Citrus Sinensis ID: 000228
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1825 | 2.2.26 [Sep-21-2011] | |||||||
| O94387 | 1944 | Uncharacterized ATP-depen | yes | no | 0.155 | 0.145 | 0.365 | 2e-42 | |
| B6SFA4 | 818 | Probable helicase MAGATAM | no | no | 0.163 | 0.365 | 0.330 | 1e-40 | |
| Q00416 | 2231 | Helicase SEN1 OS=Saccharo | yes | no | 0.142 | 0.116 | 0.361 | 3e-40 | |
| Q92355 | 1687 | Helicase sen1 OS=Schizosa | no | no | 0.145 | 0.157 | 0.361 | 4e-40 | |
| Q86AS0 | 967 | Probable helicase DDB_G02 | no | no | 0.158 | 0.298 | 0.344 | 8e-38 | |
| Q9FJR0 | 1254 | Regulator of nonsense tra | no | no | 0.138 | 0.200 | 0.359 | 3e-35 | |
| P30771 | 971 | ATP-dependent helicase NA | no | no | 0.143 | 0.268 | 0.356 | 6e-35 | |
| Q9EPU0 | 1124 | Regulator of nonsense tra | yes | no | 0.16 | 0.259 | 0.332 | 3e-34 | |
| Q92900 | 1129 | Regulator of nonsense tra | yes | no | 0.138 | 0.224 | 0.354 | 7e-34 | |
| Q9HEH1 | 1093 | Regulator of nonsense tra | N/A | no | 0.143 | 0.238 | 0.352 | 9e-34 |
| >sp|O94387|YGSA_SCHPO Uncharacterized ATP-dependent helicase C29A10.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A10.10c PE=3 SV=1 | Back alignment and function desciption |
|---|
Score = 176 bits (445), Expect = 2e-42, Method: Compositional matrix adjust.
Identities = 107/293 (36%), Positives = 169/293 (57%), Gaps = 10/293 (3%)
Query: 594 LVIDEAAQLKESESTIPLQLAGINHAVLIGDECQLPAMVESKISDEAGFGRSLFERL-TS 652
++IDEAAQ E S IPL+ G V++GD QLP V SK S + G+ +SL+ R+
Sbjct: 1513 VIIDEAAQAVELSSIIPLKY-GCESCVMVGDPNQLPPTVLSKTSAKFGYSQSLYVRMFKQ 1571
Query: 653 LNHSKHLLNIQYRMHPSISLFPNLQFYRNQILDGANVKSKSYEKQYLTGTEFGTYSFINI 712
N S LL+IQYRM+P IS FP+ FY +++LDG N+ S + + + G Y F N+
Sbjct: 1572 HNESACLLSIQYRMNPEISRFPSKFFYNSKLLDGPNM-SAVTSRPWHEDPQLGIYRFFNV 1630
Query: 713 IGGREDFIYHSCRNIVEVSAVIKILQKLYKAWVGSKQKVSIGVVSPYTAQVVAIRKKIGF 772
G S N+ E S ++ + ++L + ++ + IGVV+PY +QV +R +
Sbjct: 1631 HGTEAFSNSKSLYNVEEASFILLLYERLIQCYLNIDFEGKIGVVTPYRSQVQQLRSQFQR 1690
Query: 773 EYENKDGFTVKVKSIDGFQGGEEDIIIISTVRCNTGGSIGFISKPQRVNVALTRARHCLW 832
+Y + + + ++DGFQG E+DIII S VR + G IGF+ +R+NVALTRA+ L+
Sbjct: 1691 KYGSIIFKHLDIHTVDGFQGQEKDIIIFSCVRSSMSGGIGFLQDLRRLNVALTRAKSSLY 1750
Query: 833 ILGSERTLISSESIWGALVCDAKARQCFFNADEERNLAKARLEVSKELVEIGA 885
I+G+ + L+ E I+ +L+ DAK R + R+L+ + + SK + +
Sbjct: 1751 IVGNSKPLM-QEDIFYSLIEDAKTRGVW------RDLSANQFKNSKSISNVST 1796
|
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812) EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: - |
| >sp|B6SFA4|MAA3_ARATH Probable helicase MAGATAMA 3 OS=Arabidopsis thaliana GN=MAA3 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q00416|SEN1_YEAST Helicase SEN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEN1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q92355|SEN1_SCHPO Helicase sen1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sen1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q86AS0|Y4399_DICDI Probable helicase DDB_G0274399 OS=Dictyostelium discoideum GN=DDB_G0274399 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q9FJR0|RENT1_ARATH Regulator of nonsense transcripts 1 homolog OS=Arabidopsis thaliana GN=UPF1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|P30771|NAM7_YEAST ATP-dependent helicase NAM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM7 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9EPU0|RENT1_MOUSE Regulator of nonsense transcripts 1 OS=Mus musculus GN=Upf1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q92900|RENT1_HUMAN Regulator of nonsense transcripts 1 OS=Homo sapiens GN=UPF1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9HEH1|RENT1_NEUCR Regulator of nonsense transcripts 1 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=2E4.130 PE=3 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1825 | ||||||
| 359473525 | 2792 | PREDICTED: uncharacterized protein LOC10 | 0.473 | 0.309 | 0.583 | 0.0 | |
| 297738288 | 2562 | unnamed protein product [Vitis vinifera] | 0.449 | 0.320 | 0.569 | 0.0 | |
| 359473527 | 2788 | PREDICTED: uncharacterized protein LOC10 | 0.465 | 0.304 | 0.567 | 0.0 | |
| 255555527 | 2820 | conserved hypothetical protein [Ricinus | 0.499 | 0.323 | 0.541 | 0.0 | |
| 356510822 | 2812 | PREDICTED: uncharacterized protein LOC10 | 0.462 | 0.300 | 0.543 | 0.0 | |
| 297738290 | 6100 | unnamed protein product [Vitis vinifera] | 0.417 | 0.124 | 0.533 | 0.0 | |
| 449445385 | 2763 | PREDICTED: uncharacterized protein LOC10 | 0.458 | 0.302 | 0.515 | 0.0 | |
| 359473529 | 883 | PREDICTED: uncharacterized protein LOC10 | 0.459 | 0.950 | 0.520 | 0.0 | |
| 356577345 | 1636 | PREDICTED: uncharacterized protein LOC10 | 0.459 | 0.512 | 0.488 | 0.0 | |
| 147865014 | 2676 | hypothetical protein VITISV_037587 [Viti | 0.384 | 0.261 | 0.577 | 0.0 |
| >gi|359473525|ref|XP_003631315.1| PREDICTED: uncharacterized protein LOC100265010 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1035 bits (2676), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 518/888 (58%), Positives = 650/888 (73%), Gaps = 24/888 (2%)
Query: 11 MEGKGCSSSSKKAVGFAGHTV---FSWSLEDIFSQSFFKDQVEKIPESFQSVKQYFGSFV 67
ME +G S+ K+A+ + FSWSLEDI + +++QVE+IPE+F + YFGS++
Sbjct: 1 MEKEG--SNKKRAIAKDSRLIELLFSWSLEDISNNDLYRNQVERIPETFGTAGHYFGSYI 58
Query: 68 FPLLEETRMQLRSGLEAMRRAPYAQVIAFEELKPYGTNQYGIEVDYWRNTISNSGKEPYK 127
FPLLEE R ++ S +E + AP+A+V +F+E KPYG+ Y ++VD WRN S+ G+EPYK
Sbjct: 59 FPLLEEIRAEMCSSMEDIHSAPFAEVTSFDESKPYGSLLYDVKVDNWRNRFSDHGREPYK 118
Query: 128 TLPGDILVLADFKPEKVSDLRRVGRTWTFVSVTTVPDDEDENKKENRY-KVKARNNMQVH 186
TLPGDIL+L D KPE VSDL+RVGRTWTF SVT +PDDE+E+ + Y KVK +V
Sbjct: 119 TLPGDILILTDAKPETVSDLQRVGRTWTFASVTRIPDDENEDNSSSTYFKVKISKEYEVD 178
Query: 187 DKTKKSFFFIYLTNILPNKRIWNSLHMCGNWKVITQVLGTDSVVDERCELCSVQRKGQWD 246
D+ ++S F I+L NI+ NKRIWN+LHM GN +I++VL +DS+V E C C V G +
Sbjct: 179 DEKQRSMFVIFLINIVTNKRIWNALHMSGNISIISEVLSSDSLVKENCCQCPVWSDGVYA 238
Query: 247 EKFGPSFSSTLNESQVGAMLACLRRLDCGHRSGVELIWGPPGTGKTKTVSMLLLTLLRIK 306
E F S SS LNESQ A++ CLR++ C H+ VELIWGPPGTGKTKTVS+LL LLR
Sbjct: 239 ENFPMSSSSNLNESQTKAVVTCLRKIQCNHKPSVELIWGPPGTGKTKTVSVLLFKLLRTN 298
Query: 307 CRTLACTPTNVAITELASRVLKLVKESYKRDSRSNTPICPLGDILLFGNKDRLKVNPGFE 366
RTLAC PTNVA+TE+ASRVLKL KES++ N+ C LGDIL+FGNKDRLKV
Sbjct: 299 IRTLACAPTNVAVTEVASRVLKLTKESFE-----NSLFCSLGDILIFGNKDRLKVGADIV 353
Query: 367 EIYLNYRIKKLRECFAPLSGWRHCFSSMIDLLEDCVSQYHIYVE-KLKEREDCNVNQSEE 425
E+YL+YR+ +L ECF PL+GWR+CF+SMID LEDCVS YHI++E +L++ + C+
Sbjct: 354 EVYLDYRVDRLIECFGPLTGWRYCFNSMIDFLEDCVSHYHIFLENELRKEKSCSNEGGST 413
Query: 426 KE--------CRKETEGSKGERKPFLKYVRERFKCAVVSLRNCIFIFCTHLPKSYISENS 477
KE E SK K F+++ R+RFK LR C+ IFCTHL K +I E +
Sbjct: 414 KEEVFMKNELSSNECGSSKKVDKSFIEFARDRFKATAGPLRRCVQIFCTHLSKDFILEQN 473
Query: 478 FQEMVALKSLLDSFGNLLFQDNVVSKELEKLFSHSVDEGISWAFVRKRYLLQL-HQRRSE 536
FQ MV L LLDSF +LL +D+VV +ELEKLFSH E + + L + R E
Sbjct: 474 FQNMVDLIRLLDSFESLLSKDDVVPEELEKLFSHQ--EAVQDSSPSFSDSSNLLYMSRGE 531
Query: 537 CLSVLRNLWNSLDELNLPCTTSKLVLEDFCFKRASLFFSTASSSYKLHSVEIKPLNFLVI 596
CLSVL+ L SL++L+LP ++ ++++FCFK ASL F TASSSYKLHS +KPL+ LVI
Sbjct: 532 CLSVLKILRGSLNKLSLPSGMNEGLIKEFCFKMASLIFCTASSSYKLHSANMKPLDLLVI 591
Query: 597 DEAAQLKESESTIPLQLAGINHAVLIGDECQLPAMVESKISDEAGFGRSLFERLTSLNHS 656
DEAAQLKE ESTIPLQL GI HA+LIGDECQLPAMV SK+S EAGFGRSLFERL+SL H
Sbjct: 592 DEAAQLKECESTIPLQLPGIRHAILIGDECQLPAMVSSKVSKEAGFGRSLFERLSSLGHF 651
Query: 657 KHLLNIQYRMHPSISLFPNLQFYRNQILDGANVKSKSYEKQYLTGTEFGTYSFINIIGGR 716
KHLLN+QYRMHPSIS FPN +FY NQILD NVKSKSY K YL+G FG+YSFIN+ G
Sbjct: 652 KHLLNVQYRMHPSISFFPNSKFYFNQILDAPNVKSKSYTKHYLSGPMFGSYSFINVRGKE 711
Query: 717 E-DFIYHSCRNIVEVSAVIKILQKLYKAWVGSKQKVSIGVVSPYTAQVVAIRKKIGFEYE 775
E D + S +N++EV+ VIKI++ LYK W GS QK+SIGV+SPY AQVVAI+ K+G +YE
Sbjct: 712 EHDDVGKSRKNMIEVAIVIKIVRNLYKEWSGSNQKLSIGVISPYAAQVVAIQDKLGQKYE 771
Query: 776 NKDGFTVKVKSIDGFQGGEEDIIIISTVRCNTGGSIGFISKPQRVNVALTRARHCLWILG 835
F+VKVK++DGFQGGEEDIIII TVR NTGGSIGF+S PQR NVALTRAR+CLWILG
Sbjct: 772 KLGNFSVKVKTVDGFQGGEEDIIIICTVRSNTGGSIGFLSNPQRTNVALTRARYCLWILG 831
Query: 836 SERTLISSESIWGALVCDAKARQCFFNADEERNLAKARLEVSKELVEI 883
+ERTL +SESIW LV DAK R+CFFNADE++++A A LEV E ++
Sbjct: 832 NERTLANSESIWEDLVLDAKKRKCFFNADEDKDIANAILEVKTEFDQL 879
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297738288|emb|CBI27489.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359473527|ref|XP_002263192.2| PREDICTED: uncharacterized protein LOC100243095 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255555527|ref|XP_002518800.1| conserved hypothetical protein [Ricinus communis] gi|223542181|gb|EEF43725.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356510822|ref|XP_003524133.1| PREDICTED: uncharacterized protein LOC100802419 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297738290|emb|CBI27491.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449445385|ref|XP_004140453.1| PREDICTED: uncharacterized protein LOC101214394 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|359473529|ref|XP_003631316.1| PREDICTED: uncharacterized protein LOC100855072 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356577345|ref|XP_003556787.1| PREDICTED: uncharacterized protein LOC100781902 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|147865014|emb|CAN78970.1| hypothetical protein VITISV_037587 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1825 | ||||||
| TAIR|locus:2018561 | 1050 | AT1G65810 [Arabidopsis thalian | 0.183 | 0.318 | 0.567 | 4.4e-155 | |
| TAIR|locus:2018536 | 1065 | AT1G65780 [Arabidopsis thalian | 0.446 | 0.764 | 0.395 | 1.1e-148 | |
| TAIR|locus:2166173 | 839 | AT5G37150 [Arabidopsis thalian | 0.192 | 0.418 | 0.491 | 2.1e-131 | |
| TAIR|locus:2166163 | 692 | AT5G37140 [Arabidopsis thalian | 0.189 | 0.5 | 0.490 | 1.2e-129 | |
| TAIR|locus:2173033 | 676 | AT5G52090 [Arabidopsis thalian | 0.192 | 0.519 | 0.491 | 4.6e-129 | |
| TAIR|locus:2166183 | 871 | AT5G37160 [Arabidopsis thalian | 0.179 | 0.376 | 0.516 | 5.6e-128 | |
| TAIR|locus:2152627 | 638 | AT5G37030 [Arabidopsis thalian | 0.167 | 0.478 | 0.526 | 2.5e-122 | |
| TAIR|locus:2135472 | 689 | AT4G05540 [Arabidopsis thalian | 0.355 | 0.941 | 0.409 | 2.8e-114 | |
| TAIR|locus:2059088 | 1090 | AT2G19120 "AT2G19120" [Arabido | 0.168 | 0.281 | 0.376 | 5e-45 | |
| TAIR|locus:2126480 | 1311 | AT4G30100 [Arabidopsis thalian | 0.162 | 0.226 | 0.378 | 2.1e-44 |
| TAIR|locus:2018561 AT1G65810 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 943 (337.0 bits), Expect = 4.4e-155, Sum P(3) = 4.4e-155
Identities = 193/340 (56%), Positives = 245/340 (72%)
Query: 533 RRSECLSVLRNLWNSLDELNLPCTTSKLVLEDFCFKRASLFFSTASSSYKLHSVEIKPLN 592
R +CL +L ++ S+ LP SK L+ C A L F TASSS +LH P+
Sbjct: 500 RTQDCLEMLTSISMSI---KLPDFISKFELQKLCLDNAYLLFCTASSSARLHMSS--PIQ 554
Query: 593 FLVIDEAAQLKESESTIPLQLAGINHAVLIGDECQLPAMVESKISDEAGFGRSLFERLTS 652
LVIDEAAQLKE ES IPLQL G+ HA+LIGDE QLPAM++S I+ EA GRSLFERL
Sbjct: 555 LLVIDEAAQLKECESAIPLQLRGLQHAILIGDEKQLPAMIKSNIASEADLGRSLFERLVL 614
Query: 653 LNHSKHLLNIQYRMHPSISLFPNLQFYRNQILDGANVKSKSYEKQYLTGTEFGTYSFINI 712
L H+K LLN+QYRMHPSIS+FPN +FY +ILD +V+ +SYEK++L +G YSFINI
Sbjct: 615 LGHNKQLLNMQYRMHPSISIFPNREFYDMKILDAPSVRLRSYEKKFLPEKMYGPYSFINI 674
Query: 713 IGGREDFIY-HSCRNIVEVSAVIKILQKLYKAWVGSKQKVSIGVVSPYTAQVVAIRKKIG 771
GRE F +S +N+VEVS V +I+ KLY + + +S+GV+SPY AQV AI+++IG
Sbjct: 675 AYGREQFGEGYSSKNLVEVSVVAEIVSKLYSVSRKTGRTISVGVISPYKAQVFAIQERIG 734
Query: 772 FEYENKDGFTVKVKSIDGFQGGEEDIIIISTVRCNTGGSIGFISKPQRVNVALTRARHCL 831
+Y + FTV V+S+DGFQGGEEDIIIISTVR N G+IGF+S QR NVALTRAR+CL
Sbjct: 735 EKYNTEGTFTVSVRSVDGFQGGEEDIIIISTVRSNGNGAIGFLSNQQRTNVALTRARYCL 794
Query: 832 WILGSERTLISSESIWGALVCDAKARQCFFNADEERNLAK 871
WILG+E TL ++ S+W LV DAKAR CF NA+E+ +LA+
Sbjct: 795 WILGNEATLTNNRSVWRQLVDDAKARNCFHNAEEDESLAQ 834
|
|
| TAIR|locus:2018536 AT1G65780 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166173 AT5G37150 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166163 AT5G37140 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2173033 AT5G52090 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166183 AT5G37160 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2152627 AT5G37030 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2135472 AT4G05540 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2059088 AT2G19120 "AT2G19120" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2126480 AT4G30100 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.6.4 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1825 | |||
| pfam13087 | 195 | pfam13087, AAA_12, AAA domain | 4e-67 | |
| TIGR00376 | 637 | TIGR00376, TIGR00376, DNA helicase, putative | 1e-38 | |
| COG1112 | 767 | COG1112, COG1112, Superfamily I DNA and RNA helica | 1e-38 | |
| pfam13086 | 220 | pfam13086, AAA_11, AAA domain | 5e-15 | |
| pfam13086 | 220 | pfam13086, AAA_11, AAA domain | 4e-13 | |
| TIGR00376 | 637 | TIGR00376, TIGR00376, DNA helicase, putative | 8e-07 | |
| pfam13245 | 73 | pfam13245, AAA_19, Part of AAA domain | 5e-05 | |
| PRK10875 | 615 | PRK10875, recD, exonuclease V subunit alpha; Provi | 6e-04 | |
| pfam13191 | 154 | pfam13191, AAA_16, AAA ATPase domain | 0.001 |
| >gnl|CDD|221913 pfam13087, AAA_12, AAA domain | Back alignment and domain information |
|---|
Score = 224 bits (574), Expect = 4e-67
Identities = 76/197 (38%), Positives = 116/197 (58%), Gaps = 6/197 (3%)
Query: 642 FGRSLFERL-TSLNHSKHLLNIQYRMHPSISLFPNLQFYRNQILDGANVKSKSYEKQYLT 700
RSLFERL + + +L+ QYRMHP IS FP+ FY ++ DG +V + +
Sbjct: 1 LDRSLFERLQEAGPEAVVMLDTQYRMHPDISEFPSELFYGGKLKDGESVAERPLPWDFHL 60
Query: 701 GTEFGTYSFINIIGGRE-DFIYHSCRNIVEVSAVIKILQKLYKAWVGSKQKVSIGVVSPY 759
G FI++ G E + S N E V+++++KL K+ ++ IG+++PY
Sbjct: 61 PDPLGPLVFIDVDGSEEEEEKSTSYSNEAEAELVVQLVEKLLKSGP--EKNKDIGIITPY 118
Query: 760 TAQVVAIRKKIGFEYENKDGFTVKVKSIDGFQGGEEDIIIISTVRCNTGGSIGFISKPQR 819
AQV I+K + + + ++V ++DGFQG E+D+II STVR N G IGF+S P+R
Sbjct: 119 RAQVRLIKKLL--KRKFGGEPDIEVNTVDGFQGREKDVIIFSTVRSNEKGGIGFLSDPRR 176
Query: 820 VNVALTRARHCLWILGS 836
+NVALTRA+ L I+G+
Sbjct: 177 LNVALTRAKRGLIIVGN 193
|
This family of domains contain a P-loop motif that is characteristic of the AAA superfamily. Many of the proteins in this family are conjugative transfer proteins. Length = 195 |
| >gnl|CDD|232945 TIGR00376, TIGR00376, DNA helicase, putative | Back alignment and domain information |
|---|
| >gnl|CDD|224037 COG1112, COG1112, Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|221912 pfam13086, AAA_11, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|221912 pfam13086, AAA_11, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|232945 TIGR00376, TIGR00376, DNA helicase, putative | Back alignment and domain information |
|---|
| >gnl|CDD|222005 pfam13245, AAA_19, Part of AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|236783 PRK10875, recD, exonuclease V subunit alpha; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1825 | |||
| KOG1802 | 935 | consensus RNA helicase nonsense mRNA reducing fact | 100.0 | |
| KOG1803 | 649 | consensus DNA helicase [Replication, recombination | 100.0 | |
| TIGR00376 | 637 | DNA helicase, putative. The gene product may repre | 100.0 | |
| KOG1801 | 827 | consensus tRNA-splicing endonuclease positive effe | 100.0 | |
| KOG1805 | 1100 | consensus DNA replication helicase [Replication, r | 100.0 | |
| KOG1807 | 1025 | consensus Helicases [Replication, recombination an | 100.0 | |
| COG1112 | 767 | Superfamily I DNA and RNA helicases and helicase s | 100.0 | |
| PF13087 | 200 | AAA_12: AAA domain; PDB: 2XZO_A 2WJY_A 2WJV_A 2XZP | 100.0 | |
| KOG1804 | 775 | consensus RNA helicase [RNA processing and modific | 100.0 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 99.97 | |
| KOG1806 | 1320 | consensus DEAD box containing helicases [Replicati | 99.97 | |
| PRK11054 | 684 | helD DNA helicase IV; Provisional | 99.92 | |
| TIGR01073 | 726 | pcrA ATP-dependent DNA helicase PcrA. Designed to | 99.88 | |
| PRK11773 | 721 | uvrD DNA-dependent helicase II; Provisional | 99.88 | |
| TIGR01075 | 715 | uvrD DNA helicase II. Designed to identify uvrD me | 99.87 | |
| PRK10919 | 672 | ATP-dependent DNA helicase Rep; Provisional | 99.86 | |
| TIGR01447 | 586 | recD exodeoxyribonuclease V, alpha subunit. This f | 99.85 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 99.84 | |
| PRK10875 | 615 | recD exonuclease V subunit alpha; Provisional | 99.82 | |
| TIGR02785 | 1232 | addA_Gpos recombination helicase AddA, Firmicutes | 99.81 | |
| TIGR02768 | 744 | TraA_Ti Ti-type conjugative transfer relaxase TraA | 99.77 | |
| TIGR00609 | 1087 | recB exodeoxyribonuclease V, beta subunit. All pro | 99.75 | |
| PRK13909 | 910 | putative recombination protein RecB; Provisional | 99.74 | |
| TIGR02784 | 1141 | addA_alphas double-strand break repair helicase Ad | 99.7 | |
| PRK13826 | 1102 | Dtr system oriT relaxase; Provisional | 99.7 | |
| PRK13889 | 988 | conjugal transfer relaxase TraA; Provisional | 99.69 | |
| PRK10876 | 1181 | recB exonuclease V subunit beta; Provisional | 99.69 | |
| COG1074 | 1139 | RecB ATP-dependent exoDNAse (exonuclease V) beta s | 99.69 | |
| TIGR01074 | 664 | rep ATP-dependent DNA helicase Rep. Designed to id | 99.66 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 99.63 | |
| COG0210 | 655 | UvrD Superfamily I DNA and RNA helicases [DNA repl | 99.53 | |
| COG3973 | 747 | Superfamily I DNA and RNA helicases [General funct | 99.52 | |
| PRK13709 | 1747 | conjugal transfer nickase/helicase TraI; Provision | 99.5 | |
| PRK14712 | 1623 | conjugal transfer nickase/helicase TraI; Provision | 99.48 | |
| PF00580 | 315 | UvrD-helicase: UvrD/REP helicase N-terminal domain | 99.45 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 99.33 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 99.19 | |
| PF01443 | 234 | Viral_helicase1: Viral (Superfamily 1) RNA helicas | 99.08 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 98.98 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 98.98 | |
| COG0507 | 696 | RecD ATP-dependent exoDNAse (exonuclease V), alpha | 98.89 | |
| PF13361 | 351 | UvrD_C: UvrD-like helicase C-terminal domain; PDB: | 98.26 | |
| TIGR02773 | 1158 | addB_Gpos ATP-dependent nuclease subunit B. DNA re | 98.2 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 98.2 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 98.14 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 98.02 | |
| COG3972 | 660 | Superfamily I DNA and RNA helicases [General funct | 98.02 | |
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 97.95 | |
| KOG1804 | 775 | consensus RNA helicase [RNA processing and modific | 97.95 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 97.94 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 97.73 | |
| PF13538 | 104 | UvrD_C_2: UvrD-like helicase C-terminal domain; PD | 97.61 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 97.6 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 97.17 | |
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 97.06 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 97.04 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 97.03 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 97.0 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 96.91 | |
| PRK08181 | 269 | transposase; Validated | 96.84 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 96.82 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 96.8 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 96.77 | |
| PRK12377 | 248 | putative replication protein; Provisional | 96.76 | |
| PRK08116 | 268 | hypothetical protein; Validated | 96.76 | |
| PF07652 | 148 | Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR | 96.68 | |
| KOG0989 | 346 | consensus Replication factor C, subunit RFC4 [Repl | 96.67 | |
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 96.63 | |
| PTZ00424 | 401 | helicase 45; Provisional | 96.58 | |
| PRK06526 | 254 | transposase; Provisional | 96.57 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 96.5 | |
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 96.49 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 96.48 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 96.46 | |
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 96.38 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 96.33 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 96.32 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 96.32 | |
| PRK01172 | 674 | ski2-like helicase; Provisional | 96.29 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 96.24 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 96.22 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 96.21 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 96.21 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 96.21 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 96.19 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 96.15 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 96.15 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 96.11 | |
| COG1875 | 436 | NYN ribonuclease and ATPase of PhoH family domains | 96.1 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 96.07 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 96.05 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 96.04 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 96.04 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 96.02 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 95.98 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 95.97 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 95.9 | |
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 95.84 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 95.81 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 95.81 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 95.81 | |
| PRK08727 | 233 | hypothetical protein; Validated | 95.8 | |
| COG4096 | 875 | HsdR Type I site-specific restriction-modification | 95.8 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 95.76 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 95.74 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 95.74 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 95.71 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 95.67 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 95.66 | |
| PRK02362 | 737 | ski2-like helicase; Provisional | 95.65 | |
| PRK00254 | 720 | ski2-like helicase; Provisional | 95.63 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 95.63 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 95.62 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 95.6 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 95.58 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 95.55 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 95.55 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 95.54 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 95.49 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 95.45 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 95.45 | |
| PRK10436 | 462 | hypothetical protein; Provisional | 95.45 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 95.42 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 95.39 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 95.38 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 95.38 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 95.38 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 95.38 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 95.37 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 95.36 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 95.36 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 95.32 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 95.31 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 95.26 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 95.25 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 95.22 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 95.17 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 95.16 | |
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 95.15 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 95.14 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 95.11 | |
| smart00488 | 289 | DEXDc2 DEAD-like helicases superfamily. | 95.11 | |
| smart00489 | 289 | DEXDc3 DEAD-like helicases superfamily. | 95.11 | |
| PRK14701 | 1638 | reverse gyrase; Provisional | 95.1 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 95.08 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 95.08 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 95.05 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 95.04 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 95.02 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 95.02 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 94.98 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 94.97 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 94.96 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 94.95 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 94.93 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 94.93 | |
| TIGR00348 | 667 | hsdR type I site-specific deoxyribonuclease, HsdR | 94.93 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 94.93 | |
| TIGR01587 | 358 | cas3_core CRISPR-associated helicase Cas3. This mo | 94.92 | |
| TIGR02538 | 564 | type_IV_pilB type IV-A pilus assembly ATPase PilB. | 94.89 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 94.87 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 94.85 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 94.83 | |
| TIGR03158 | 357 | cas3_cyano CRISPR-associated helicase, Cyano-type. | 94.76 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 94.76 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 94.74 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 94.72 | |
| PHA02653 | 675 | RNA helicase NPH-II; Provisional | 94.71 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 94.68 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 94.66 | |
| TIGR01074 | 664 | rep ATP-dependent DNA helicase Rep. Designed to id | 94.65 | |
| PF13173 | 128 | AAA_14: AAA domain | 94.63 | |
| COG0552 | 340 | FtsY Signal recognition particle GTPase [Intracell | 94.59 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 94.58 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 94.57 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 94.56 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 94.55 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 94.54 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 94.53 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 94.53 | |
| cd01983 | 99 | Fer4_NifH The Fer4_NifH superfamily contains a var | 94.52 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 94.5 | |
| KOG0743 | 457 | consensus AAA+-type ATPase [Posttranslational modi | 94.48 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 94.47 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 94.47 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 94.46 | |
| PRK09694 | 878 | helicase Cas3; Provisional | 94.46 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 94.41 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 94.4 | |
| TIGR01967 | 1283 | DEAH_box_HrpA ATP-dependent helicase HrpA. This mo | 94.4 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 94.39 | |
| PRK13768 | 253 | GTPase; Provisional | 94.38 | |
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 94.34 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 94.32 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 94.32 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 94.27 | |
| PF05729 | 166 | NACHT: NACHT domain | 94.21 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 94.19 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 94.19 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 94.08 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 94.07 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 94.05 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 94.01 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 94.01 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 94.0 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 93.99 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 93.99 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 93.95 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 93.92 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 93.91 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 93.9 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 93.88 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 93.84 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 93.84 | |
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 93.81 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 93.81 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 93.8 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 93.8 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 93.78 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 93.77 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 93.75 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 93.75 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 93.64 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 93.63 | |
| KOG0651 | 388 | consensus 26S proteasome regulatory complex, ATPas | 93.63 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 93.6 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 93.59 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 93.58 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 93.58 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 93.56 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 93.54 | |
| ) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309 | 127 | Torsin: Torsin; InterPro: IPR010448 This family co | 93.5 | |
| KOG2108 | 853 | consensus 3'-5' DNA helicase [Replication, recombi | 93.48 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 93.48 | |
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 93.47 | |
| COG1643 | 845 | HrpA HrpA-like helicases [DNA replication, recombi | 93.47 | |
| PTZ00110 | 545 | helicase; Provisional | 93.46 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 93.45 | |
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 93.45 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 93.45 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 93.4 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 93.4 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 93.4 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 93.38 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 93.38 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 93.37 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 93.37 | |
| PF02492 | 178 | cobW: CobW/HypB/UreG, nucleotide-binding domain; I | 93.36 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 93.35 | |
| PF13177 | 162 | DNA_pol3_delta2: DNA polymerase III, delta subunit | 93.29 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 93.28 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 93.25 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 93.18 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 93.13 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 93.13 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 93.12 | |
| PRK06620 | 214 | hypothetical protein; Validated | 93.1 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 93.06 | |
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 93.06 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 93.04 | |
| cd03114 | 148 | ArgK-like The function of this protein family is u | 93.02 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 92.99 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 92.99 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 92.99 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 92.98 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 92.96 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 92.95 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 92.92 | |
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 92.9 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 92.9 | |
| COG4098 | 441 | comFA Superfamily II DNA/RNA helicase required for | 92.85 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 92.84 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 92.84 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 92.78 | |
| KOG2108 | 853 | consensus 3'-5' DNA helicase [Replication, recombi | 92.75 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 92.74 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 92.73 | |
| COG0714 | 329 | MoxR-like ATPases [General function prediction onl | 92.72 | |
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 92.62 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 92.53 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 92.52 | |
| PF01443 | 234 | Viral_helicase1: Viral (Superfamily 1) RNA helicas | 92.44 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 92.43 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 92.42 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 92.39 | |
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 92.33 | |
| PRK06696 | 223 | uridine kinase; Validated | 92.31 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 92.24 | |
| TIGR03754 | 643 | conj_TOL_TraD conjugative coupling factor TraD, TO | 92.22 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 92.19 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 92.16 | |
| PRK13766 | 773 | Hef nuclease; Provisional | 92.1 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 92.09 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 92.02 | |
| PRK13764 | 602 | ATPase; Provisional | 91.99 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 91.94 | |
| PRK07667 | 193 | uridine kinase; Provisional | 91.88 | |
| PF12846 | 304 | AAA_10: AAA-like domain | 91.87 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 91.86 | |
| PHA02244 | 383 | ATPase-like protein | 91.86 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 91.82 | |
| COG1199 | 654 | DinG Rad3-related DNA helicases [Transcription / D | 91.79 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 91.7 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 91.68 | |
| TIGR03600 | 421 | phage_DnaB phage replicative helicase, DnaB family | 91.64 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 91.63 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 91.62 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 91.6 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 91.59 | |
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 91.57 | |
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 91.55 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 91.51 | |
| PF05127 | 177 | Helicase_RecD: Helicase; InterPro: IPR007807 This | 91.49 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 91.48 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 91.42 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 91.41 | |
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 91.39 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 91.36 | |
| TIGR03117 | 636 | cas_csf4 CRISPR-associated DEAD/DEAH-box helicase | 91.34 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 91.33 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 91.31 | |
| TIGR00665 | 434 | DnaB replicative DNA helicase. This model describe | 91.29 | |
| PHA02624 | 647 | large T antigen; Provisional | 91.23 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 91.19 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 91.07 | |
| PF13476 | 202 | AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V | 91.02 | |
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 91.01 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 91.01 | |
| cd02034 | 116 | CooC The accessory protein CooC, which contains a | 91.0 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 91.0 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 90.97 | |
| KOG1533 | 290 | consensus Predicted GTPase [General function predi | 90.95 | |
| PRK05298 | 652 | excinuclease ABC subunit B; Provisional | 90.94 | |
| COG5192 | 1077 | BMS1 GTP-binding protein required for 40S ribosome | 90.93 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 90.92 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 90.9 | |
| TIGR00041 | 195 | DTMP_kinase thymidylate kinase. Function: phosphor | 90.86 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 90.86 | |
| PF06068 | 398 | TIP49: TIP49 C-terminus; InterPro: IPR010339 This | 90.84 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 90.83 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 90.74 | |
| PF13521 | 163 | AAA_28: AAA domain; PDB: 1LW7_A. | 90.73 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 90.68 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 90.66 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 90.65 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 90.64 | |
| TIGR00764 | 608 | lon_rel lon-related putative ATP-dependent proteas | 90.58 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 90.53 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 90.5 | |
| cd02117 | 212 | NifH_like This family contains the NifH (iron prot | 90.49 | |
| PRK09519 | 790 | recA DNA recombination protein RecA; Reviewed | 90.47 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 90.46 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 90.46 | |
| PRK14712 | 1623 | conjugal transfer nickase/helicase TraI; Provision | 90.4 | |
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 90.38 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 90.37 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 90.36 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 90.26 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 90.25 | |
| cd00550 | 254 | ArsA_ATPase Oxyanion-translocating ATPase (ArsA). | 90.25 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 90.25 | |
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 90.25 | |
| PRK08506 | 472 | replicative DNA helicase; Provisional | 90.17 | |
| PRK05748 | 448 | replicative DNA helicase; Provisional | 90.17 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 90.12 | |
| PRK14493 | 274 | putative bifunctional molybdopterin-guanine dinucl | 90.11 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 90.09 | |
| PRK08074 | 928 | bifunctional ATP-dependent DNA helicase/DNA polyme | 90.09 | |
| PRK07246 | 820 | bifunctional ATP-dependent DNA helicase/DNA polyme | 90.08 | |
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 90.08 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 90.08 | |
| cd01672 | 200 | TMPK Thymidine monophosphate kinase (TMPK), also k | 90.03 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 90.03 | |
| PRK13765 | 637 | ATP-dependent protease Lon; Provisional | 89.99 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 89.99 | |
| PRK00698 | 205 | tmk thymidylate kinase; Validated | 89.99 | |
| TIGR00455 | 184 | apsK adenylylsulfate kinase (apsK). Important resi | 89.97 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 89.94 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 89.92 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 89.84 | |
| COG1204 | 766 | Superfamily II helicase [General function predicti | 89.81 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 89.8 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 89.78 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 89.78 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 89.74 | |
| PRK07399 | 314 | DNA polymerase III subunit delta'; Validated | 89.7 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 89.7 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 89.68 | |
| PF03796 | 259 | DnaB_C: DnaB-like helicase C terminal domain; Inte | 89.58 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 89.56 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 89.53 | |
| PLN02200 | 234 | adenylate kinase family protein | 89.52 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 89.52 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 89.52 | |
| cd02035 | 217 | ArsA ArsA ATPase functionas as an efflux pump loca | 89.51 | |
| PF05707 | 193 | Zot: Zonular occludens toxin (Zot); InterPro: IPR0 | 89.51 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 89.5 | |
| PF02399 | 824 | Herpes_ori_bp: Origin of replication binding prote | 89.5 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 89.49 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 89.47 | |
| TIGR00708 | 173 | cobA cob(I)alamin adenosyltransferase. Alternate n | 89.44 | |
| COG0210 | 655 | UvrD Superfamily I DNA and RNA helicases [DNA repl | 89.43 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 89.43 | |
| cd02040 | 270 | NifH NifH gene encodes component II (iron protein) | 89.41 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 89.38 | |
| COG1702 | 348 | PhoH Phosphate starvation-inducible protein PhoH, | 89.35 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 89.34 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 89.28 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 89.28 | |
| PRK03839 | 180 | putative kinase; Provisional | 89.27 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 89.27 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 89.26 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 89.19 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 89.18 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 89.14 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 89.14 | |
| TIGR02621 | 844 | cas3_GSU0051 CRISPR-associated helicase Cas3, Anae | 89.12 | |
| PF13479 | 213 | AAA_24: AAA domain | 89.1 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 89.09 | |
| PF06414 | 199 | Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e | 89.08 | |
| cd00561 | 159 | CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B | 89.05 | |
| TIGR01618 | 220 | phage_P_loop phage nucleotide-binding protein. Thi | 88.93 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 88.9 | |
| PRK08760 | 476 | replicative DNA helicase; Provisional | 88.88 | |
| KOG0738 | 491 | consensus AAA+-type ATPase [Posttranslational modi | 88.86 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 88.82 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 88.78 | |
| COG0378 | 202 | HypB Ni2+-binding GTPase involved in regulation of | 88.73 | |
| PF00176 | 299 | SNF2_N: SNF2 family N-terminal domain; InterPro: I | 88.67 | |
| TIGR00631 | 655 | uvrb excinuclease ABC, B subunit. This family is b | 88.65 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 88.64 | |
| PRK09165 | 497 | replicative DNA helicase; Provisional | 88.61 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 88.56 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 88.55 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 88.55 | |
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 88.53 | |
| COG4889 | 1518 | Predicted helicase [General function prediction on | 88.5 | |
| PF02374 | 305 | ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ | 88.41 | |
| PRK08769 | 319 | DNA polymerase III subunit delta'; Validated | 88.4 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 88.39 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 88.37 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 88.35 | |
| cd03116 | 159 | MobB Molybdenum is an essential trace element in t | 88.34 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 88.34 | |
| COG3854 | 308 | SpoIIIAA ncharacterized protein conserved in bacte | 88.33 | |
| PF01580 | 205 | FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 | 88.31 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 88.3 | |
| PRK05595 | 444 | replicative DNA helicase; Provisional | 88.27 | |
| PRK09087 | 226 | hypothetical protein; Validated | 88.26 | |
| PTZ00202 | 550 | tuzin; Provisional | 88.18 | |
| TIGR02016 | 296 | BchX chlorophyllide reductase iron protein subunit | 88.12 | |
| PF00406 | 151 | ADK: Adenylate kinase; InterPro: IPR000850 Adenyla | 88.01 | |
| PRK14494 | 229 | putative molybdopterin-guanine dinucleotide biosyn | 87.99 | |
| PHA02542 | 473 | 41 41 helicase; Provisional | 87.98 | |
| cd02037 | 169 | MRP-like MRP (Multiple Resistance and pH adaptatio | 87.96 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 87.91 | |
| KOG3347 | 176 | consensus Predicted nucleotide kinase/nuclear prot | 87.88 | |
| COG1224 | 450 | TIP49 DNA helicase TIP49, TBP-interacting protein | 87.85 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 87.81 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 87.8 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 87.77 | |
| PRK13234 | 295 | nifH nitrogenase reductase; Reviewed | 87.76 | |
| KOG0952 | 1230 | consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup | 87.74 | |
| PRK15455 | 644 | PrkA family serine protein kinase; Provisional | 87.73 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 87.71 | |
| PRK02496 | 184 | adk adenylate kinase; Provisional | 87.69 | |
| PRK01184 | 184 | hypothetical protein; Provisional | 87.56 | |
| PRK05986 | 191 | cob(I)alamin adenolsyltransferase/cobinamide ATP-d | 87.52 | |
| KOG0741 | 744 | consensus AAA+-type ATPase [Posttranslational modi | 87.52 | |
| COG1855 | 604 | ATPase (PilT family) [General function prediction | 87.49 | |
| PHA02774 | 613 | E1; Provisional | 87.48 | |
| PRK14528 | 186 | adenylate kinase; Provisional | 87.43 | |
| PF10412 | 386 | TrwB_AAD_bind: Type IV secretion-system coupling p | 87.36 | |
| PF12774 | 231 | AAA_6: Hydrolytic ATP binding site of dynein motor | 87.32 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 87.29 | |
| PF01656 | 195 | CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai | 87.27 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 87.11 | |
| TIGR00073 | 207 | hypB hydrogenase accessory protein HypB. HypB is i | 87.08 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 87.07 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 86.95 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 86.94 | |
| PRK06761 | 282 | hypothetical protein; Provisional | 86.91 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 86.91 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 86.87 | |
| TIGR02238 | 313 | recomb_DMC1 meiotic recombinase Dmc1. This model d | 86.85 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 86.84 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 86.73 | |
| KOG0731 | 774 | consensus AAA+-type ATPase containing the peptidas | 86.68 | |
| PRK13973 | 213 | thymidylate kinase; Provisional | 86.59 | |
| PRK08154 | 309 | anaerobic benzoate catabolism transcriptional regu | 86.57 | |
| PTZ00035 | 337 | Rad51 protein; Provisional | 86.55 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 86.4 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 86.37 | |
| KOG0652 | 424 | consensus 26S proteasome regulatory complex, ATPas | 86.34 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 86.26 | |
| PF01745 | 233 | IPT: Isopentenyl transferase; InterPro: IPR002648 | 86.24 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 86.2 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 86.16 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 86.07 | |
| PRK13235 | 274 | nifH nitrogenase reductase; Reviewed | 86.06 |
| >KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.9e-80 Score=733.47 Aligned_cols=600 Identities=25% Similarity=0.312 Sum_probs=447.4
Q ss_pred cccccccccCChhHHHhhchhhHHHHHHHHHHHhhhhccCCCceEEEeeeec-CCCCCceEEEEEeeecccccCCCCCCC
Q 000228 48 QVEKIPESFQSVKQYFGSFVFPLLEETRMQLRSGLEAMRRAPYAQVIAFEEL-KPYGTNQYGIEVDYWRNTISNSGKEPY 126 (1825)
Q Consensus 48 kVkkIP~TF~S~~eYl~SF~PlLLEEtrAdL~SSle~is~Ap~~eIlsve~~-~~~~~~~ydI~v~~~~~~~~~~~~e~y 126 (1825)
+...+..+|.+..+|-++|-|++-.|+..+ ..+.+....+.+.++++ .-++...-.+.+...++ .-
T Consensus 228 ~~~hv~~ry~da~~y~~vf~pliklea~yd-----k~~Kes~~q~~~tvRW~~gLnkk~~a~f~~~k~~~--------e~ 294 (935)
T KOG1802|consen 228 EPPHVQLRYEDAYEYQNVFSPLIKLEADYD-----KRLKESQTQENGTVRWDIGLNKKRLAYFTLPKLDS--------EL 294 (935)
T ss_pred CCCcccccccchHHHhhhcchhhhhhhhhh-----hhhhhhcccccceEEeeeccccceEEEEecCCCcc--------hh
Confidence 567888999999999999999999999887 34444444455566665 22222233333433322 24
Q ss_pred CCCCCCEEEEeecCCCCccccccCCceeEEEEEEeccCCCccccccceEEEEecCCcccccCCCceEEEEEeeccchhHH
Q 000228 127 KTLPGDILVLADFKPEKVSDLRRVGRTWTFVSVTTVPDDEDENKKENRYKVKARNNMQVHDKTKKSFFFIYLTNILPNKR 206 (1825)
Q Consensus 127 ~p~~GDIVlLt~~kP~~~sDL~r~~~~~~la~V~~v~~~~~~~~~~~~~~V~~sk~i~~~~~~~~~~~~v~L~Nl~T~~R 206 (1825)
+...||-+.|+...... ...-.+|+|.++.+...+. ..+-+..+.+ ...+....+.+-++.|-+++.|
T Consensus 295 kl~~GdE~~L~y~~~~~-------~~w~~~g~v~~~pd~~~dE---~~lEl~~~~~--~p~e~~~~Ftvd~vwk~ts~dr 362 (935)
T KOG1802|consen 295 KLAIGDEIRLTYSGGLV-------LPWNGIGSVLKIPDNNGDE---VKLELEFSQD--PPIEVTHGFTVDFVWKSTSFDR 362 (935)
T ss_pred ccccCCeeEEEecCCcC-------CcccccceEEecCCCCcce---eEEEeecCCC--CCcccccceEEEEEEcCccHHH
Confidence 67899999998743221 1133578899888764332 4455555544 2233455678999999999999
Q ss_pred HHHHHhcc-------CCchhHhhhcCCCCccccchhccccccCCCCCccCCCCCCCCCCHHHHHHHHHhhhhccCCCCCC
Q 000228 207 IWNSLHMC-------GNWKVITQVLGTDSVVDERCELCSVQRKGQWDEKFGPSFSSTLNESQVGAMLACLRRLDCGHRSG 279 (1825)
Q Consensus 207 i~~AL~~~-------~n~~li~~IL~~~~~~~~~c~~c~~~~~~~~~~i~~~~~~~~LNeSQ~eAV~saLsa~~c~h~~~ 279 (1825)
|..||... ..+-+.+.+..+.......+..+ +.+......+||.||..||...|+ ++
T Consensus 363 m~~alk~la~D~~~vs~y~y~klLgh~~~~~~~k~~LP---------~~~s~~~lpkLN~SQ~~AV~~VL~-------rp 426 (935)
T KOG1802|consen 363 MQLALKLLAVDEKKVSGYLYHKLLGHPVEDSSLKKLLP---------RRFSVPNLPKLNASQSNAVKHVLQ-------RP 426 (935)
T ss_pred HHHHHHHhhhccccchhhhhhHHhcCcchhhhhcccCc---------hhhcCCCchhhchHHHHHHHHHHc-------CC
Confidence 99999762 22333333333333222222221 233344456899999999999997 79
Q ss_pred eEEEEcCCCCChhHHHHHHHHHHHHc-CCcEEEEcCChHHHHHHHHHHHHHhhhhhccCCCCCCCCCCCCceEEeccCCC
Q 000228 280 VELIWGPPGTGKTKTVSMLLLTLLRI-KCRTLACTPTNVAITELASRVLKLVKESYKRDSRSNTPICPLGDILLFGNKDR 358 (1825)
Q Consensus 280 VsLIqGPPGTGKTkTIaaLL~~LLk~-~~RILVcAPTN~AVDEVaeRL~klv~es~~~~~~~~~~~ygLgdIVRfGn~~r 358 (1825)
++|||||||||||.|+++++..|++. +.+||||||||.|||+++++|.+... .|||+-.+.|
T Consensus 427 lsLIQGPPGTGKTvtsa~IVyhl~~~~~~~VLvcApSNiAVDqLaeKIh~tgL-----------------KVvRl~aksR 489 (935)
T KOG1802|consen 427 LSLIQGPPGTGKTVTSATIVYHLARQHAGPVLVCAPSNIAVDQLAEKIHKTGL-----------------KVVRLCAKSR 489 (935)
T ss_pred ceeeecCCCCCceehhHHHHHHHHHhcCCceEEEcccchhHHHHHHHHHhcCc-----------------eEeeeehhhh
Confidence 99999999999999999999999987 57999999999999999999998632 3899888777
Q ss_pred CCcCchhHHHhHHHHHHHHhhhccCCCCchhhhHhhHHHhhhhHHHHHHHHHHHhhhhcccccchhhHHHhhhhcCCcCC
Q 000228 359 LKVNPGFEEIYLNYRIKKLRECFAPLSGWRHCFSSMIDLLEDCVSQYHIYVEKLKEREDCNVNQSEEKECRKETEGSKGE 438 (1825)
Q Consensus 359 mkI~~eL~~V~LD~RVe~L~~~f~~~~gWr~~L~Sli~lLe~~~~qY~~~lee~~~~~~~de~~~kr~ei~k~~~~~kk~ 438 (1825)
..+...+.-..|.+.++.... |
T Consensus 490 E~~~S~vs~L~lh~~~~~~~~---------------------p------------------------------------- 511 (935)
T KOG1802|consen 490 EDIESDVSFLSLHEQLRNMDK---------------------P------------------------------------- 511 (935)
T ss_pred hhccCCccHHHHHHHHhccCc---------------------H-------------------------------------
Confidence 544333333333322222000 0
Q ss_pred CcchHHHHHHHHHHHHHHHHHHHHHHhccCCCCCCChhhHHHHHHHHHHHHHHHhhhhcCCcchHHHHHHhhccccccch
Q 000228 439 RKPFLKYVRERFKCAVVSLRNCIFIFCTHLPKSYISENSFQEMVALKSLLDSFGNLLFQDNVVSKELEKLFSHSVDEGIS 518 (1825)
Q Consensus 439 ~lsf~efvkerf~~l~~~L~~~i~~L~t~lP~s~iS~~~~~~m~~~l~lL~~le~LL~~~~i~~eeLk~~f~~l~~~~ks 518 (1825)
+|..+.. +-.+. +.+. .
T Consensus 512 -----------------------------------------ELq~l~k-------lkde~-----------gelS----~ 528 (935)
T KOG1802|consen 512 -----------------------------------------ELQKLLK-------LKDEG-----------GELS----S 528 (935)
T ss_pred -----------------------------------------HHHHHHh-------hhhhc-----------cccc----c
Confidence 0000000 00000 0000 0
Q ss_pred hHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhcccCCCccchhHHHHHhhccCcEEEEccccccccccccCCCcCEEEEEc
Q 000228 519 WAFVRKRYLLQLHQRRSECLSVLRNLWNSLDELNLPCTTSKLVLEDFCFKRASLFFSTASSSYKLHSVEIKPLNFLVIDE 598 (1825)
Q Consensus 519 ~~~~~~~~~~kL~e~R~ecl~~Lr~L~~~lk~l~lP~~~~r~~I~~~iLk~A~VI~~T~Sss~~L~~l~~~~fD~VIIDE 598 (1825)
+. ..+ ++ ...+..++.++..|+|||||+.+++.. .+....|..|+|||
T Consensus 529 sD------~~k-----------~~--------------~lk~~~e~ell~~AdVIccTcv~Agd~-rl~~~kfr~VLiDE 576 (935)
T KOG1802|consen 529 SD------EKK-----------YR--------------KLKRAAEKELLNQADVICCTCVGAGDR-RLSKFKFRTVLIDE 576 (935)
T ss_pred hh------hHH-----------HH--------------HHHHHHHHHHHhhcCEEEEecccccch-hhccccccEEEEec
Confidence 00 000 00 012344567899999999999999873 33347899999999
Q ss_pred CCCCChhHHHHHHHhcCCCcEEEEccCCCCCcccccccccccCCcccHHHHHhhcCCCceecccccccCcccccccchhc
Q 000228 599 AAQLKESESTIPLQLAGINHAVLIGDECQLPAMVESKISDEAGFGRSLFERLTSLNHSKHLLNIQYRMHPSISLFPNLQF 678 (1825)
Q Consensus 599 AsQa~E~esLIPL~l~~~krlILVGDpkQLPPtV~S~~a~~~gl~~SLFERLi~~g~~~~~L~~QYRMhP~Is~fpNk~F 678 (1825)
|.|++||+++||+.+ |++++||||||+||+|++..+.++.+|+.+|||+||+..|...++|.+||||||.|++||+..|
T Consensus 577 aTQatEpe~LiPlvl-G~kq~VlVGDh~QLgpvi~~kK~a~Agl~qsLferli~lg~~P~~L~vQYRmhP~lSefpsn~f 655 (935)
T KOG1802|consen 577 ATQATEPECLIPLVL-GAKQLVLVGDHKQLGPVIMCKKAATAGLSQSLFERLISLGIKPIRLQVQYRMHPALSEFPSNMF 655 (935)
T ss_pred ccccCCcchhhhhhh-cceeEEEeccccccCceeeeHHHHHhHHHHHHHHHHHhccCCceEEEEeeeeChhhhhcchhhh
Confidence 999999999999997 8999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cccccccCcccccccchhccccCCC-CCceEEEEecCCccc--ccccccCCHHHHHHHHHHHHHHHHhhcCCCCCceEEE
Q 000228 679 YRNQILDGANVKSKSYEKQYLTGTE-FGTYSFINIIGGRED--FIYHSCRNIVEVSAVIKILQKLYKAWVGSKQKVSIGV 755 (1825)
Q Consensus 679 Y~gkL~d~~sv~~~~~~~~~l~~~~-~~p~~FIdV~~G~ee--~~~~S~~N~~EA~~Vv~iV~~Ll~~~~~~~~~~dIgI 755 (1825)
|+|.|.++....++.....++|.+. ..|+.|... .|.|+ ..|+|+.|..||..+..+|..|++.+.... .|||
T Consensus 656 Y~G~LqnGVT~~~R~~~g~~~pwp~p~~pl~fy~~-~g~eeisasGtSf~Nr~Ea~~~ekii~~l~~~gv~~~---qIGV 731 (935)
T KOG1802|consen 656 YEGELQNGVTEIERSPLGVDFPWPQPDKPLFFYVC-YGQEEISASGTSFLNRTEAANCEKIITKLLKSGVKPS---QIGV 731 (935)
T ss_pred ccchhhcCcchhhhccCCCCCCCCCCCCccceEEe-ccceeeeccccceecHHHHHHHHHHHHHHHHcCCCHH---Heee
Confidence 9999999977666554333333221 347777777 66666 778999999999999999999999987644 5999
Q ss_pred EeecHHHHHHHHHHhchhhc--CCCCCcEEEccccCCCCceeeEEEEEeeecCCCCCcccCCCCCcceeecccccccEEE
Q 000228 756 VSPYTAQVVAIRKKIGFEYE--NKDGFTVKVKSIDGFQGGEEDIIIISTVRCNTGGSIGFISKPQRVNVALTRARHCLWI 833 (1825)
Q Consensus 756 ITPY~aQv~~Ir~~L~~~~~--~~~~~~V~V~TVD~FQG~EkDIVILS~VRSn~~g~iGFL~d~rRLNVALTRAK~~LiI 833 (1825)
||||.+|...|-+.+..... ......|+|.|||+|||+|+|+||+||||+|...+|||+.|+|||||||||||++|+|
T Consensus 732 ITpYegQr~~i~~ym~~~gsl~~~ly~~veVasVDaFQGrEKdfIIlSCVRsn~~qgIGFl~d~RRlNVaLTRaK~glvi 811 (935)
T KOG1802|consen 732 ITPYEGQRSYIVNYMQTNGSLHKDLYKEVEVASVDAFQGREKDFIILSCVRSNEHQGIGFLNDPRRLNVALTRAKYGLVI 811 (935)
T ss_pred ecccchhHHHHHHHHHhcCccccchhheeEEEeeccccCcccceEEEEEeecccccccccccCchhhhhhhhhcccceEE
Confidence 99999999999998865433 2233578999999999999999999999999999999999999999999999999999
Q ss_pred EechhhhcccchHHHHHHHHHhhcCceecCc
Q 000228 834 LGSERTLISSESIWGALVCDAKARQCFFNAD 864 (1825)
Q Consensus 834 VGn~~tL~~s~~~Wk~LI~~ak~rgc~~~~~ 864 (1825)
|||+..|++ ++.|..+|.|++++++++.+.
T Consensus 812 vGN~~~L~k-~~LW~~li~h~~eke~l~eg~ 841 (935)
T KOG1802|consen 812 VGNPKVLRK-HPLWGHLITHYKEKEVLVEGP 841 (935)
T ss_pred ecCHHHhhh-chHHHHHHHHhhcccceeecc
Confidence 999999987 799999999999999999854
|
|
| >KOG1803 consensus DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00376 DNA helicase, putative | Back alignment and domain information |
|---|
| >KOG1801 consensus tRNA-splicing endonuclease positive effector (SEN1) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1805 consensus DNA replication helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1807 consensus Helicases [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG1112 Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13087 AAA_12: AAA domain; PDB: 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A 2XZL_A | Back alignment and domain information |
|---|
| >KOG1804 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >KOG1806 consensus DEAD box containing helicases [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK11054 helD DNA helicase IV; Provisional | Back alignment and domain information |
|---|
| >TIGR01073 pcrA ATP-dependent DNA helicase PcrA | Back alignment and domain information |
|---|
| >PRK11773 uvrD DNA-dependent helicase II; Provisional | Back alignment and domain information |
|---|
| >TIGR01075 uvrD DNA helicase II | Back alignment and domain information |
|---|
| >PRK10919 ATP-dependent DNA helicase Rep; Provisional | Back alignment and domain information |
|---|
| >TIGR01447 recD exodeoxyribonuclease V, alpha subunit | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >PRK10875 recD exonuclease V subunit alpha; Provisional | Back alignment and domain information |
|---|
| >TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type | Back alignment and domain information |
|---|
| >TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA | Back alignment and domain information |
|---|
| >TIGR00609 recB exodeoxyribonuclease V, beta subunit | Back alignment and domain information |
|---|
| >PRK13909 putative recombination protein RecB; Provisional | Back alignment and domain information |
|---|
| >TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type | Back alignment and domain information |
|---|
| >PRK13826 Dtr system oriT relaxase; Provisional | Back alignment and domain information |
|---|
| >PRK13889 conjugal transfer relaxase TraA; Provisional | Back alignment and domain information |
|---|
| >PRK10876 recB exonuclease V subunit beta; Provisional | Back alignment and domain information |
|---|
| >COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01074 rep ATP-dependent DNA helicase Rep | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG3973 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13709 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >PRK14712 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >COG0507 RecD ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13361 UvrD_C: UvrD-like helicase C-terminal domain; PDB: 1UAA_B 3U4Q_A 3U44_A 1W36_B 3K70_B 2IS6_B 3LFU_A 2IS2_B 2IS1_B 2IS4_A | Back alignment and domain information |
|---|
| >TIGR02773 addB_Gpos ATP-dependent nuclease subunit B | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >COG3972 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >KOG1804 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PF13538 UvrD_C_2: UvrD-like helicase C-terminal domain; PDB: 1W36_G 3K70_G 3DMN_A 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain | Back alignment and domain information |
|---|
| >KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >smart00488 DEXDc2 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >smart00489 DEXDc3 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR01587 cas3_core CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PHA02653 RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01074 rep ATP-dependent DNA helicase Rep | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK09694 helicase Cas3; Provisional | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins | Back alignment and domain information |
|---|
| >KOG2108 consensus 3'-5' DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >cd03114 ArgK-like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG2108 consensus 3'-5' DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >COG0714 MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >TIGR03754 conj_TOL_TraD conjugative coupling factor TraD, TOL family | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PF12846 AAA_10: AAA-like domain | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00665 DnaB replicative DNA helicase | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >KOG1533 consensus Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05298 excinuclease ABC subunit B; Provisional | Back alignment and domain information |
|---|
| >COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00041 DTMP_kinase thymidylate kinase | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13521 AAA_28: AAA domain; PDB: 1LW7_A | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00764 lon_rel lon-related putative ATP-dependent protease | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase | Back alignment and domain information |
|---|
| >PRK09519 recA DNA recombination protein RecA; Reviewed | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >PRK14712 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK08506 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK05748 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >PRK13765 ATP-dependent protease Lon; Provisional | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK00698 tmk thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >TIGR00455 apsK adenylylsulfate kinase (apsK) | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >COG1204 Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK07399 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell | Back alignment and domain information |
|---|
| >PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >TIGR00708 cobA cob(I)alamin adenosyltransferase | Back alignment and domain information |
|---|
| >COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype | Back alignment and domain information |
|---|
| >PF13479 AAA_24: AAA domain | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] | Back alignment and domain information |
|---|
| >cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP | Back alignment and domain information |
|---|
| >TIGR01618 phage_P_loop phage nucleotide-binding protein | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08760 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] | Back alignment and domain information |
|---|
| >PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e | Back alignment and domain information |
|---|
| >TIGR00631 uvrb excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK09165 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >COG4889 Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B | Back alignment and domain information |
|---|
| >PRK08769 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK05595 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PTZ00202 tuzin; Provisional | Back alignment and domain information |
|---|
| >TIGR02016 BchX chlorophyllide reductase iron protein subunit X | Back alignment and domain information |
|---|
| >PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction |
Back alignment and domain information |
|---|
| >PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional | Back alignment and domain information |
|---|
| >PHA02542 41 41 helicase; Provisional | Back alignment and domain information |
|---|
| >cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK13234 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK15455 PrkA family serine protein kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >PRK02496 adk adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK01184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated | Back alignment and domain information |
|---|
| >KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1855 ATPase (PilT family) [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02774 E1; Provisional | Back alignment and domain information |
|---|
| >PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein | Back alignment and domain information |
|---|
| >PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >TIGR00073 hypB hydrogenase accessory protein HypB | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >PRK06761 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13973 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >PTZ00035 Rad51 protein; Provisional | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >PRK13235 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1825 | ||||
| 2xzl_A | 802 | Upf1-Rna Complex Length = 802 | 6e-36 | ||
| 2wjv_A | 800 | Crystal Structure Of The Complex Between Human Nons | 2e-35 | ||
| 2xzo_A | 623 | Upf1 Helicase - Rna Complex Length = 623 | 3e-35 | ||
| 2gjk_A | 624 | Structural And Functional Insights Into The Human U | 3e-35 | ||
| 4b3g_A | 646 | Crystal Structure Of Ighmbp2 Helicase In Complex Wi | 4e-22 | ||
| 4b3f_X | 646 | Crystal Structure Of 1ghmbp2 Helicase Length = 646 | 4e-22 |
| >pdb|2XZL|A Chain A, Upf1-Rna Complex Length = 802 | Back alignment and structure |
|
| >pdb|2WJV|A Chain A, Crystal Structure Of The Complex Between Human Nonsense Mediated Decay Factors Upf1 And Upf2 Length = 800 | Back alignment and structure |
| >pdb|2XZO|A Chain A, Upf1 Helicase - Rna Complex Length = 623 | Back alignment and structure |
| >pdb|2GJK|A Chain A, Structural And Functional Insights Into The Human Upf1 Helicase Core Length = 624 | Back alignment and structure |
| >pdb|4B3G|A Chain A, Crystal Structure Of Ighmbp2 Helicase In Complex With Rna Length = 646 | Back alignment and structure |
| >pdb|4B3F|X Chain X, Crystal Structure Of 1ghmbp2 Helicase Length = 646 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Length = 802 | Back alignment and structure |
|---|
Score = 322 bits (827), Expect = 8e-94
Identities = 100/346 (28%), Positives = 161/346 (46%), Gaps = 15/346 (4%)
Query: 529 QLHQRRSECLSVLRNLWNSLDELNLPCT----TSKLVLEDFCFKRASLFFSTASSSYKLH 584
+ + L L L + + EL+ T E +A + T +
Sbjct: 454 LVGRGAKGELKNLLKLKDEVGELSASDTKRFVKLVRKTEAEILNKADVVCCTCVGAG--D 511
Query: 585 SVEIKPLNFLVIDEAAQLKESESTIPLQLAGINHAVLIGDECQLPAMVESKISDEAGFGR 644
++IDE+ Q E E IP+ + G +L+GD QL ++ + + +AG +
Sbjct: 512 KRLDTKFRTVLIDESTQASEPECLIPI-VKGAKQVILVGDHQQLGPVILERKAADAGLKQ 570
Query: 645 SLFERLTSLNHSKHLLNIQYRMHPSISLFPNLQFYRNQILDGANVKSKSYEKQYLTGTEF 704
SLFERL SL H L +QYRM+P +S FP+ FY + +G ++ ++
Sbjct: 571 SLFERLISLGHVPIRLEVQYRMNPYLSEFPSNMFYEGSLQNGVTIEQRTVPNSKFPWPIR 630
Query: 705 GTYSFINIIGGREDFIY--HSCRNIVEVSAVIKILQKLYKAWVGSKQKVSIGVVSPYTAQ 762
G GRE+ S N +E +I+ KL++ V +Q IGV++PY Q
Sbjct: 631 GIPMMFWANYGREEISANGTSFLNRIEAMNCERIITKLFRDGVKPEQ---IGVITPYEGQ 687
Query: 763 VVAIRKKIGFEYENKDGF--TVKVKSIDGFQGGEEDIIIISTVRCNTGGSIGFISKPQRV 820
I + + V+V S+D FQG E+D II+S VR N +IGF+ P+R+
Sbjct: 688 RAYILQYMQMNGSLDKDLYIKVEVASVDAFQGREKDYIILSCVRANEQQAIGFLRDPRRL 747
Query: 821 NVALTRARHCLWILGSERTLISSESIWGALVCDAKARQCFFNADEE 866
NV LTRA++ L ILG+ R+L + ++W L+ + + C +
Sbjct: 748 NVGLTRAKYGLVILGNPRSL-ARNTLWNHLLIHFREKGCLVEGTLD 792
|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Length = 802 | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Length = 624 | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Length = 624 | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Length = 800 | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Length = 800 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Length = 446 | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Length = 574 | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Length = 459 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1825 | ||||
| d1uaaa1 | 306 | c.37.1.19 (A:2-307) DEXX box DNA helicase {Escheri | 1e-06 | |
| g1qhh.1 | 623 | c.37.1.19 (A:,B:,C:,D:) DEXX box DNA helicase {Bac | 1e-04 | |
| d1w36b1 | 485 | c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta ch | 3e-04 |
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Length = 306 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: DEXX box DNA helicase species: Escherichia coli, RepD [TaxId: 562]
Score = 50.1 bits (118), Expect = 1e-06
Identities = 36/248 (14%), Positives = 68/248 (27%), Gaps = 32/248 (12%)
Query: 257 LNESQVGAMLACLRRLDCGHRSGVELIWGPPGTGKTKTVSMLLLTLLRIKC----RTLAC 312
LN Q A+ +G L+ G+GKT+ ++ + L+R A
Sbjct: 2 LNPGQQQAVE---------FVTGPCLVLAGAGSGKTRVITNKIAHLIRGCGYQARHIAAV 52
Query: 313 TPTNVAITELASRVLKLVKESYKRDSRSNTPICPLGDILLFGNKDRLKVNPGFEEIYLNY 372
T TN A E+ RV + + R + LG ++ L + F
Sbjct: 53 TFTNKAAREMKERVGQTLGRKEARGLMIS-TFHTLGLDIIKREYAALGMKANFSLFDDTD 111
Query: 373 RIKKLRECFAPLSGWRHC------------------FSSMIDLLEDCVSQYHIYVEKLKE 414
++ L+E L S + + L +
Sbjct: 112 QLALLKELTEGLIEDDKVLLQQLISTISNWKNDLKTPSQAAASAIGERDRIFAHCYGLYD 171
Query: 415 REDCNVNQSEEKECRKETEGSKGERKPFLKYVRERFKCAVVSLRNCIFIFCTHLPKSYIS 474
N + + + K + + + +V L K +
Sbjct: 172 AHLKACNVLDFDDLILLPTLLLQANEEVRKRWQNKIRYLLVDEYQDTNTSQYELVKLLVG 231
Query: 475 ENSFQEMV 482
+ +V
Sbjct: 232 SRARFTVV 239
|
| >d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Length = 485 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1825 | |||
| g1qhh.1 | 623 | DEXX box DNA helicase {Bacillus stearothermophilus | 99.93 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 99.85 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 99.84 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 99.8 | |
| d1w36b1 | 485 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 99.58 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 98.48 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 98.43 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 98.2 | |
| d1w36b2 | 395 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 98.19 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 98.19 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 98.18 | |
| d1pjra2 | 333 | DEXX box DNA helicase {Bacillus stearothermophilus | 98.04 | |
| d1uaaa2 | 333 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 97.86 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 97.8 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 97.68 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 97.68 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 97.65 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 97.62 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 97.55 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 97.54 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 97.52 | |
| d1w36d2 | 246 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 97.5 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 97.42 | |
| d1z63a1 | 230 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 97.12 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 96.93 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 96.9 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 96.89 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 96.77 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 96.69 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 96.48 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 96.47 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 96.44 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 96.4 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 96.39 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 96.37 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 96.32 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 96.32 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 96.29 | |
| d1z3ix2 | 298 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 96.27 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 96.17 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 96.16 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 96.1 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 96.04 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.89 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 95.88 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 95.85 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 95.84 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 95.74 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 95.7 | |
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 95.67 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 95.61 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 95.58 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 95.4 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 95.25 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 95.03 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 95.02 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 94.96 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 94.91 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 94.89 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 94.88 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 94.87 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 94.73 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 94.48 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 94.48 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 94.44 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 94.24 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 94.24 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 94.14 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 94.01 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 93.58 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 93.46 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 93.4 | |
| d1q0ua_ | 209 | Probable DEAD box RNA helicase YqfR {Bacillus stea | 93.25 | |
| d1t5la1 | 413 | Nucleotide excision repair enzyme UvrB {Bacillus c | 93.2 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 93.1 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 92.87 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 92.87 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 92.84 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 92.79 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 92.69 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 92.65 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 92.63 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 92.38 | |
| d1w36c2 | 470 | Exodeoxyribonuclease V gamma chain (RecC), N-termi | 92.36 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 92.18 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 92.14 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 92.08 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 92.07 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 92.06 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 91.94 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 91.9 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 91.25 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 91.2 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 91.11 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 91.03 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 90.96 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 90.81 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 90.79 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 90.76 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 90.52 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 90.5 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 90.36 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 90.3 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 90.27 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 90.26 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 90.21 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 90.2 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 90.13 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 90.06 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 90.05 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 90.04 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 89.8 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 89.77 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 89.74 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 89.68 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 89.3 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 89.19 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 88.98 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 88.97 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 88.74 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 88.51 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 88.26 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 88.08 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 87.82 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 87.69 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 87.35 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 86.58 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 86.1 | |
| d1c4oa1 | 408 | Nucleotide excision repair enzyme UvrB {Thermus th | 85.89 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 85.81 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 85.62 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 85.5 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 85.44 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 85.17 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 84.79 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 81.77 |
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1w36b2 c.37.1.19 (B:486-880) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pjra2 c.37.1.19 (A:319-651) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1uaaa2 c.37.1.19 (A:308-640) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w36d2 c.37.1.19 (D:361-606) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1w36c2 c.37.1.19 (C:348-817) Exodeoxyribonuclease V gamma chain (RecC), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|