccHHccccccccEEEEEEccccccccccccccccccccEEEEcccccHHHccccccccccccccEEEEEcccccHcccccccccHHHHHHcEEEccccccHHHccccccccccHHHHcccccccccccccccccccEEEEEccccHHccccccHccccccccEEEEcccccHHHccHHHccccccHHccccccccccccccccccccccccEEEEccccccccccccccccHHHHHcccccHHcccccccccccccEEEEcccHcHHccccccHccccccccEEEEcccccHHHcccccccccccccccccccEEEEccccccccccccccccccccccEEEEccccccccccccccccccccEEEEEcccHHcccccccccHHHHHHHccccccccccccccccccccccccccccccccccccEEEEEcccccHHcccccHHHcccccccEEEEccccccHEccHHcccccccccccccccccEEEEcccccHccccccccccccccccEEEEEccccccccccccccHHHHHHHcccHHHHHHcccccccccccccccccccccEEEEcccHcHHHccccccccccccccEEEEEccccccccccccccccccccccEEEEcccccHHHcccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccEEEEEcccccccccccccccHHHcccHcccccccccccccccccccccccEEEEcccccccEccccccccccccccccEEEEcccccHccccccccccccccEEEEcccccHHHcccccccccHHHccEEEEccccccHHccccccccccccEccccccEEEEccccccccccccccccccccccEEEEEcccccEEcccccccccccEEEEEEcccccccccccHHHHHHHHHHHcccccccccc
MGGEDANVNSIIELSYNFLESEEAKSLFRLCgllnggsqipidALMRCGMGLGLLKGVYTLQEARKRVHMLVNFLKASRLLLDGDAEECLKMHDIIHSIAASVATEELMFNMQNVADLKEELdkkthkdptaisipfrgiyefperlecpklkLFVLFSEnlslripdlffeGMTELRVLSftgfrfpslpssigclislrtltlescllgdvatigdlkKLEILSLrhsdveelpgeigqltrlklldlsncmklkvirpnVISSLSRLEElymgnsfteweiegqsnASLVELKqlsrlttlevhipdaqvmpqDLLSVELERYRICIgdvwswsgehetSRRLKLSALNKCIYLGYGMQMLLKGIEDLYLDELNGFQNALLeledgevfpllkHLHVQNVCEILYIVNLVgwehcnafpLLESLFLHNLMRLEMVYrgqltehsfSKLRIIKVcqcdnlkhlfsfpmARNLLQLQKLKVSFCESLKLivgkessethnVHEIINFTQLhsltlqclpqltssgfdlerpllsptisatTLAFEEViaeddsdeslfnnkvifpnleklklssiNIEKIwhdqyplmlnscsqnltnltvetcSRLKFLFSYSMVDSLVRLQQLEIRKCESMEAVIDttdieinsvefpslhhlrivdcpnlrsfisvnsseekilhtdtqplfdeklvlprleVLSIDMMDNMRKIWHHQLALNSFSKlkalevtncgklanifpaniIMRRRLDRLeylkvdgcaSVEEIIGetssngnicveeeedeEARRRfvfprltwlnlsllprlksfcpgvdisewpllkslgvfgcdsvEILFaspeyfscdsqrplfvldpkvafpglkelelnklpnLLHLWKENSQLSKALLNLATLEIsecdkleklvpssvslenLVTLEVSKCNELIHLMTLSTAESLVKLNRMNVIDCKMLQQIILQVGEEVKKDcivfgqfkylglhclpcltsfclgnftlefpcleqvivrecpkmkifsqgvlhtpklqrLHLREKYdeglwegsLNSTIQKLFEEMVGYHDkaclslskfphlkeiwhgqalpvsfFINLRWLVvddcrfmsgaipanqlqnlinlktlevrncyFLEQVfhleeqnpigqfrslfpklrnlklinlpqlirfCNFTgriielpslVNLWIENCRNMktfissstpviiapnkepqqmTSQENLLADIQplfdekvklpslevlgiSQMDNLRKIWQDRLSLDSFCKLNCLVIQRCKKLLSIFPWNMLQRLQKLEKLEVVYCESVQRISELRALNYGDARAISVAQLRETlpicvfplltslklrslprlkcfypgvhisewpmlkyldisgcAELEILASKFLslgethvdgqhdsqtqqpffsfdkvafpslkelrlsrlpKLFWLcketshprnvfqnecskldilvpssvsfgnlstlevskcgrlmnlmTISTAERLVNLERMNVTDCKMIQQIIQQVGEVEKDCIVFSQlkylglhclpslksfcmgnkalefpcleqviveecpkmkifsqgvlhtpklrrlqlteeddegrwegnLNSTIQKLFVEMVGFcdlkclklslfpnlkeiwhvqplpvsffsnLRSLViddcmnfssaiPANLLRSLNnleklevtncdsleevfhleepnadehygslfpklrklklkdlpklKRFCYFAkgiielpflsfmwiescpnmvtfvsnstfahltateapleMIAEEniladiqplfdekvglpsleELAILSMDSLRKLWQDELSlhsfynlkflgVQKCNKLLNIFPCNMLERLQKLQKLQVLYCSSVREIFELRalsgrdthtikaaplresdasfvfpqltslslwwlprlksfypqvqisewpmlkkldvggcaEVEIFASEVLSLQethvdsqhniqipqylffvdkvafpsLEELMLFRLPkllhlwkgnshpskvfpnlaslklsectkleklvpssmsfqnlttlevskcdglinlvtcSTAESMVKLVRMSITDCKLIEEIIHPIREDVKDCIVFSQlkylglhclptltsfclgnytlefpsleQVIVMDCLKMmtfsqgalctpklhrlqlteeddegcwdgnlnNTIQQLFKRvnfqnsneed
mggedanvnSIIELSYNFLESEEAKSLFRLCGLLNGGSQIPIDALMRCGMGLGLLKGVYTLQEARKRVHMLVNFLKASRLLLDGDAEECLKMHDIIHSIAASVATEELMFNMQNVADLKEELDkkthkdptaisipfrGIYEFPERLECPKLKLFVLFSENLSLRIPDLFFEGMTELRVLSFTGFRFPSLPSSIGCLISLRTLTLESCLLGDVATIGDLKKLEILSLrhsdveelpgeigqltrLKLLDLSNCMKLKVIRPNVISSLSRLEELYMGNSFTEWEIEGQSNASLVELKQLSRLTTLevhipdaqvmPQDLLSVELERYRICIGdvwswsgehetSRRLKLSALNKCIYLGYGMQMLLKGIEDLYLDELNGFQNALLELEDGEVFPLLKHLHVQNVCEILYIVNLVGWEHCNAFPLLESLFLHNLMRLEMVYRGQLTEHSFSKLRIIKVCQCDNLKHLFSFPMARNLLQLQKLKVSFCESLKLIVGKESSETHNVHEIINFTQLHSLTLQCLPQLTSSGFDLERPLLSPTISATTLAFEEVIAeddsdeslfnNKVIFPNLEKLKLSSINIEKIWHDQYPLMLNSCSQNLTNLTVETCSRLKFLFSYSMVDSLVRLQQLEIRKCESMEAVIDTTDIEINSVEFPSLHHLRIVDCPNLRSFISVNSSEEKIlhtdtqplfdeklvLPRLEVLSIDMMDNMRKIWHHQLALNSFSKLKALEVTNCgklanifpaniiMRRRLDRLEYLKVDGCASVEeiigetssngnicVEEEEDEEARRRFVFPRLTWLNLSLLPRLKSFCPGVDISEWPLLKSLGVFGCDSVEILFASPEYFSCDSQRPLFVLDPKVAFPGLKELELNKLPNLLHLWKENSQLSKALLNLATLEISECDKLEKLVPSSVSLENLVTLEVSKCNELIHLMTLSTAESLVKLNRMNVIDCKMLQQIILQVGEEVKKDCIVFGQFKYLGLHCLPCLTSFCLGNFTLEFPCLEQVIVRECPKMKIfsqgvlhtpklqrLHLREKYDEGLWEGSLNSTIQKLFEEMVGYHDKACLSLSKFPHLKEIWHGQALPVSFFINLRWLVVDDCRFMSGAIPANQLQNLINLKTLEVRNCYFLEQVFHLEEQNPIGQFRSLFPKLRNLKLINLPQLIRFCNFTGRIIELPSLVNLWIENCRNMKTFISSSTPVIIAPNKEPQQMTSQENLLADIQPLFDEKVKLPSLEVLGISQMDNLRKIWQDRLSLDSFCKLNCLVIQRCKKLLSIFPWNMLQRLQKLEKLEVVYCESVQRISELRALNYGDARAISVAQLRETLPICVFPLltslklrslprLKCFYPGVHISEWPMLKYLDISGCAELEILASKFLSLGETHVDGQHDSQTQQPFFSFDKVAFPSLKELRLSRLPKLFWLCKETSHPRNVFQNECSKLDILVPSSVSFGNLSTLEVSKCGRLMNLMTISTAERLVNLERMNVTDCKMIQQIIQQVGEVEKDCIVFSQLKYLGLHCLPSLKSFCMGNKALEFPCLEQVIVEECPKMKIfsqgvlhtpklrRLQLteeddegrwegnLNSTIQKLFVEMVGFCDLKCLKLSLFPNLKEIWHVQPLPVSFFSNLRSLVIDDCMNFSSAIPANLLRSLNNLEKLEVTNCDSLEEVFHLeepnadehygslfpklrKLKLKDLPKLKRFCYFAKGIIELPFLSFMWIESCPNMVTFVSNSTFAHLTATEAPLEMIAEENILADIQPLFDEKVGLPSLEELAILSMDSLRKLWQDELSLHSFYNLKFLGVQKCNKLLNIFPCNMLERLQKLQKLQVLYCSSVREIFElralsgrdtHTIKAaplresdasfVFPQLTSLSLWWLPRLKSFYPQVQISEWPMLKKLDVGGCAEVEIFASEVLSLQETHVDSQHNIQIPQYLFFVDKVAFPSLEELMLFRLPKLLHLWKGNSHPSKVFPNLASLKLSECTKLEKlvpssmsfqnLTTLEVSKCDGLINLVTCSTAESMVKLVRMSITDCKLIEEIIHPIREDVKDCIVFSQLKYLGLHCLPTLTSFCLGNYTLEFPSLEQVIVMDCLKMMTFSQGALCTPKLHRLQLTEEDDEGCWDGNLNNTIQQLfkrvnfqnsneed
MGGEDANVNSIIELSYNFLESEEAKSLFRLCGLLNGGSQIPIDALMRCGMGLGLLKGVYTLQEARKRVHMLVNFLKASRLLLDGDAEECLKMHDIIHSIAASVATEELMFNMQNVADLKEELDKKTHKDPTAISIPFRGIYEFPERLECPKLKLFVLFSENLSLRIPDLFFEGMTELRVLSFTGFRFPSLPSSIGCLISLRTLTLESCLLGDVATIGDLKKLEILSLRHSDVEELPGEIGQLTRLKLLDLSNCMKLKVIRPNVISSLSRLEELYMGNSFTEWEIEGQSNASLVELKQLSRLTTLEVHIPDAQVMPQDLLSVELERYRICIGDVWSWSGEHETSRRLKLSALNKCIYLGYGMQMLLKGIEDLYLDELNGFQNALLELEDGEVFPLLKHLHVQNVCEILYIVNLVGWEHCNAFPLLESLFLHNLMRLEMVYRGQLTEHSFSKLRIIKVCQCDNLKHLFSFPMARNLLQLQKLKVSFCESLKLIVGKESSETHNVHEIINFTQLHSLTLQCLPQLTSSGFDLERPLLSPTISATTLAFEEVIAEDDSDESLFNNKVIFPNLEKLKLSSINIEKIWHDQYPLMLNSCSQNLTNLTVETCSRLKFLFSYSMVDSLVRLQQLEIRKCESMEAVIDTTDIEINSVEFPSLHHLRIVDCPNLRSFISVNSSEEKILHTDTQPLFDEKLVLPRLEVLSIDMMDNMRKIWHHQLALNSFSKLKALEVTNCGKLANIFPANIIMRRRLDRLEYLKVDGCASVEEIIGETSSNGNICVeeeedeeARRRFVFPRLTWLNLSLLPRLKSFCPGVDISEWPLLKSLGVFGCDSVEILFASPEYFSCDSQRPLFVLDPKVAFPGlkelelnklpnllhlWKENSQLSKALLNLATLEISECDKLEKLVPSSVSLENLVTLEVSKCNELIHLMTLSTAESLVKLNRMNVIDCKMLQQIILQVGEEVKKDCIVFGQFKYLGLHCLPCLTSFCLGNFTLEFPCLEQVIVRECPKMKIFSQGVLHTPKLQRLHLREKYDEGLWEGSLNSTIQKLFEEMVGYHDKACLSLSKFPHLKEIWHGQALPVSFFINLRWLVVDDCRFMSGAIPANQLQNLINLKTLEVRNCYFLEQVFHLEEQNPIGQFRSLFPKLRNLKLINLPQLIRFCNFTGRIIELPSLVNLWIENCRNMKTFISSSTPVIIAPNKEPQQMTSQENLLADIQPLFDEKVKLPSLEVLGISQMDNLRKIWQDRLSLDSFCKLNCLVIQRCKKLLSIFPWNMLQRLQKLEKLEVVYCESVQRISELRALNYGDARAISVAQLRETLPICVFPLLTSLKLRSLPRLKCFYPGVHISEWPMLKYLDISGCAELEILASKFLSLGETHVDGQHDSQTQQPFFSFDKVAFPSLKELRLSRLPKLFWLCKETSHPRNVFQNECSKLDILVPSSVSFGNLSTLEVSKCGRLMNLMTISTAERLVNLERMNVTDCKMiqqiiqqVGEVEKDCIVFSQLKYLGLHCLPSLKSFCMGNKALEFPCLEQVIVEECPKMKIFSQGVLHTPKLRRLQLTEEDDEGRWEGNLNSTIQKLFVEMVGFCDLKCLKLSLFPNLKEIWHVQPLPVSFFSNLRSLVIDDCMNFSSAIPANLLRSLNNLEKLEVTNCDSLEEVFHLEEPNADEHYGSlfpklrklklkdlpklkrfCYFAKGIIELPFLSFMWIESCPNMVTFVSNSTFAHLTATEAPLEMIAEENILADIQPLFDEKVGLPSLEELAILSMDSLRKLWQDELSLHSFYNLKFLGVQKCNKLLNIFPCNMLERLQKLQKLQVLYCSSVREIFELRALSGRDTHTIKAAPLRESDASFVFPQLTSLSLWWLPRLKSFYPQVQISEWPMLKKLDVGGCAEVEIFASEVLSLQETHVDSQHNIQIPQYLFFVDKVAFPSLEELMLFRLPKLLHLWKGNSHPSKVFPNLASLKLSECTKLEKLVPSSMSFQNLTTLEVSKCDGLINLVTCSTAESMVKLVRMSITDCKLIEEIIHPIREDVKDCIVFSQLKYLGLHCLPTLTSFCLGNYTLEFPSLEQVIVMDCLKMMTFSQGALCTPKLHRLQLTEEDDEGCWDGNLNNTIQQLFKRVNFQNSNEED
********NSIIELSYNFLESEEAKSLFRLCGLLNGGSQIPIDALMRCGMGLGLLKGVYTLQEARKRVHMLVNFLKASRLLLDGDAEECLKMHDIIHSIAASVATEELMFNMQNVADL***********PTAISIPFRGIYEFPERLECPKLKLFVLFSENLSLRIPDLFFEGMTELRVLSFTGFRFPSLPSSIGCLISLRTLTLESCLLGDVATIGDLKKLEILSLRHSDVEELPGEIGQLTRLKLLDLSNCMKLKVIRPNVISSLSRLEELYMGNSFTEWEIEGQSNASLVELKQLSRLTTLEVHIPDAQVMPQDLLSVELERYRICIGDVWSWSGEHETSRRLKLSALNKCIYLGYGMQMLLKGIEDLYLDELNGFQNALLELEDGEVFPLLKHLHVQNVCEILYIVNLVGWEHCNAFPLLESLFLHNLMRLEMVYRGQLTEHSFSKLRIIKVCQCDNLKHLFSFPMARNLLQLQKLKVSFCESLKLIVGKESSETHNVHEIINFTQLHSLTLQCLPQLTSSGFDLERPLLSPTISATTLAFEEVIAEDDSDESLFNNKVIFPNLEKLKLSSINIEKIWHDQYPLMLNSCSQNLTNLTVETCSRLKFLFSYSMVDSLVRLQQLEIRKCESMEAVIDTTDIEINSVEFPSLHHLRIVDCPNLRSFISVNSSEEKILHTDTQPLFDEKLVLPRLEVLSIDMMDNMRKIWHHQLALNSFSKLKALEVTNCGKLANIFPANIIMRRRLDRLEYLKVDGCASVEEIIG********************RFVFPRLTWLNLSLLPRLKSFCPGVDISEWPLLKSLGVFGCDSVEILFASPEYFSCDSQRPLFVLDPKVAFPGLKELELNKLPNLLHLWKENSQLSKALLNLATLEISECDKLEKLVPSSVSLENLVTLEVSKCNELIHLMTLSTAESLVKLNRMNVIDCKMLQQIILQVGEEVKKDCIVFGQFKYLGLHCLPCLTSFCLGNFTLEFPCLEQVIVRECPKMKIFSQGVLHTPKLQRLHLREKYDEGLWEGSLNSTIQKLFEEMVGYHDKACLSLSKFPHLKEIWHGQALPVSFFINLRWLVVDDCRFMSGAIPANQLQNLINLKTLEVRNCYFLEQVFHLEEQNPIGQFRSLFPKLRNLKLINLPQLIRFCNFTGRIIELPSLVNLWIENCRNMKTFISSSTPVII**************LLADIQPLFDEKVKLPSLEVLGISQMDNLRKIWQDRLSLDSFCKLNCLVIQRCKKLLSIFPWNMLQRLQKLEKLEVVYCESVQRISELRALNYGDARAISVAQLRETLPICVFPLLTSLKLRSLPRLKCFYPGVHISEWPMLKYLDISGCAELEILASKFLSLGETHVD********QPFFSFDKVAFPSLKELRLSRLPKLFWLCKETSHPRNVFQNECSKLDILVPSSVSFGNLSTLEVSKCGRLMNLMTISTAERLVNLERMNVTDCKMIQQIIQQVGEVEKDCIVFSQLKYLGLHCLPSLKSFCMGNKALEFPCLEQVIVEECPKMKIFSQGVLHTPKLRRLQLTEE*DEGRWEGNLNSTIQKLFVEMVGFCDLKCLKLSLFPNLKEIWHVQPLPVSFFSNLRSLVIDDCMNFSSAIPANLLRSLNNLEKLEVTNCDSLEEVFHLEEPNADEHYGSLFPKLRKLKLKDLPKLKRFCYFAKGIIELPFLSFMWIESCPNMVTFVSNSTFAHLTATEAPLEMIAEENILADIQPLFDEKVGLPSLEELAILSMDSLRKLWQDELSLHSFYNLKFLGVQKCNKLLNIFPCNMLERLQKLQKLQVLYCSSVREIFELRALSGRDTHTIKAAPLRESDASFVFPQLTSLSLWWLPRLKSFYPQVQISEWPMLKKLDVGGCAEVEIFASEVLSLQETHVDSQHNIQIPQYLFFVDKVAFPSLEELMLFRLPKLLHLWKGNSHPSKVFPNLASLKLSECTKLEKLVPSSMSFQNLTTLEVSKCDGLINLVTCSTAESMVKLVRMSITDCKLIEEIIHPIREDVKDCIVFSQLKYLGLHCLPTLTSFCLGNYTLEFPSLEQVIVMDCLKMMTFSQGALCTPKLHRLQLTEEDDEGCWDGNLNNTIQQLFKRVN********
***EDANVNSIIELSYNFLESEEAKSLFRLCGLLNGGSQIPIDALMRCGMGLGLLKGVYTLQEARKRVHMLVNFLKASRLLLDGDAEECLKMHDIIHSIAASVATEELMFNMQNVA**KEELDKKTHKDPTAISIPFRGIYEFPERLECPKLKLFVLFSENLSLRIPDLFFEGMTELRVLSFTGFRFPSLPSSIGCLISLRTLTLESCLLGDVATIGDLKKLEILSLRHSDVEELPGEIGQLTRLKLLDLSNCMKLKV*******SLSRLEELYMGNSFTEWEIEG***A*L*ELKQLSRLTTLEVHIPDAQVMPQDLLSVELERYRICIGDVWSWSGEHETSRRLKLSALNKCIYLGYGMQMLLKGIEDLYLDELNGFQNALLELEDGEVFPLLKHLHVQNVCEILYIVNLVGWEHCNAFPLLESLFLHNLMRLEMVYRGQLTEHSFSKLRIIKVCQCDNLKHLFSFPMARNLLQLQKLKVSFCESLKLIV************IINFTQLHSLTLQCLPQLTSSGFDLERPLLSPTISATTLAFEEVIAEDDSDESLFNNKVIFPNLEKLKLSSINIEKIWHDQYPLMLNSCSQNLTNLTVETCSRLKFLFSYSMVDSLVRLQQLEIRKCESMEAVIDTTDIEINSVEFPSLHHLRIVDCPNLRSFISVNSSEEKILHTDTQPLFDEKLVLPRLEVLSIDMMDNMRKIWHHQLALNSFSKLKALEVTNCGKLANIFPANIIMRRRLDRLEYLKVDGCASVEEIIGETSSNGNICVEEEEDEEARRRFVFPRLTWLNLSLLPRLKSFCPGVDISEWPLLKSLGVFGCDSVEILFASPEYFSCDSQRPLFVLDPKVAFPGLKELELNKLPNLLHLWKENSQLSKALLNLATLEISECDKLEKLVPSSVSLENLVTLEVSKCNELIHLMTLSTAESLVKLNRMNVIDCKMLQQIILQVGEEVKKDCIVFGQFKYLGLHCLPCLTSFCLGNFTLEFPCLEQVIVRECPKMKIFSQGVLHTPKLQRLHLREKYDEGLWEGSLNSTIQKLFEEMVGYHDKACLSLSKFPHLKEIWHGQALPVSFFINLRWLVVDDCRFMSGAIPANQLQNLINLKTLEVRNCYFLEQVFHL**************KLRNLKLINLPQLIRFCNFTGRIIELPSLVNLWIENCRNMKTFISSSTPVIIAPNKEPQQMTSQENLLADIQPLFDEKVKLPSLEVLGISQMDNLRKIWQDRLSLDSFCKLNCLVIQRCKKLLSIFPWNMLQRLQKLEKLEVVYCESVQRISELRALNYGDARAISVAQLRETLPICVFPLLTSLKLRSLPRLKCFYPGVHISEWPMLKYLDISGCAELEILASKFLSLGETHVDGQHDSQTQQPFFSFDKVAFPSLKELRLSRLPKLFWLCKETSHPRNVFQNECSKLDILVPSSVSFGNLSTLEVSKCGRLMNLMTISTAERLVNLERMNVTDCKMIQQIIQQVGE**K*CIVFSQLKYLGLHCLPSLKSFCMGNKALEFPCLEQVIVEECPKMKIFSQGVLHTPKLRRLQLTEEDDEGRWEGNLNSTIQKLFVEMVGFCDLKCLKLSLFPNLKEIWHVQPLPVSFFSNLRSLVIDDCMNFSSAIPANLLRSLNNLEKLEVTNCDSLEEVFHLEE*********LFPKLRKLKLKDLPKLKRFCYFAKGIIELPFLSFMWIESCPNMVTFVSNSTFAHLTATEAPLEMIAEENILADIQPLFDEKVGLPSLEELAILSMDSLRKLWQDELSLHSFYNLKFLGVQKCNKLLNIFPCNMLERLQKLQKLQVLYCSSVREIFELRALSGRDTHTIKAAPLRESDASFVFPQLTSLSLWWLPRLKSFYPQVQISEWPMLKKLDVGGCAEVEIFASEVLSLQETHVDSQHNIQIPQYLFFVDKVAFPSLEELMLFRLPKLLHLWKGNSHPSKVFPNLASLKLSECTKLEKLVPSSMSFQNLTTLEVSKCDGLINLVTCSTAESMVKLVRMSITDCKLIEEI************VFSQLKYLGLHCLPTLTSFCLGNYTLEFPSLEQVIVMDCLKMMTFSQGALCTPKLHRLQLTEEDDEGCWDGNLNNTIQQLFKR**********
MGGEDANVNSIIELSYNFLESEEAKSLFRLCGLLNGGSQIPIDALMRCGMGLGLLKGVYTLQEARKRVHMLVNFLKASRLLLDGDAEECLKMHDIIHSIAASVATEELMFNMQNVADLKEELDKKTHKDPTAISIPFRGIYEFPERLECPKLKLFVLFSENLSLRIPDLFFEGMTELRVLSFTGFRFPSLPSSIGCLISLRTLTLESCLLGDVATIGDLKKLEILSLRHSDVEELPGEIGQLTRLKLLDLSNCMKLKVIRPNVISSLSRLEELYMGNSFTEWEIEGQSNASLVELKQLSRLTTLEVHIPDAQVMPQDLLSVELERYRICIGDVWSWSGEHETSRRLKLSALNKCIYLGYGMQMLLKGIEDLYLDELNGFQNALLELEDGEVFPLLKHLHVQNVCEILYIVNLVGWEHCNAFPLLESLFLHNLMRLEMVYRGQLTEHSFSKLRIIKVCQCDNLKHLFSFPMARNLLQLQKLKVSFCESLKLIVGKESSETHNVHEIINFTQLHSLTLQCLPQLTSSGFDLERPLLSPTISATTLAFEEVIAEDDSDESLFNNKVIFPNLEKLKLSSINIEKIWHDQYPLMLNSCSQNLTNLTVETCSRLKFLFSYSMVDSLVRLQQLEIRKCESMEAVIDTTDIEINSVEFPSLHHLRIVDCPNLRSFISVNSSEEKILHTDTQPLFDEKLVLPRLEVLSIDMMDNMRKIWHHQLALNSFSKLKALEVTNCGKLANIFPANIIMRRRLDRLEYLKVDGCASVEEIIGETSSNGNICV********RRRFVFPRLTWLNLSLLPRLKSFCPGVDISEWPLLKSLGVFGCDSVEILFASPEYFSCDSQRPLFVLDPKVAFPGLKELELNKLPNLLHLWKENSQLSKALLNLATLEISECDKLEKLVPSSVSLENLVTLEVSKCNELIHLMTLSTAESLVKLNRMNVIDCKMLQQIILQVGEEVKKDCIVFGQFKYLGLHCLPCLTSFCLGNFTLEFPCLEQVIVRECPKMKIFSQGVLHTPKLQRLHLREKYDEGLWEGSLNSTIQKLFEEMVGYHDKACLSLSKFPHLKEIWHGQALPVSFFINLRWLVVDDCRFMSGAIPANQLQNLINLKTLEVRNCYFLEQVFHLEEQNPIGQFRSLFPKLRNLKLINLPQLIRFCNFTGRIIELPSLVNLWIENCRNMKTFISSSTPVIIAPNKEPQQMTSQENLLADIQPLFDEKVKLPSLEVLGISQMDNLRKIWQDRLSLDSFCKLNCLVIQRCKKLLSIFPWNMLQRLQKLEKLEVVYCESVQRISELRALNYGDARAISVAQLRETLPICVFPLLTSLKLRSLPRLKCFYPGVHISEWPMLKYLDISGCAELEILASKFLSLGETHVDGQHDSQTQQPFFSFDKVAFPSLKELRLSRLPKLFWLCKETSHPRNVFQNECSKLDILVPSSVSFGNLSTLEVSKCGRLMNLMTISTAERLVNLERMNVTDCKMIQQIIQQVGEVEKDCIVFSQLKYLGLHCLPSLKSFCMGNKALEFPCLEQVIVEECPKMKIFSQGVLHTPKLRRLQLTEEDDEGRWEGNLNSTIQKLFVEMVGFCDLKCLKLSLFPNLKEIWHVQPLPVSFFSNLRSLVIDDCMNFSSAIPANLLRSLNNLEKLEVTNCDSLEEVFHLEEPNADEHYGSLFPKLRKLKLKDLPKLKRFCYFAKGIIELPFLSFMWIESCPNMVTFVSNSTFAHLTATEAPLEMIAEENILADIQPLFDEKVGLPSLEELAILSMDSLRKLWQDELSLHSFYNLKFLGVQKCNKLLNIFPCNMLERLQKLQKLQVLYCSSVREIFELRALSGRDTHTIKAAPLRESDASFVFPQLTSLSLWWLPRLKSFYPQVQISEWPMLKKLDVGGCAEVEIFASEVLSLQETHVDSQHNIQIPQYLFFVDKVAFPSLEELMLFRLPKLLHLWKGNSHPSKVFPNLASLKLSECTKLEKLVPSSMSFQNLTTLEVSKCDGLINLVTCSTAESMVKLVRMSITDCKLIEEIIHPIREDVKDCIVFSQLKYLGLHCLPTLTSFCLGNYTLEFPSLEQVIVMDCLKMMTFSQGALCTPKLHRLQLTEEDDEGCWDGNLNNTIQQLFKRVN********
****DANVNSIIELSYNFLESEEAKSLFRLCGLLNGGSQIPIDALMRCGMGLGLLKGVYTLQEARKRVHMLVNFLKASRLLLDGDAEECLKMHDIIHSIAASVATEELMFNMQNVADLKEELDKKTHKDPTAISIPFRGIYEFPERLECPKLKLFVLFSENLSLRIPDLFFEGMTELRVLSFTGFRFPSLPSSIGCLISLRTLTLESCLLGDVATIGDLKKLEILSLRHSDVEELPGEIGQLTRLKLLDLSNCMKLKVIRPNVISSLSRLEELYMGNSFTEWEIEGQSNASLVELKQLSRLTTLEVHIPDAQVMPQDLLSVELERYRICIGDVWSWSGEHETSRRLKLSALNKCIYLGYGMQMLLKGIEDLYLDELNGFQNALLELEDGEVFPLLKHLHVQNVCEILYIVNLVGWEHCNAFPLLESLFLHNLMRLEMVYRGQLTEHSFSKLRIIKVCQCDNLKHLFSFPMARNLLQLQKLKVSFCESLKLIVGKESSETHNVHEIINFTQLHSLTLQCLPQLTSSGFDLERPLLSPTISATTLAFEEVIAEDDSDESLFNNKVIFPNLEKLKLSSINIEKIWHDQYPLMLNSCSQNLTNLTVETCSRLKFLFSYSMVDSLVRLQQLEIRKCESMEAVIDTTDIEINSVEFPSLHHLRIVDCPNLRSFISVNSSEEKILHTDTQPLFDEKLVLPRLEVLSIDMMDNMRKIWHHQLALNSFSKLKALEVTNCGKLANIFPANIIMRRRLDRLEYLKVDGCASVEEIIGETSSNGNICVEEEEDEEARRRFVFPRLTWLNLSLLPRLKSFCPGVDISEWPLLKSLGVFGCDSVEILFASPEYFSCDSQRPLFVLDPKVAFPGLKELELNKLPNLLHLWKENSQLSKALLNLATLEISECDKLEKLVPSSVSLENLVTLEVSKCNELIHLMTLSTAESLVKLNRMNVIDCKMLQQIILQVGEEVKKDCIVFGQFKYLGLHCLPCLTSFCLGNFTLEFPCLEQVIVRECPKMKIFSQGVLHTPKLQRLHLREKYDEGLWEGSLNSTIQKLFEEMVGYHDKACLSLSKFPHLKEIWHGQALPVSFFINLRWLVVDDCRFMSGAIPANQLQNLINLKTLEVRNCYFLEQVFHLEEQNPIGQFRSLFPKLRNLKLINLPQLIRFCNFTGRIIELPSLVNLWIENCRNMKTFISSSTPVIIAPNKEPQQMTSQENLLADIQPLFDEKVKLPSLEVLGISQMDNLRKIWQDRLSLDSFCKLNCLVIQRCKKLLSIFPWNMLQRLQKLEKLEVVYCESVQRISELRALNYGDARAISVAQLRETLPICVFPLLTSLKLRSLPRLKCFYPGVHISEWPMLKYLDISGCAELEILASKFLSLGETHVDGQHDSQTQQPFFSFDKVAFPSLKELRLSRLPKLFWLCKETSHPRNVFQNECSKLDILVPSSVSFGNLSTLEVSKCGRLMNLMTISTAERLVNLERMNVTDCKMIQQIIQQVGEVEKDCIVFSQLKYLGLHCLPSLKSFCMGNKALEFPCLEQVIVEECPKMKIFSQGVLHTPKLRRLQLTEEDDEGRWEGNLNSTIQKLFVEMVGFCDLKCLKLSLFPNLKEIWHVQPLPVSFFSNLRSLVIDDCMNFSSAIPANLLRSLNNLEKLEVTNCDSLEEVFHLEEPNADEHYGSLFPKLRKLKLKDLPKLKRFCYFAKGIIELPFLSFMWIESCPNMVTFVSNSTFAHLTATEAPLEMIAEENILADIQPLFDEKVGLPSLEELAILSMDSLRKLWQDELSLHSFYNLKFLGVQKCNKLLNIFPCNMLERLQKLQKLQVLYCSSVREIFELRALSGRDTHTIKAAPLRESDASFVFPQLTSLSLWWLPRLKSFYPQVQISEWPMLKKLDVGGCAEVEIFASEVLSLQETHVDSQHNIQIPQYLFFVDKVAFPSLEELMLFRLPKLLHLWKGNSHPSKVFPNLASLKLSECTKLEKLVPSSMSFQNLTTLEVSKCDGLINLVTCSTAESMVKLVRMSITDCKLIEEIIHPIREDVKDCIVFSQLKYLGLHCLPTLTSFCLGNYTLEFPSLEQVIVMDCLKMMTFSQGALCTPKLHRLQLTEEDDEGCWDGNLNNTIQQLFKRVNF*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGGEDANVNSIIELSYNFLESEEAKSLFRLCGLLNGGSQIPIDALMRCGMGLGLLKGVYTLQEARKRVHMLVNFLKASRLLLDGDAEECLKMHDIIHSIAASVATEELMFNMQNVADLKEELDKKTHKDPTAISIPFRGIYEFPERLECPKLKLFVLFSENLSLRIPDLFFEGMTELRVLSFTGFRFPSLPSSIGCLISLRTLTLESCLLGDVATIGDLKKLEILSLRHSDVEELPGEIGQLTRLKLLDLSNCMKLKVIRPNVISSLSRLEELYMGNSFTEWEIEGQSNASLVELKQLSRLTTLEVHIPDAQVMPQDLLSVELERYRICIGDVWSWSGEHETSRRLKLSALNKCIYLGYGMQMLLKGIEDLYLDELNGFQNALLELEDGEVFPLLKHLHVQNVCEILYIVNLVGWEHCNAFPLLESLFLHNLMRLEMVYRGQLTEHSFSKLRIIKVCQCDNLKHLFSFPMARNLLQLQKLKVSFCESLKLIVGKESSETHNVHEIINFTQLHSLTLQCLPQLTSSGFDLERPLLSPTISATTLAFEEVIAEDDSDESLFNNKVIFPNLEKLKLSSINIEKIWHDQYPLMLNSCSQNLTNLTVETCSRLKFLFSYSMVDSLVRLQQLEIRKCESMEAVIDTTDIEINSVEFPSLHHLRIVDCPNLRSFISVNSSEEKILHTDTQPLFDEKLVLPRLEVLSIDMMDNMRKIWHHQLALNSFSKLKALEVTNCGKLANIFPANIIMRRRLDRLEYLKVDGCASVEEIIGETSSNGNICVEEEEDEEARRRFVFPRLTWLNLSLLPRLKSFCPGVDISEWPLLKSLGVFGCDSVEILFASPEYFSCDSQRPLFVLDPKVAFPGLKELELNKLPNLLHLWKENSQLSKALLNLATLEISECDKLEKLVPSSVSLENLVTLEVSKCNELIHLMTLSTAESLVKLNRMNVIDCKMLQQIILQVGEEVKKDCIVFGQFKYLGLHCLPCLTSFCLGNFTLEFPCLEQVIVRECPKMKIFSQGVLHTPKLQRLHLREKYDEGLWEGSLNSTIQKLFEEMVGYHDKACLSLSKFPHLKEIWHGQALPVSFFINLRWLVVDDCRFMSGAIPANQLQNLINLKTLEVRNCYFLEQVFHLEEQNPIGQFRSLFPKLRNLKLINLPQLIRFCNFTGRIIELPSLVNLWIENCRNMKTFISSSTPVIIAPNKEPQQMTSQENLLADIQPLFDEKVKLPSLEVLGISQMDNLRKIWQDRLSLDSFCKLNCLVIQRCKKLLSIFPWNMLQRLQKLEKLEVVYCESVQRISELRALNYGDARAISVAQLRETLPICVFPLLTSLKLRSLPRLKCFYPGVHISEWPMLKYLDISGCAELEILASKFLSLGETHVDGQHDSQTQQPFFSFDKVAFPSLKELRLSRLPKLFWLCKETSHPRNVFQNECSKLDILVPSSVSFGNLSTLEVSKCGRLMNLMTISTAERLVNLERMNVTDCKMIQQIIQQVGEVEKDCIVFSQLKYLGLHCLPSLKSFCMGNKALEFPCLEQVIVEECPKMKIFSQGVLHTPKLRRLQLTEEDDEGRWEGNLNSTIQKLFVEMVGFCDLKCLKLSLFPNLKEIWHVQPLPVSFFSNLRSLVIDDCMNFSSAIPANLLRSLNNLEKLEVTNCDSLEEVFHLEEPNADEHYGSLFPKLRKLKLKDLPKLKRFCYFAKGIIELPFLSFMWIESCPNMVTFVSNSTFAHLTATEAPLEMIAEENILADIQPLFDEKVGLPSLEELAILSMDSLRKLWQDELSLHSFYNLKFLGVQKCNKLLNIFPCNMLERLQKLQKLQVLYCSSVREIFELRALSGRDTHTIKAAPLRESDASFVFPQLTSLSLWWLPRLKSFYPQVQISEWPMLKKLDVGGCAEVEIFASEVLSLQETHVDSQHNIQIPQYLFFVDKVAFPSLEELMLFRLPKLLHLWKGNSHPSKVFPNLASLKLSECTKLEKLVPSSMSFQNLTTLEVSKCDGLINLVTCSTAESMVKLVRMSITDCKLIEEIIHPIREDVKDCIVFSQLKYLGLHCLPTLTSFCLGNYTLEFPSLEQVIVMDCLKMMTFSQGALCTPKLHRLQLTEEDDEGCWDGNLNNTIQQLFKRVNFQNSNEED
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query2123 2.2.26 [Sep-21-2011]
Q9T048985 Disease resistance protei yes no 0.228 0.492 0.268 3e-32
O81825919 Probable disease resistan no no 0.235 0.542 0.285 1e-25
Q42484909 Disease resistance protei no no 0.210 0.490 0.247 8e-24
Q9FLB4874 Putative disease resistan no no 0.114 0.279 0.258 9e-09
Q9C8T9898 Putative disease resistan no no 0.134 0.318 0.243 9e-08
Q9LVT4843 Probable disease resistan no no 0.106 0.269 0.253 5e-07
Q9RBS21024 Protein PopC OS=Ralstonia yes no 0.049 0.103 0.385 2e-06
P60839884 Probable disease resistan no no 0.053 0.127 0.346 2e-06
Q940K0889 Probable disease resistan no no 0.103 0.246 0.264 3e-06
Q96NW71537 Leucine-rich repeat-conta yes no 0.037 0.052 0.430 3e-06
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function desciption
 Score =  142 bits (359), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 148/551 (26%), Positives = 260/551 (47%), Gaps = 66/551 (11%)

Query: 12  IELSYNFLESEEAKSLFRLCGLLNGGSQIPIDALMRCGMGLGLLKGVYTLQEARKRVHML 71
           ++LSY+FLE ++AK  F LC L      I +  ++R  M  G ++ + + +++       
Sbjct: 383 LKLSYDFLE-DKAKFCFLLCALFPEDYSIEVTEVVRYWMAEGFMEELGSQEDSMNEGITT 441

Query: 72  VNFLKASRLLLDGDAEECLKMHDIIHSIAASVAT------EELMFNMQNVADLKEELDKK 125
           V  LK   LL DGD  + +KMHD++   A  + +        L+ +   + D++++   K
Sbjct: 442 VESLKDYCLLEDGDRRDTVKMHDVVRDFAIWIMSSSQDDSHSLVMSGTGLQDIRQD---K 498

Query: 126 THKDPTAISIPFRGIYEFPERLE--CPKLKLFVLFSENLSLRIPDLFFEGMTELRVLSFT 183
                  +S+    +   P+ +E  C K  + +L    L   +P  F +    LR+L+ +
Sbjct: 499 LAPSLRRVSLMNNKLESLPDLVEEFCVKTSVLLLQGNFLLKEVPIGFLQAFPTLRILNLS 558

Query: 184 GFRFPSLPS-SIGCLISLRTLTLESCL-LGDVATIGDLKKLEILSLRHSDVEELPGEIGQ 241
           G R  S PS S+  L SL +L L  C  L  + ++  L KLE+L L  + + E P  + +
Sbjct: 559 GTRIKSFPSCSLLRLFSLHSLFLRDCFKLVKLPSLETLAKLELLDLCGTHILEFPRGLEE 618

Query: 242 LTRLKLLDLSNCMKLKVIRPNVISSLSRLEELYMGNSFTEWEIEGQS---NASLVELKQL 298
           L R + LDLS  + L+ I   V+S LS LE L M +S   W ++G++    A++ E+  L
Sbjct: 619 LKRFRHLDLSRTLHLESIPARVVSRLSSLETLDMTSSHYRWSVQGETQKGQATVEEIGCL 678

Query: 299 SRLTTLEVHIPDAQVM--PQDLLSVELERYRICIGDVWSWSGEHETSRRLKLSALNKC-I 355
            RL  L + +  +  +   ++     L+++++ +G  +     H+  RRL +S LN   +
Sbjct: 679 QRLQVLSIRLHSSPFLLNKRNTWIKRLKKFQLVVGSRYILRTRHD-KRRLTISHLNVSQV 737

Query: 356 YLGYGMQMLLKGIEDLYLDELNGFQNALLEL-EDGEVFPLLKHLHVQNVCEILYIVNLVG 414
            +G+    LL     L L+   G +  + +L  D + F  LK L ++NV     I+N   
Sbjct: 738 SIGW----LLAYTTSLALNHCQGIEAMMKKLVSDNKGFKNLKSLTIENV-----IINTNS 788

Query: 415 W----------EHCNAFPLLESLFLHNLMRLEMVYRGQLTEH---SFSKLRIIKVCQCDN 461
           W          +  +   LL +L   +L R+++    +L  H       L+II++  C  
Sbjct: 789 WVEMVSTNTSKQSSDILDLLPNLEELHLRRVDLETFSELQTHLGLKLETLKIIEITMCRK 848

Query: 462 LKHLFSFPMARNLL---QLQKLKVSFCESLKLIVGKESSETHNVHEIINFTQ-----LHS 513
           L+ L      RN L    L+++++S+C+SL+           N+HE + + Q     L  
Sbjct: 849 LRTLLD---KRNFLTIPNLEEIEISYCDSLQ-----------NLHEALLYHQPFVPNLRV 894

Query: 514 LTLQCLPQLTS 524
           L L+ LP L S
Sbjct: 895 LKLRNLPNLVS 905




Disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function description
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FLB4|DRL31_ARATH Putative disease resistance protein At5g05400 OS=Arabidopsis thaliana GN=At5g05400 PE=2 SV=1 Back     alignment and function description
>sp|Q9C8T9|DRL19_ARATH Putative disease resistance protein At1g63350 OS=Arabidopsis thaliana GN=At1g63350 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVT4|DRL37_ARATH Probable disease resistance protein At5g47250 OS=Arabidopsis thaliana GN=At5g47250 PE=2 SV=1 Back     alignment and function description
>sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 Back     alignment and function description
>sp|P60839|DRL2_ARATH Probable disease resistance protein At1g12290 OS=Arabidopsis thaliana GN=At1g12290 PE=2 SV=1 Back     alignment and function description
>sp|Q940K0|DRL15_ARATH Probable disease resistance protein At1g61180 OS=Arabidopsis thaliana GN=At1g61180 PE=2 SV=2 Back     alignment and function description
>sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query2123
255542484 2460 phosphoprotein phosphatase, putative [Ri 0.900 0.777 0.293 0.0
328447250 4316 Rpp4 candidate R5 [Glycine max] 0.768 0.378 0.314 1e-177
225016141 3055 Rpp4 candidate 1 [Glycine max] 0.767 0.533 0.311 1e-175
353685491 2670 Rpp4C5 [Phaseolus vulgaris] 0.781 0.621 0.306 1e-171
353685480 2629 Rpp4C4 [Phaseolus vulgaris] 0.758 0.612 0.307 1e-171
328447249 3916 Rpp4 candidate R3 [Glycine max] 0.948 0.514 0.285 1e-170
2555632521603 Disease resistance protein RPS5, putativ 0.352 0.467 0.459 1e-168
358344903 2248 Cc-nbs-lrr resistance protein [Medicago 0.748 0.706 0.307 1e-167
3594881011677 PREDICTED: disease resistance protein At 0.478 0.605 0.366 1e-165
2241112961315 cc-nbs-lrr resistance protein [Populus t 0.368 0.595 0.444 1e-162
>gi|255542484|ref|XP_002512305.1| phosphoprotein phosphatase, putative [Ricinus communis] gi|223548266|gb|EEF49757.1| phosphoprotein phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 677/2304 (29%), Positives = 1058/2304 (45%), Gaps = 392/2304 (17%)

Query: 10   SIIELSYNFLESEEAKSLFRLCGLLNGGSQIPIDALMRCGMGLGLLKGVYTLQEARKRVH 69
            + ++LSYNFL +EE KSLF LCG L     I +  L++  +GLGL     T++ AR R+ 
Sbjct: 335  TALKLSYNFLGAEE-KSLFVLCGQLKA-HYIVVSDLLKYSLGLGLFNQRTTVKAARNRLL 392

Query: 70   MLVNFLKASRLLLDGDAEECLKMHDIIHSIAASVAT-EELMFNMQNVADLKEELDKKTHK 128
             +VN LK S LLL+GD ++ ++MHD++H+ A  VA+ +  +F +   + L+E  +K   +
Sbjct: 393  KVVNDLKRSCLLLEGDDDDEVRMHDVVHNFATLVASRDHHVFAVACDSGLEEWPEKDILE 452

Query: 129  DPTAISIPFRGIYEFPERLECPKLKLFVLFSENLSLRIPDLFFEGMTELRVLSFTGFRFP 188
              TAIS+P   I + PE  ECP L+ F+L++++ SL+IPD FF  M +L+++  +     
Sbjct: 453  QFTAISLPDCKIPKLPEVFECPDLQSFLLYNKDSSLKIPDNFFSRMKKLKLMDLSNVHLS 512

Query: 189  SLPSSIGCLISLRTLTLESCLLGDVATIGDLKKLEILSLRHSDVEELPGEIGQLTRLKLL 248
             +P S+ CL +L+TL L+ C L D+A IG+LKKL++LS   S + +LP E+G+LTRL+LL
Sbjct: 513  PMPLSLQCLENLQTLCLDRCTLEDIAAIGELKKLQVLSFIGSTMVQLPREVGKLTRLQLL 572

Query: 249  DLSNCMKLKVIRPNVISSLSRLEELYMGNSFTEWEIE----GQSNASLVELKQLSRLTTL 304
            DLS C KL+VI   V+S L++LEELYMGNSF +WE E     ++NASL ELK L  L TL
Sbjct: 573  DLSRCQKLEVIPKGVLSCLTKLEELYMGNSFVQWESEEHDGDRNNASLDELKLLPNLVTL 632

Query: 305  EVHIPDAQVMPQDLLSVELERYRICIGDVWSWSGEHETSRRLKLSALNKCIYLGYGMQML 364
            E+HI +A+++P+D+ S +L+ Y++ IG+ WSW G++E SR LKL  LN  I +   +++L
Sbjct: 633  ELHIINAEILPRDVFSEKLDLYKVFIGEEWSWFGKYEASRTLKLK-LNSSIEIE-KVKVL 690

Query: 365  LKGIEDLYLDELNGFQNALLELEDGEVFPLLKHLHVQNVCEILYIVN-LVGWEHCNAFPL 423
            L   EDLYLDEL G +N L EL DG+ FP LKHLH+QN  EI YIV+ L    H  AFP 
Sbjct: 691  LMTTEDLYLDELEGVRNVLYEL-DGQGFPQLKHLHIQNSSEIQYIVDCLSMGNHYIAFPR 749

Query: 424  LESLFLHNLMRLEMVYRGQLTEHSFSKLRIIKVCQCDNLKHLFSFPMARNLLQLQKLKVS 483
            LESL + NL  L  +  GQL   SFSKLR +KV  C+ LK+LF F M R L+QL+++ VS
Sbjct: 750  LESLLVDNLNNLGQICYGQLMSGSFSKLRKLKVEHCNALKNLFYFSMFRGLVQLEEIDVS 809

Query: 484  FCESLKLIVGKESSETHNVHEIINFTQLHSLTLQCLPQLTSSGFDLERPLLSPTISATTL 543
             C  ++ IV +E  +     EII   +L +LTL+ LP+ TS  F  +R      ++    
Sbjct: 810  SCNIMEEIVVEEIEDDSGRDEIIKPIRLRTLTLEYLPRFTS--FCSQR---MQKLAGLDA 864

Query: 544  AFEEVIAEDDSDESLFNNKVIFPNLEKLKLSSI-NIEKIWHDQYPLMLNSCSQNLTNLTV 602
               ++I+E  S   LF  K+ F NL  LKLSSI N+EKIW +Q     +S  QNLT+L V
Sbjct: 865  GCAQIISETPS--VLFGQKIEFSNLLNLKLSSINNMEKIWRNQVKEPPSSV-QNLTSLIV 921

Query: 603  ETCSRLKFLFSYSMVDSLVRLQQLEIRKCESMEAVIDTTDIEI----------------- 645
            E C +L +LF+ SMV++L +L+ LEI  C  ME +I    +                   
Sbjct: 922  EGCGKLSYLFTSSMVENLSQLEYLEISDCSFMEEIIVAEGLTKHNSKLHFPILHTLKLKS 981

Query: 646  ----------NSVEFPSLHHLRIVDCPNLRSFISVNSS----EEKILHTDTQPLFDEKLV 691
                      N +E PSL+ LRI +CP L  FIS ++S      +        LFDEK+ 
Sbjct: 982  LPNLIRFCFGNLIECPSLNALRIENCPRLLKFISSSASTNMEANRGGRETNSTLFDEKVS 1041

Query: 692  LPRLEVLSIDMMDNMRKIWHHQLALNSFSKLKALEVTNCGKLANIFPANIIMRRRLDRLE 751
             P LE L I  M+N+R IW  +   +SF KLK +++ NC +L  IFP+   M R L +LE
Sbjct: 1042 FPILEKLEIVYMNNLRMIWESEDRGDSFCKLKIVKIQNCKELVTIFPSK--MLRALQKLE 1099

Query: 752  YLKVDGCASVEEIIGETSSNGNICVEEEEDEEARRRFVFP---RLTWLNLSLLPRLKSFC 808
             + V  C  +EE+           ++E    E ++  V P   +L  L +  LP LK   
Sbjct: 1100 DVVVTNCDLLEEVFN---------LQELMATEGKQNRVLPVVAQLRDLTIENLPSLKHVW 1150

Query: 809  PG--VDISEWPLLKSLGVFGCDSVEILFASPEYFSCDSQRPLFVLD-------------- 852
             G    +  +  L+SL    C S++ LF +    S      L +++              
Sbjct: 1151 SGDPQGVFSFDNLRSLSAENCPSLKNLFPASIAKSLSQLEDLSIVNCGLQEIVAKDRVEA 1210

Query: 853  -PKVAFPGLKELELNKLPNLLHLWKENSQLSKALLNLATLEISECDKLEKLVPSSVSL-- 909
             P+  FP LK ++L  L  + + +     L      L  L I +CD LE     S  L  
Sbjct: 1211 TPRFVFPQLKSMKLWILEEVKNFYPGRHILDCP--KLEKLTIHDCDNLELFTLESQCLQV 1268

Query: 910  ---ENLVTLEVSKCNELIHLMTLSTAESLVKLNRMNVIDCKMLQQIILQVGEEVKKDCIV 966
               EN V +E  +      L + +   S +K   ++  +  M++Q  L           +
Sbjct: 1269 GRGENQVDVEFQQ-----PLFSFTQVVSHLKSLSLSNKETMMIRQAQLPAS--------L 1315

Query: 967  FGQFKYLGLHCLPCLTSFCLGNFTLEFPCLEQVIVRECPKMKIF-------SQGVLHTPK 1019
            F + + L L C    +S+   +    F  +E +++       +F          V     
Sbjct: 1316 FHKLERLDLQCFHDRSSYFPFDLLQRFQNVETLLLTCSNVEDLFPYPLVGEDNNVRILSN 1375

Query: 1020 LQRLHLREKYD-EGLW--EGSLNSTIQKLFEEMVGYHDKACLSLSKFPHLKEIWHGQALP 1076
            L+ L L    D   +W  E   N ++Q L    V Y    C  L             A  
Sbjct: 1376 LRHLTLNSLRDIRRIWNQECQPNQSLQNLETLEVMY----CKKLINL----------APS 1421

Query: 1077 VSFFINLRWLVVDDCRFMSGAIPANQLQNLINLKTLEVRNCYFLEQVFHLEEQNPIGQFR 1136
             + F NL  L V +C  +   + +   ++L+ L  ++V NC  L ++   E      +  
Sbjct: 1422 SATFKNLASLEVHECNGLVSLLTSTTAKSLVQLGEMKVSNCKMLREIVANEGDEMESEIT 1481

Query: 1137 SLFPKLRNLKLINLPQLIRFCNFTGRIIELPSLVNLWIENCRNMKTFISSSTPVIIAP-- 1194
              F KL +L+L +L +L   C+   R ++ PSL  L +  C  M+ F   S  +I AP  
Sbjct: 1482 --FSKLESLRLDDLTRLTTVCSVNCR-VKFPSLEELIVTACPRMEFF---SHGIITAPKL 1535

Query: 1195 -----NKEPQQMTSQENLLADIQPLFDEKVKLPSLEVLGISQMDNLRKIWQDRLSLDSFC 1249
                  KE  +  S  +L    Q L+ E V L  ++ L +S+   L + W D+L    F 
Sbjct: 1536 EKVSLTKEGDKWRSVGDLNTTTQQLYREMVGLNGVQHLQLSEFPTLVEKWHDQLPAYFFY 1595

Query: 1250 KLNCLVIQRCKKLLSIFPWNMLQRLQKLEKLEVVYCESVQRISELRALN-YGDARAISVA 1308
             L  LV+  C    S  P N+L  L +LE LEV  C+S+ ++ +    N YG A  +   
Sbjct: 1596 NLKSLVVDNCSFPSSSVPSNLLPFLNELEVLEVRNCDSLAKVFDFEWSNDYGYAGHL--- 1652

Query: 1309 QLRETLPICVFPLLTSLKLRSLPRLKCFYPGV--HISEWPMLKYLDISGCAELEILASKF 1366
                       P L    L  LPRL+  +  +   IS +  L  L+I  C+ L  + +  
Sbjct: 1653 -----------PNLKKFHLIDLPRLRHIWDDISSEISGFKNLTVLNIHNCSSLRYIFNPI 1701

Query: 1367 LSLG-----ETHVDG---------QHDSQTQQPFFSFDKVAFPSLKELRLSRLPKLFWL- 1411
            + +G     E  V           +  ++ + P    +++ FP LK + L  LP L    
Sbjct: 1702 ICMGLVQLQEVEVRNCALVQAIIREGLAKEEAP----NEIIFPLLKSISLESLPSLINFF 1757

Query: 1412 ------------------CKETSHPRNVFQNECSKLDILVPSSVSFG------------- 1440
                              C  T     + ++E +  D ++ + V F              
Sbjct: 1758 SGSGIVRCPSLKEITIVNCPATFTCTLLRESESNATDEIIETKVEFSELKILKLFSINIE 1817

Query: 1441 ---------------NLSTLEVSKCGRLMNLMTISTAERLVNLERMNVTDCKMIQQIIQQ 1485
                           +L++L V  CG L + ++ S  + LV+L+++ V +C+M++++I  
Sbjct: 1818 KIWHAHQLEMYASIQHLASLTVDGCGHLKHALSSSMVQTLVHLKKLEVCNCRMMEEVIAT 1877

Query: 1486 VGEVEKDC--IVFSQLKYLGLHCLPSLKSFCMGNKALEFPCLEQVIVEECPKMKIF---- 1539
             G  E+    ++  QL++L L  LP L  F   N  +EFP ++++ ++ CPK+  F    
Sbjct: 1878 EGFEEESTSRMLLRQLEFLKLKDLPELAQFFTSN-LIEFPVMKELWLQNCPKLVAFVSSF 1936

Query: 1540 -------------SQGVLHT-----PKLRRLQLTEEDDEGRWEGNLNSTIQKLFVEMVGF 1581
                         S+  L       PKL++LQ+ + ++   +  N+   +Q L   ++  
Sbjct: 1937 GREDLALSSELEISKSTLFNEKVAFPKLKKLQIFDMNNFKIFSSNMLLRLQNLDNLVIKN 1996

Query: 1582 CD------------------------LKCLKLSLFPNLKEIWHVQPLPVSFFSNLRSLVI 1617
            C                         L+ L++   PNLK +W+  P  +  F  L S+ +
Sbjct: 1997 CSSLEEVFDLRELIKVEEQLVTEASQLETLEIHNLPNLKHVWNEDPKGIISFEKLSSVEV 2056

Query: 1618 DDCMNFSSAIPANLLRSLNNLEKLEVTNCDSLEEVFHLEEPNADEHYGSLFPKLRKLKLK 1677
             +C    S  P ++ + L  LE L V  C   E V   +    +E    +FP+L+ L L 
Sbjct: 2057 WECPCLKSIFPTSVAKHLPQLEALNVDGCGVEEIVSKEDGVGVEETSMFVFPRLKFLDLW 2116

Query: 1678 DLPKLKRFCYFAKGIIELPFLSFMWIESCPNMVTFVSNSTFAHLTATEAPLEMIAEENIL 1737
             L +LK F Y     +E P L  + +  C  + TF S    +  T TE   E+ AE    
Sbjct: 2117 RLQELKSF-YPGIHTLECPVLEQLIVYRCDKLETF-SYEQGSQETHTEGQQEIQAE---- 2170

Query: 1738 ADIQPLFDEKVGLPSLEELAILSMDSLRKLWQDELSLHSFYNLKFLGVQKCNKLLNIFPC 1797
               QPLF     +P+L  L+ LS D ++ + + + S  +F  L  L +   +      PC
Sbjct: 2171 ---QPLFCFTKVVPNLCNLS-LSCDDIKAIREGQFSAETFNKLNTLHLYCFHDTSFDSPC 2226

Query: 1798 NMLERLQKLQKLQVLYCSSVREIFELRALSGRDTHTIKAAPLRESDASFVFPQLTSLSLW 1857
            ++L + Q + +L +L CS+ + +F    +                +++ +  QL  L L 
Sbjct: 2227 DLLHKFQNVHQL-ILRCSNFKVLFSFGVV---------------DESARILSQLRYLKLD 2270

Query: 1858 WLPRLKSFYPQVQISEWPM--LKKLDVGGCAEVEIFASEVLSLQETHVDSQHNIQIPQYL 1915
            +LP +K  + Q   ++  +  L+ L++ GC  +   AS                      
Sbjct: 2271 YLPDMKEIWSQDCPTDQTLQNLETLEIWGCHSLISLAS---------------------- 2308

Query: 1916 FFVDKVAFPSLEELMLFRLPKLLHLWKGNSHPSKVFPNLASLKLSECTKLEKLVPSSMS- 1974
                   F +LE L ++   +LL+L    S  +K   +L  + + EC  L ++V S    
Sbjct: 2309 ---GSAGFQNLETLDVYNCDELLYL--VTSSVAKSLVHLTKMTVRECNILREVVASEADE 2363

Query: 1975 ------FQNLTTLEVSKCDGLINLVTCSTAESMVKLVRMSITDCKLIEEIIHPIREDVKD 2028
                  F  L  L + + + LI   + S       L  + +T C                
Sbjct: 2364 PQGDIIFSKLENLRLYRLESLIRFCSASITIQFPSLKDVEVTQC---------------- 2407

Query: 2029 CIVFSQLKYLGLHCLPTLTSFCLGNYTLEFPSLEQVIVMDCLKMMTFSQGALCTPKLHRL 2088
                           P +  F                          S+G +  PKL ++
Sbjct: 2408 ---------------PNMMDF--------------------------SRGVIRAPKLQKV 2426

Query: 2089 QLTEEDDEGCWDGNLNNTIQQLFK 2112
                E+    W  +LN TIQQL+K
Sbjct: 2427 CFAGEER---WVEHLNTTIQQLYK 2447




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|328447250|gb|AEB06128.1| Rpp4 candidate R5 [Glycine max] Back     alignment and taxonomy information
>gi|225016141|gb|ACN78965.1| Rpp4 candidate 1 [Glycine max] Back     alignment and taxonomy information
>gi|353685491|gb|AER13168.1| Rpp4C5 [Phaseolus vulgaris] Back     alignment and taxonomy information
>gi|353685480|gb|AER13157.1| Rpp4C4 [Phaseolus vulgaris] Back     alignment and taxonomy information
>gi|328447249|gb|AEB06127.1| Rpp4 candidate R3 [Glycine max] Back     alignment and taxonomy information
>gi|255563252|ref|XP_002522629.1| Disease resistance protein RPS5, putative [Ricinus communis] gi|223538105|gb|EEF39716.1| Disease resistance protein RPS5, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|358344903|ref|XP_003636525.1| Cc-nbs-lrr resistance protein [Medicago truncatula] gi|355502460|gb|AES83663.1| Cc-nbs-lrr resistance protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|359488101|ref|XP_002263761.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query2123
TAIR|locus:2136447985 AT4G27190 [Arabidopsis thalian 0.229 0.495 0.264 3.3e-33
TAIR|locus:2131689919 AT4G27220 [Arabidopsis thalian 0.236 0.546 0.284 1.9e-30
TAIR|locus:2005517909 RPS2 "RESISTANT TO P. SYRINGAE 0.113 0.265 0.298 5.2e-24
TAIR|locus:20916621424 AT3G14460 [Arabidopsis thalian 0.146 0.219 0.25 5.3e-17
TAIR|locus:2034765884 AT1G12290 [Arabidopsis thalian 0.126 0.304 0.280 1.2e-14
TAIR|locus:2031366898 AT1G63350 "AT1G63350" [Arabido 0.115 0.272 0.275 2.1e-13
TAIR|locus:2132741892 AT4G10780 [Arabidopsis thalian 0.126 0.300 0.280 7.7e-13
TAIR|locus:2171589948 AT5G47260 [Arabidopsis thalian 0.138 0.311 0.254 1e-12
TAIR|locus:2171579843 AT5G47250 [Arabidopsis thalian 0.115 0.290 0.274 1.5e-12
TAIR|locus:22058241384 AT1G27170 [Arabidopsis thalian 0.174 0.268 0.268 4.3e-12
TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 397 (144.8 bits), Expect = 3.3e-33, Sum P(2) = 3.3e-33
 Identities = 145/548 (26%), Positives = 258/548 (47%)

Query:    12 IELSYNFLESEEAKSLFRLCGLLNGGSQIPIDALMRCGMGLGLLKGVYTLQEARKRVHML 71
             ++LSY+FLE ++AK  F LC L      I +  ++R  M  G ++ + + +++       
Sbjct:   383 LKLSYDFLE-DKAKFCFLLCALFPEDYSIEVTEVVRYWMAEGFMEELGSQEDSMNEGITT 441

Query:    72 VNFLKASRLLLDGDAEECLKMHDIIHSIAASVATEE------LMFNMQNVADLKEELDKK 125
             V  LK   LL DGD  + +KMHD++   A  + +        L+ +   + D++++   K
Sbjct:   442 VESLKDYCLLEDGDRRDTVKMHDVVRDFAIWIMSSSQDDSHSLVMSGTGLQDIRQD---K 498

Query:   126 THKDPTAISIPFRGIYEFPERLE--CPKLKLFVLFSENLSLRIPDLFFEGMTELRVLSFT 183
                    +S+    +   P+ +E  C K  + +L    L   +P  F +    LR+L+ +
Sbjct:   499 LAPSLRRVSLMNNKLESLPDLVEEFCVKTSVLLLQGNFLLKEVPIGFLQAFPTLRILNLS 558

Query:   184 GFRFPSLPS-SIGCLISLRTLTLESCL-LGDVATIGDLKKLEILSLRHSDVEELPGEIGQ 241
             G R  S PS S+  L SL +L L  C  L  + ++  L KLE+L L  + + E P  + +
Sbjct:   559 GTRIKSFPSCSLLRLFSLHSLFLRDCFKLVKLPSLETLAKLELLDLCGTHILEFPRGLEE 618

Query:   242 LTRLKLLDLSNCMKLKVIRPNVISSLSRLEELYMGNSFTEWEIEGQSN---ASLVELKQL 298
             L R + LDLS  + L+ I   V+S LS LE L M +S   W ++G++    A++ E+  L
Sbjct:   619 LKRFRHLDLSRTLHLESIPARVVSRLSSLETLDMTSSHYRWSVQGETQKGQATVEEIGCL 678

Query:   299 SRLTTLEVHIPDAQVM--PQDLLSVELERYRICIGDVWSWSGEHETSRRLKLSALNKC-I 355
              RL  L + +  +  +   ++     L+++++ +G  +     H+  RRL +S LN   +
Sbjct:   679 QRLQVLSIRLHSSPFLLNKRNTWIKRLKKFQLVVGSRYILRTRHD-KRRLTISHLNVSQV 737

Query:   356 YLGYGMQMLLKGIEDLYLDELNGFQNALLEL-EDGEVFPLLKHLHVQNVCEILYIVNLVG 414
              +G+    LL     L L+   G +  + +L  D + F  LK L ++NV     I+N   
Sbjct:   738 SIGW----LLAYTTSLALNHCQGIEAMMKKLVSDNKGFKNLKSLTIENV-----IINTNS 788

Query:   415 W----------EHCNAFPLLESLFLHNLMRLEMVYRGQLTEH---SFSKLRIIKVCQCDN 461
             W          +  +   LL +L   +L R+++    +L  H       L+II++  C  
Sbjct:   789 WVEMVSTNTSKQSSDILDLLPNLEELHLRRVDLETFSELQTHLGLKLETLKIIEITMCRK 848

Query:   462 LKHLFSFPMARNLLQLQKLKVSFCESLKLIVGKESSETHNVHEIINFTQ-----LHSLTL 516
             L+ L        +  L+++++S+C+SL+           N+HE + + Q     L  L L
Sbjct:   849 LRTLLDKRNFLTIPNLEEIEISYCDSLQ-----------NLHEALLYHQPFVPNLRVLKL 897

Query:   517 QCLPQLTS 524
             + LP L S
Sbjct:   898 RNLPNLVS 905


GO:0000166 "nucleotide binding" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031366 AT1G63350 "AT1G63350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171589 AT5G47260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171579 AT5G47250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205824 AT1G27170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query2123
PLN032101153 PLN03210, PLN03210, Resistant to P 9e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-04
PLN03210 1153 PLN03210, PLN03210, Resistant to P 0.001
PLN032101153 PLN03210, PLN03210, Resistant to P 0.001
PLN032101153 PLN03210, PLN03210, Resistant to P 0.003
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
 Score = 57.2 bits (138), Expect = 9e-08
 Identities = 91/333 (27%), Positives = 145/333 (43%), Gaps = 68/333 (20%)

Query: 431 NLMRLEMVYRGQLTE------HSFSKLRIIKVCQCDNLKHLFSFPMARNLLQLQKLKVSF 484
           NL++L+M  +G   E      HS + LR I +    NLK +    MA N   L+ LK+S 
Sbjct: 612 NLVKLQM--QGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPDLSMATN---LETLKLSD 666

Query: 485 CESLKLIVGKESSETHNVHEIINFTQLHSLTLQCLPQLTSSGFDLER------------- 531
           C SL  +     S    ++++ +        L+ LP    +G +L+              
Sbjct: 667 CSSLVEL----PSSIQYLNKLEDLDMSRCENLEILP----TGINLKSLYRLNLSGCSRLK 718

Query: 532 --PLLSPTISATTLAFEEVIAEDDSDESLFNNKVIFPNLEKLKLSSINIEKIWHDQYPL- 588
             P +S  IS   L  +E   E+      F + +   NL++L L  +  EK+W    PL 
Sbjct: 719 SFPDISTNIS--WLDLDETAIEE------FPSNLRLENLDELILCEMKSEKLWERVQPLT 770

Query: 589 -MLNSCSQNLTNLTVETCSRLKFLFSYSMVDSLVRLQQLEIRKCESMEAVIDTTDIEINS 647
            ++   S +LT L +     L  L   S + +L +L+ LEI  C ++E    T    IN 
Sbjct: 771 PLMTMLSPSLTRLFLSDIPSLVEL--PSSIQNLHKLEHLEIENCINLE----TLPTGIN- 823

Query: 648 VEFPSLHHLRIVDCPNLRSF--ISVNSSEEKILHTDTQ--PLFDEKLVLPRLEVLSIDMM 703
               SL  L +  C  LR+F  IS N S+  +  T  +  P + EK     L  L ++  
Sbjct: 824 --LESLESLDLSGCSRLRTFPDISTNISDLNLSRTGIEEVPWWIEKFS--NLSFLDMNGC 879

Query: 704 DNMRKIWHHQLALNSFSKLKALE---VTNCGKL 733
           +N++++  +       SKLK LE    ++CG L
Sbjct: 880 NNLQRVSLN------ISKLKHLETVDFSDCGAL 906


syringae 6; Provisional. Length = 1153

>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 2123
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN032101153 Resistant to P. syringae 6; Provisional 99.97
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.97
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.96
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.8
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.79
PLN032101153 Resistant to P. syringae 6; Provisional 99.78
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.77
KOG04441255 consensus Cytoskeletal regulator Flightless-I (con 99.76
KOG06181081 consensus Serine/threonine phosphatase 2C containi 99.75
KOG04441255 consensus Cytoskeletal regulator Flightless-I (con 99.75
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.74
KOG06181081 consensus Serine/threonine phosphatase 2C containi 99.7
KOG0617264 consensus Ras suppressor protein (contains leucine 99.57
KOG0617264 consensus Ras suppressor protein (contains leucine 99.52
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.32
KOG4341483 consensus F-box protein containing LRR [General fu 99.28
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.26
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.26
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.25
KOG4341483 consensus F-box protein containing LRR [General fu 99.2
KOG4237498 consensus Extracellular matrix protein slit, conta 99.08
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.96
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 98.95
KOG4237498 consensus Extracellular matrix protein slit, conta 98.89
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 98.86
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.73
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.71
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.67
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.63
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.62
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.47
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.46
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.32
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.17
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.1
PLN03150623 hypothetical protein; Provisional 98.02
PRK15386 426 type III secretion protein GogB; Provisional 98.0
PRK15386 426 type III secretion protein GogB; Provisional 97.97
PLN03150623 hypothetical protein; Provisional 97.92
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.9
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.84
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.83
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.8
KOG18591096 consensus Leucine-rich repeat proteins [General fu 97.77
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.7
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.65
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.6
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.57
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.56
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.44
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.37
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.33
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.22
KOG18591096 consensus Leucine-rich repeat proteins [General fu 97.16
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.99
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 96.89
KOG2982418 consensus Uncharacterized conserved protein [Funct 96.8
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.55
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.54
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 96.53
KOG2982418 consensus Uncharacterized conserved protein [Funct 96.39
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.3
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.06
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 93.76
KOG2123388 consensus Uncharacterized conserved protein [Funct 93.73
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 93.63
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 92.07
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.94
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.9
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 91.75
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 89.25
KOG2123388 consensus Uncharacterized conserved protein [Funct 88.59
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 88.55
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 86.73
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 84.78
KOG0473326 consensus Leucine-rich repeat protein [Function un 81.04
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=1.3e-37  Score=411.96  Aligned_cols=277  Identities=27%  Similarity=0.370  Sum_probs=206.3

Q ss_pred             CCCchhHHHHHHHhHhcCCCchhhHHHHhcccCCCCCccChhHHHHHHHhcCCccccccHHHHHHHHHHHHHHHHHcCCc
Q 000128            2 GGEDANVNSIIELSYNFLESEEAKSLFRLCGLLNGGSQIPIDALMRCGMGLGLLKGVYTLQEARKRVHMLVNFLKASRLL   81 (2123)
Q Consensus         2 ~~~~~~i~~~L~lSY~~Lp~~~lK~cFlyca~Fp~d~~i~~~~Li~~WiaeGfi~~~~~~~~~~~~~~~~i~~L~~rsll   81 (2123)
                      +|+++.|+++|++|||+||+ ++|.||+|||+|||||+|++++||.+||||||+++....+.+++.|++|+.+|++|+|+
T Consensus       391 ~~~~~~i~~iLklSyd~L~~-~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll  469 (889)
T KOG4658|consen  391 SGMEESILPILKLSYDNLPE-ELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLL  469 (889)
T ss_pred             CchhhhhHHhhhccHhhhhH-HHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHH
Confidence            47789999999999999996 59999999999999999999999999999999998766778999999999999999999


Q ss_pred             ccCC---CcCeEEechhHHHHHHHHHHHHhhcccccEEecCCCcC----ccCCCCceEEEccCCCCccCCCCCCCCCceE
Q 000128           82 LDGD---AEECLKMHDIIHSIAASVATEELMFNMQNVADLKEELD----KKTHKDPTAISIPFRGIYEFPERLECPKLKL  154 (2123)
Q Consensus        82 ~~~~---~~~~~~mHDlv~dla~~i~~~e~~~~~~~~~~~~~~~~----~~~~~~l~~L~l~~n~~~~lp~~~~~~~Lr~  154 (2123)
                      +...   +..+|+|||+|||||.++|++.....-+.+...+....    ......+|++++.+|.+..++....+++|++
T Consensus       470 ~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~~~~~L~t  549 (889)
T KOG4658|consen  470 IEERDEGRKETVKMHDVVREMALWIASDFGKQEENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSSENPKLRT  549 (889)
T ss_pred             hhcccccceeEEEeeHHHHHHHHHHhccccccccceEEECCcCccccccccchhheeEEEEeccchhhccCCCCCCccce
Confidence            8765   34689999999999999999331111143333221111    1115688999999999999998888899999


Q ss_pred             EEeecCcC-CCccchhHhhCCCCccEEEeecC-CCCCCCcccCCCCCccEEEcCCCCCCCCccccCCCCCcEEEccCCCC
Q 000128          155 FVLFSENL-SLRIPDLFFEGMTELRVLSFTGF-RFPSLPSSIGCLISLRTLTLESCLLGDVATIGDLKKLEILSLRHSDV  232 (2123)
Q Consensus       155 L~l~~n~~-~~~~p~~~~~~l~~Lr~L~L~~n-~i~~lp~~i~~L~~Lr~L~L~~~~l~~p~~i~~L~~L~~L~L~~n~l  232 (2123)
                      |.+.+|.. ...++..||..++.||||||++| .+.++|++|+.|.|||||+++++.                      +
T Consensus       550 Lll~~n~~~l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~----------------------I  607 (889)
T KOG4658|consen  550 LLLQRNSDWLLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTG----------------------I  607 (889)
T ss_pred             EEEeecchhhhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCCC----------------------c
Confidence            99999873 44788888999999999999986 466888888777777777666655                      4


Q ss_pred             cccccccCCCCCccEEeccCCCCCcccChhhhCCCCCCCEEEccCcccccccccccccChhhhCCCCCCCEEEEe
Q 000128          233 EELPGEIGQLTRLKLLDLSNCMKLKVIRPNVISSLSRLEELYMGNSFTEWEIEGQSNASLVELKQLSRLTTLEVH  307 (2123)
Q Consensus       233 ~~lP~~i~~L~~L~~L~l~~~~~l~~lp~~~i~~L~~L~~L~l~~n~~~~~~~~~~~~~~~~l~~L~~L~~L~l~  307 (2123)
                      +.+|.++++|++|.+|++..+..+..+| ++...|++||+|.+......     .......++.++.+|+.+...
T Consensus       608 ~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~-~i~~~L~~Lr~L~l~~s~~~-----~~~~~l~el~~Le~L~~ls~~  676 (889)
T KOG4658|consen  608 SHLPSGLGNLKKLIYLNLEVTGRLESIP-GILLELQSLRVLRLPRSALS-----NDKLLLKELENLEHLENLSIT  676 (889)
T ss_pred             cccchHHHHHHhhheecccccccccccc-chhhhcccccEEEeeccccc-----cchhhHHhhhcccchhhheee
Confidence            4555555555555555555554333332 33445666666665543311     112345566666666666554



>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query2123
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-15
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-14
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-12
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-11
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-10
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-05
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-09
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-08
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-08
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 6e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-05
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-08
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-05
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-06
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-06
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-05
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 2e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-04
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-04
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-06
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-05
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query2123
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.97
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.97
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.96
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.96
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.96
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 99.95
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.94
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.93
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 99.93
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.92
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.91
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.91
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.91
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.91
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.91
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.9
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.9
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.88
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.87
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.87
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.86
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.85
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.85
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.85
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.85
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.84
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.83
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.83
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.83
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.82
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.82
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.82
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.82
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.8
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.8
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.77
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.76
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.76
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.76
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.75
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.74
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.73
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.72
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.72
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.7
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.69
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.68
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.68
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.68
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.67
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.67
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.67
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.66
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.66
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.66
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.66
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.63
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.62
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.62
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.62
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.61
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.6
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.59
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.59
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.57
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.57
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.56
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.56
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.56
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.55
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.55
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.55
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.55
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.55
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.54
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.52
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.52
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.52
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.51
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.5
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.49
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.49
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.46
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.44
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.43
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.43
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.42
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.41
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.41
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.41
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.4
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.39
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.38
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.38
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.37
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.36
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.35
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.34
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.34
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.32
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.31
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.3
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.3
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.29
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.29
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.28
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.27
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.27
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.25
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.25
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.23
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.22
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.21
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.2
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.17
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.15
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.15
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.15
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.14
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.14
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.13
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.1
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.08
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.03
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.01
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.95
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.92
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.91
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.9
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.82
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 98.78
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.74
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.67
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.67
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 98.47
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.45
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.4
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.36
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.36
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.24
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.11
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 98.09
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.97
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.79
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.6
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.47
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.43
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.36
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.35
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.14
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.12
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.73
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.64
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.22
4gt6_A394 Cell surface protein; leucine rich repeats, putati 93.67
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 92.69
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 90.83
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 89.77
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 88.48
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 87.79
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 86.52
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1.9e-34  Score=398.17  Aligned_cols=656  Identities=15%  Similarity=0.051  Sum_probs=343.2

Q ss_pred             CceEEEeecCcCCCc---cchhHhhCCCCccEEEeecCCCCCCCcccCCCCCccEEEcCCCCCC--CCc--cccCCCCCc
Q 000128          151 KLKLFVLFSENLSLR---IPDLFFEGMTELRVLSFTGFRFPSLPSSIGCLISLRTLTLESCLLG--DVA--TIGDLKKLE  223 (2123)
Q Consensus       151 ~Lr~L~l~~n~~~~~---~p~~~~~~l~~Lr~L~L~~n~i~~lp~~i~~L~~Lr~L~L~~~~l~--~p~--~i~~L~~L~  223 (2123)
                      +++.|+++++.+.+.   +|+.+ .++++|++++++.+.+..+|+.++++++|++|+|++|.+.  .|.  .++++++|+
T Consensus        51 ~v~~L~L~~~~l~g~~~~l~~~l-~~L~~L~~l~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~  129 (768)
T 3rgz_A           51 KVTSIDLSSKPLNVGFSAVSSSL-LSLTGLESLFLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLK  129 (768)
T ss_dssp             EEEEEECTTSCCCEEHHHHHHHT-TTCTTCCEEECTTSCEEECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCC
T ss_pred             cEEEEECCCCCcCCccCccChhH-hccCcccccCCcCCCcCCCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCC
Confidence            344445544444444   44433 4556666666666555555555666666666666666655  333  556666666


Q ss_pred             EEEccCCCCc-cccccc-CCCCCccEEeccCCCCCcccChhh---hCCCCCCCEEEccCcccccccccccccChhhhCCC
Q 000128          224 ILSLRHSDVE-ELPGEI-GQLTRLKLLDLSNCMKLKVIRPNV---ISSLSRLEELYMGNSFTEWEIEGQSNASLVELKQL  298 (2123)
Q Consensus       224 ~L~L~~n~l~-~lP~~i-~~L~~L~~L~l~~~~~l~~lp~~~---i~~L~~L~~L~l~~n~~~~~~~~~~~~~~~~l~~L  298 (2123)
                      +|++++|.+. .+|..+ +++++|++|++++|. +...++..   ++++++|++|++++|.+.+..         .++.+
T Consensus       130 ~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~-l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~---------~~~~l  199 (768)
T 3rgz_A          130 FLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANS-ISGANVVGWVLSDGCGELKHLAISGNKISGDV---------DVSRC  199 (768)
T ss_dssp             EEECCSSEEECCSSCCSCCCCTTCSEEECCSSC-CEEETHHHHHHTTCCTTCCEEECCSSEEESCC---------BCTTC
T ss_pred             EEECcCCccCCcCCHHHhccCCCCCEEECCCCc-cCCcCChhhhhhccCCCCCEEECCCCcccccC---------CcccC
Confidence            6666666554 334333 556666666666665 44333332   455666666666666554211         12455


Q ss_pred             CCCCEEEEecCCCCCCChhhhccccceeeeccCCccCCCCCcccceeeecccccCccccchhHHHhccCCcEEecccccC
Q 000128          299 SRLTTLEVHIPDAQVMPQDLLSVELERYRICIGDVWSWSGEHETSRRLKLSALNKCIYLGYGMQMLLKGIEDLYLDELNG  378 (2123)
Q Consensus       299 ~~L~~L~l~~~~~~~~~~~~~~~~L~~l~i~~~~~~~~~~~~~~L~~L~L~~~~~~~~~p~~i~~~l~~L~~L~L~~~~~  378 (2123)
                      ++|++|+++.|.+....+.                   ...+++|+.|++++..-...+|.++.. +++|++|++++|..
T Consensus       200 ~~L~~L~Ls~n~l~~~~~~-------------------l~~l~~L~~L~Ls~n~l~~~~~~~l~~-l~~L~~L~Ls~n~l  259 (768)
T 3rgz_A          200 VNLEFLDVSSNNFSTGIPF-------------------LGDCSALQHLDISGNKLSGDFSRAIST-CTELKLLNISSNQF  259 (768)
T ss_dssp             TTCCEEECCSSCCCSCCCB-------------------CTTCCSCCEEECCSSCCCSCHHHHTTT-CSSCCEEECCSSCC
T ss_pred             CcCCEEECcCCcCCCCCcc-------------------cccCCCCCEEECcCCcCCCcccHHHhc-CCCCCEEECCCCcc
Confidence            5666666665554432111                   122233444444433222223333332 56677777776543


Q ss_pred             ccccccccCCCCCCCCccEEEeeccCCccEeeccccccCCCcCcccceeeccccccchhhhcCCCCcccCCCccEEEEec
Q 000128          379 FQNALLELEDGEVFPLLKHLHVQNVCEILYIVNLVGWEHCNAFPLLESLFLHNLMRLEMVYRGQLTEHSFSKLRIIKVCQ  458 (2123)
Q Consensus       379 ~~~~~~~l~~~~~l~~L~~L~L~~~~~~~~i~~~~~~~~~~~f~~L~~L~l~~~~~l~~~~~~~~~~~~~~~L~~L~l~~  458 (2123)
                      . ...|.    ..+++|++|++.+|.....++..    ....+++|++|++.++.-...+   +...+.+++|++|++.+
T Consensus       260 ~-~~~~~----~~l~~L~~L~L~~n~l~~~ip~~----~~~~~~~L~~L~Ls~n~l~~~~---p~~~~~l~~L~~L~L~~  327 (768)
T 3rgz_A          260 V-GPIPP----LPLKSLQYLSLAENKFTGEIPDF----LSGACDTLTGLDLSGNHFYGAV---PPFFGSCSLLESLALSS  327 (768)
T ss_dssp             E-ESCCC----CCCTTCCEEECCSSEEEESCCCC----SCTTCTTCSEEECCSSEEEECC---CGGGGGCTTCCEEECCS
T ss_pred             c-CccCc----cccCCCCEEECcCCccCCccCHH----HHhhcCcCCEEECcCCcCCCcc---chHHhcCCCccEEECCC
Confidence            2 22222    25677777777776322222221    1122466777777664322122   22235577777777777


Q ss_pred             CCCCCCCCChhhhhhcCCCcEEEecccccchhhhccCCccccccccccccc-ccceeecccCccccccccccCCCCCCCc
Q 000128          459 CDNLKHLFSFPMARNLLQLQKLKVSFCESLKLIVGKESSETHNVHEIINFT-QLHSLTLQCLPQLTSSGFDLERPLLSPT  537 (2123)
Q Consensus       459 c~~L~~lp~~~~~~~L~~L~~L~l~~c~~l~~i~~~~~~~~~~~~~~~~fp-~L~~L~l~~~~~L~~l~~~~~~~~~~p~  537 (2123)
                      |.-...+|. ..+..+++|++|++++|.....++.          ....++ +|+.|+++++.--..+         .+.
T Consensus       328 n~l~~~ip~-~~l~~l~~L~~L~Ls~n~l~~~~p~----------~l~~l~~~L~~L~Ls~N~l~~~~---------~~~  387 (768)
T 3rgz_A          328 NNFSGELPM-DTLLKMRGLKVLDLSFNEFSGELPE----------SLTNLSASLLTLDLSSNNFSGPI---------LPN  387 (768)
T ss_dssp             SEEEEECCH-HHHTTCTTCCEEECCSSEEEECCCT----------THHHHTTTCSEEECCSSEEEEEC---------CTT
T ss_pred             CcccCcCCH-HHHhcCCCCCEEeCcCCccCccccH----------HHHhhhcCCcEEEccCCCcCCCc---------Chh
Confidence            532224543 3366777788888877643322221          112233 6777776665311111         000


Q ss_pred             cccccccccceecccCcccccccccccCCCccceeeccccccccccccccccccccccCcceEEEecCCCcccccchhhH
Q 000128          538 ISATTLAFEEVIAEDDSDESLFNNKVIFPNLEKLKLSSINIEKIWHDQYPLMLNSCSQNLTNLTVETCSRLKFLFSYSMV  617 (2123)
Q Consensus       538 l~~~~~~~~~~i~~~~~~~~~~~~~~~l~~L~~L~L~~~~l~~i~~~~~~~~~~~~l~~L~~L~l~~c~~L~~l~~~~~~  617 (2123)
                      +.                      ...+++|++|++++|+++...+..+     ..+++|+.|++++|. +....|. .+
T Consensus       388 ~~----------------------~~~~~~L~~L~L~~n~l~~~~p~~l-----~~l~~L~~L~Ls~N~-l~~~~p~-~l  438 (768)
T 3rgz_A          388 LC----------------------QNPKNTLQELYLQNNGFTGKIPPTL-----SNCSELVSLHLSFNY-LSGTIPS-SL  438 (768)
T ss_dssp             TT----------------------CSTTCCCCEEECCSSEEEEECCGGG-----GGCTTCCEEECCSSE-EESCCCG-GG
T ss_pred             hh----------------------hcccCCccEEECCCCccccccCHHH-----hcCCCCCEEECcCCc-ccCcccH-HH
Confidence            00                      0125678888888887775543332     347788888888753 4433332 24


Q ss_pred             hhhhccceEEEeecCCcceeeccCccccccccCCcceeeeeccCCCcccccccCCcccccccCCCCCccccccccCccce
Q 000128          618 DSLVRLQQLEIRKCESMEAVIDTTDIEINSVEFPSLHHLRIVDCPNLRSFISVNSSEEKILHTDTQPLFDEKLVLPRLEV  697 (2123)
Q Consensus       618 ~~l~~L~~L~I~~C~~L~~i~~~~~~~~~~~~l~~L~~L~l~~c~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Le~  697 (2123)
                      ..+++|+.|++++|.-...      .+..+..+++|+.|++++|.-...+|                  .....+++|+.
T Consensus       439 ~~l~~L~~L~L~~n~l~~~------~p~~~~~l~~L~~L~L~~N~l~~~~p------------------~~l~~l~~L~~  494 (768)
T 3rgz_A          439 GSLSKLRDLKLWLNMLEGE------IPQELMYVKTLETLILDFNDLTGEIP------------------SGLSNCTNLNW  494 (768)
T ss_dssp             GGCTTCCEEECCSSCCCSC------CCGGGGGCTTCCEEECCSSCCCSCCC------------------GGGGGCTTCCE
T ss_pred             hcCCCCCEEECCCCcccCc------CCHHHcCCCCceEEEecCCcccCcCC------------------HHHhcCCCCCE
Confidence            5678888888887762222      22234467788888887775433332                  12346778888


Q ss_pred             eeeccccCcchhccccCCCCccCCccEEEeccCCcccccCCCcHHHHHhcCCccEEEEecCCCcceeecccCCCCCcccc
Q 000128          698 LSIDMMDNMRKIWHHQLALNSFSKLKALEVTNCGKLANIFPANIIMRRRLDRLEYLKVDGCASVEEIIGETSSNGNICVE  777 (2123)
Q Consensus       698 L~i~~c~~l~~i~~~~~~~~~l~~L~~L~i~~C~~L~~~~p~~~~~~~~l~~L~~L~i~~C~~l~~i~~~~~~~g~~~~~  777 (2123)
                      |+++++.-...+   +..+..+++|+.|++++|... ...|..   ++.+++|+.|++++|.-...++..          
T Consensus       495 L~L~~N~l~~~~---p~~~~~l~~L~~L~L~~N~l~-~~~p~~---l~~l~~L~~L~Ls~N~l~g~ip~~----------  557 (768)
T 3rgz_A          495 ISLSNNRLTGEI---PKWIGRLENLAILKLSNNSFS-GNIPAE---LGDCRSLIWLDLNTNLFNGTIPAA----------  557 (768)
T ss_dssp             EECCSSCCCSCC---CGGGGGCTTCCEEECCSSCCE-EECCGG---GGGCTTCCEEECCSSEEESBCCGG----------
T ss_pred             EEccCCccCCcC---ChHHhcCCCCCEEECCCCccc-CcCCHH---HcCCCCCCEEECCCCccCCcCChH----------
Confidence            888876433233   334556678888888886543 334543   577888888888886543333211          


Q ss_pred             ccchhhhcccccccccCceecccCcccccccCCCcccccc-cccEEEEccccccee-eccCCccccccCCCC-ccccCcc
Q 000128          778 EEEDEEARRRFVFPRLTWLNLSLLPRLKSFCPGVDISEWP-LLKSLGVFGCDSVEI-LFASPEYFSCDSQRP-LFVLDPK  854 (2123)
Q Consensus       778 ~~~~~~~~~~~~~p~L~~L~L~~~~~L~~l~~~~~~~~~~-~L~~L~i~~C~~L~~-~~~~L~~L~l~~~~~-~~~~~~~  854 (2123)
                               ......+..+.+.....+..+........+. .-..+.+.+...... .++.+..+++..+.. ...+...
T Consensus       558 ---------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~  628 (768)
T 3rgz_A          558 ---------MFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTF  628 (768)
T ss_dssp             ---------GGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSC
T ss_pred             ---------HhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhh
Confidence                     1111222222222111111110000000000 000011111100000 011222222222110 1122234


Q ss_pred             cccCCccEEEcccCCCcchhhhccchhhhhcccccEEEeccccccccccCcccccccccEEeeccCCCcccccchhhHHH
Q 000128          855 VAFPGLKELELNKLPNLLHLWKENSQLSKALLNLATLEISECDKLEKLVPSSVSLENLVTLEVSKCNELIHLMTLSTAES  934 (2123)
Q Consensus       855 ~~l~~L~~L~l~~~~~l~~i~~~~~~~~~~l~~L~~L~l~~c~~l~~lp~~~~~l~~L~~L~l~~c~~l~~l~~~~~~~~  934 (2123)
                      ..+++|+.|+++++.--..+|...    ..+++|+.|+++++.....+|..++.+++|++|++++|.--..+|..  ...
T Consensus       629 ~~l~~L~~LdLs~N~l~g~ip~~l----~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~--l~~  702 (768)
T 3rgz_A          629 DNNGSMMFLDMSYNMLSGYIPKEI----GSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQA--MSA  702 (768)
T ss_dssp             SSSBCCCEEECCSSCCBSCCCGGG----GGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGG--GGG
T ss_pred             hccccccEEECcCCcccccCCHHH----hccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChH--HhC
Confidence            557788888888884333455432    34888888999887777788888888888999999888633355543  677


Q ss_pred             hhhcceeEEcccccchhhhc
Q 000128          935 LVKLNRMNVIDCKMLQQIIL  954 (2123)
Q Consensus       935 l~~L~~L~i~~C~~l~~~~~  954 (2123)
                      +++|+.|++++|.....+|.
T Consensus       703 l~~L~~L~ls~N~l~g~iP~  722 (768)
T 3rgz_A          703 LTMLTEIDLSNNNLSGPIPE  722 (768)
T ss_dssp             CCCCSEEECCSSEEEEECCS
T ss_pred             CCCCCEEECcCCcccccCCC
Confidence            88888888888877766664



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 2123
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 51.2 bits (121), Expect = 8e-07
 Identities = 28/166 (16%), Positives = 63/166 (37%), Gaps = 28/166 (16%)

Query: 133 ISIPFRGIYEFPERLECPKLKLFVLFSENLSLRIPDLFFEGMTELRVLSFTGFRFPSLPS 192
           +S+    + +         L    L +  +S   P     G+T+L  L     +  ++  
Sbjct: 224 LSLNGNQLKDIGTLASLTNLTDLDLANNQISNLAP---LSGLTKLTELKLGANQISNISP 280

Query: 193 SIGC---------------------LISLRTLTLESCLLGDVATIGDLKKLEILSLRHSD 231
             G                      L +L  LTL    + D++ +  L KL+ L   ++ 
Sbjct: 281 LAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFANNK 340

Query: 232 VEELPGEIGQLTRLKLLDLSNCMKLKVIRPNVISSLSRLEELYMGN 277
           V ++   +  LT +  L   +  ++  + P  +++L+R+ +L + +
Sbjct: 341 VSDVS-SLANLTNINWLSAGHN-QISDLTP--LANLTRITQLGLND 382


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query2123
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.64
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.61
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.57
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.57
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.56
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.5
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.5
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.47
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.43
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.43
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.42
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.41
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.39
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.39
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.38
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.33
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.33
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.27
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.2
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.16
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.15
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.13
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.09
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.08
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.08
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.04
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.03
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.99
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.79
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.72
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.62
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.55
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.44
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.31
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.27
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.04
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.92
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.34
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 94.91
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 94.85
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 92.73
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 92.27
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.64  E-value=7.9e-15  Score=182.76  Aligned_cols=78  Identities=19%  Similarity=0.183  Sum_probs=53.4

Q ss_pred             cCCCccceeeccccccccccccccccccccccCcceEEEecCCCcccccchhhHhhhhccceEEEeecCCcceeeccCcc
Q 000128          564 IFPNLEKLKLSSINIEKIWHDQYPLMLNSCSQNLTNLTVETCSRLKFLFSYSMVDSLVRLQQLEIRKCESMEAVIDTTDI  643 (2123)
Q Consensus       564 ~l~~L~~L~L~~~~l~~i~~~~~~~~~~~~l~~L~~L~l~~c~~L~~l~~~~~~~~l~~L~~L~I~~C~~L~~i~~~~~~  643 (2123)
                      .+++++.|++++|+++.+.+       +..+++|++|++++| .++.++.   +.++++|++|++++| .++.+.     
T Consensus       305 ~~~~l~~L~ls~n~l~~l~~-------l~~l~~L~~L~L~~n-~l~~l~~---l~~l~~L~~L~l~~N-~l~~l~-----  367 (384)
T d2omza2         305 NLKNLTYLTLYFNNISDISP-------VSSLTKLQRLFFANN-KVSDVSS---LANLTNINWLSAGHN-QISDLT-----  367 (384)
T ss_dssp             GCTTCSEEECCSSCCSCCGG-------GGGCTTCCEEECCSS-CCCCCGG---GGGCTTCCEEECCSS-CCCBCG-----
T ss_pred             hhcccCeEECCCCCCCCCcc-------cccCCCCCEEECCCC-CCCCChh---HcCCCCCCEEECCCC-cCCCCh-----
Confidence            36778888888887776532       235788888888886 5666532   456888888888765 455542     


Q ss_pred             ccccccCCcceeeeecc
Q 000128          644 EINSVEFPSLHHLRIVD  660 (2123)
Q Consensus       644 ~~~~~~l~~L~~L~l~~  660 (2123)
                        ...++++|+.|+|++
T Consensus       368 --~l~~l~~L~~L~L~~  382 (384)
T d2omza2         368 --PLANLTRITQLGLND  382 (384)
T ss_dssp             --GGTTCTTCSEEECCC
T ss_pred             --hhccCCCCCEeeCCC
Confidence              134778888888865



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure