Citrus Sinensis ID: 000301
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1701 | 2.2.26 [Sep-21-2011] | |||||||
| Q84WU2 | 1115 | Ubiquitin carboxyl-termin | no | no | 0.075 | 0.114 | 0.366 | 6e-17 | |
| Q9FPT1 | 1116 | Ubiquitin carboxyl-termin | no | no | 0.075 | 0.114 | 0.359 | 2e-16 | |
| Q8RY18 | 1055 | MATH domain-containing pr | no | no | 0.071 | 0.115 | 0.315 | 3e-09 | |
| Q8T126 | 1304 | Probable inactive serine/ | no | no | 0.160 | 0.209 | 0.217 | 1e-08 | |
| Q6U7I1 | 1101 | Ubiquitin carboxyl-termin | yes | no | 0.072 | 0.112 | 0.259 | 1e-06 | |
| Q93009 | 1102 | Ubiquitin carboxyl-termin | no | no | 0.072 | 0.112 | 0.251 | 6e-06 | |
| P11467 | 460 | RING finger protein DG17 | no | no | 0.073 | 0.271 | 0.284 | 1e-05 |
| >sp|Q84WU2|UBP13_ARATH Ubiquitin carboxyl-terminal hydrolase 13 OS=Arabidopsis thaliana GN=UBP13 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 91.3 bits (225), Expect = 6e-17, Method: Compositional matrix adjust.
Identities = 51/139 (36%), Positives = 78/139 (56%), Gaps = 11/139 (7%)
Query: 427 KFTWRIENFTRLKDLLKKRKITGLCIKSRRFQIGNRDCRLIVYPRGQSQPPCHLSVFLEV 486
KFTW I FTRL RK S F +G R++++P+G + HLS++L+V
Sbjct: 55 KFTWTIPMFTRLN----TRKHY-----SDVFVVGGYKWRILIFPKGNNVD--HLSMYLDV 103
Query: 487 MDSRNTSSDWSCFVSHRLSVVNQKMEEKSVTKESQNRYSKAAKDWGWREFVTLTSLFDQD 546
D+ N WS + L+VVNQ S+ KE+Q++++ DWG+ F+ L+ L++
Sbjct: 104 ADAANLPYGWSRYSQFSLAVVNQVNNRYSIRKETQHQFNARESDWGFTSFMPLSELYEPT 163
Query: 547 SGFLVQDTVVFSAEVLILK 565
G+LV DTV+ AEV + K
Sbjct: 164 RGYLVNDTVLIEAEVAVRK 182
|
Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin. Involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins. Arabidopsis thaliana (taxid: 3702) EC: 3EC: .EC: 4EC: .EC: 1EC: 9EC: .EC: 1EC: 2 |
| >sp|Q9FPT1|UBP12_ARATH Ubiquitin carboxyl-terminal hydrolase 12 OS=Arabidopsis thaliana GN=UBP12 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q8RY18|Y5436_ARATH MATH domain-containing protein At5g43560 OS=Arabidopsis thaliana GN=At5g43560 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q8T126|FNKC_DICDI Probable inactive serine/threonine-protein kinase fnkC OS=Dictyostelium discoideum GN=fnkC PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q6U7I1|UBP7_CHICK Ubiquitin carboxyl-terminal hydrolase 7 OS=Gallus gallus GN=USP7 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q93009|UBP7_HUMAN Ubiquitin carboxyl-terminal hydrolase 7 OS=Homo sapiens GN=USP7 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|P11467|DG17_DICDI RING finger protein DG17 OS=Dictyostelium discoideum GN=zfaA PE=2 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1701 | ||||||
| 359475831 | 1683 | PREDICTED: uncharacterized protein LOC10 | 0.970 | 0.980 | 0.869 | 0.0 | |
| 356518240 | 1679 | PREDICTED: uncharacterized protein LOC10 | 0.961 | 0.973 | 0.847 | 0.0 | |
| 109676322 | 2224 | unknown [Populus trichocarpa] | 0.952 | 0.728 | 0.850 | 0.0 | |
| 109676324 | 1649 | unknown [Populus trichocarpa] | 0.937 | 0.967 | 0.828 | 0.0 | |
| 357466147 | 1714 | CGS1 mRNA stability [Medicago truncatula | 0.968 | 0.960 | 0.804 | 0.0 | |
| 449437160 | 1686 | PREDICTED: uncharacterized protein LOC10 | 0.967 | 0.975 | 0.814 | 0.0 | |
| 145360308 | 1673 | TRAF-like protein [Arabidopsis thaliana] | 0.953 | 0.969 | 0.735 | 0.0 | |
| 4567245 | 1660 | unknown protein [Arabidopsis thaliana] | 0.942 | 0.966 | 0.730 | 0.0 | |
| 168034797 | 1677 | predicted protein [Physcomitrella patens | 0.940 | 0.953 | 0.658 | 0.0 | |
| 255548870 | 1575 | conserved hypothetical protein [Ricinus | 0.835 | 0.902 | 0.687 | 0.0 |
| >gi|359475831|ref|XP_002282789.2| PREDICTED: uncharacterized protein LOC100259525 [Vitis vinifera] gi|296082057|emb|CBI21062.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 2979 bits (7724), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 1449/1667 (86%), Positives = 1550/1667 (92%), Gaps = 16/1667 (0%)
Query: 41 DQSQPVTSSEKPQSSSFPAAATGGVEDLSLG-TRDGSGGAQESVAVDRRGEHSAVCRWTV 99
+QSQP P ++ P+ + G +D SL +RDG G QESV VDRR + SAVC+WTV
Sbjct: 27 EQSQP------PIATPSPSPSMG--DDPSLAASRDGHG--QESVTVDRRTDFSAVCKWTV 76
Query: 100 HNFPRIRARALWSKYFEVGGYDCRLLVYPKGDSQALPGYISIYLQIMDPRGTSSSKWDCF 159
HNFP+I+ARALWSKYFEVGG+DCRLL+YPKGDSQALPGYIS+YLQIMDPRG+SSSKWDCF
Sbjct: 77 HNFPKIKARALWSKYFEVGGFDCRLLIYPKGDSQALPGYISVYLQIMDPRGSSSSKWDCF 136
Query: 160 ASYRLAIVNLSDESKTIHRDSWHRFSSKKKSHGWCDFTPSSTVFDSKLGYLFNNDAVLIT 219
ASYRLAIVN +D+SK+IHRDSWHRFSSKKKSHGWCDFTPS+T+FDSK GYLFNND+VLIT
Sbjct: 137 ASYRLAIVNHADDSKSIHRDSWHRFSSKKKSHGWCDFTPSTTLFDSKSGYLFNNDSVLIT 196
Query: 220 ADILILNESVSFMRDNNELQSPSMVSSSVVAGPVSDVLSGKFTWKVHNFSLFKEMIKTQK 279
ADILILNESV+F RDNNELQS S ++S VVAGPVSDVLSGKFTWKVHNFSLFKEMIKTQK
Sbjct: 197 ADILILNESVNFTRDNNELQSASSMASMVVAGPVSDVLSGKFTWKVHNFSLFKEMIKTQK 256
Query: 280 IMSPVFPAGECNLRISVYQSSVNGQEYLSMCLESKDMEKTVVSDRSCWCLFRMSVLNQSP 339
IMSPVFPAGECNLRISVYQSSVNG EYLSMCLESKD EK VVSDRSCWCLFRMSVLNQ P
Sbjct: 257 IMSPVFPAGECNLRISVYQSSVNGVEYLSMCLESKDTEKAVVSDRSCWCLFRMSVLNQKP 316
Query: 340 GSNHMHRDSYGRFAADNKSGDNTSLGWNDYMKMADFVGHDSGFLVDDTAVFSTSFHVIKE 399
G NHMHRDSYGRFAADNKSGDNTSLGWNDYMKM+DF+G DSGFLVDDTAVFSTSFHVIKE
Sbjct: 317 GLNHMHRDSYGRFAADNKSGDNTSLGWNDYMKMSDFIGSDSGFLVDDTAVFSTSFHVIKE 376
Query: 400 ISSFSKNGGLIGWRSGNGA-RKSDGHMGKFTWRIENFTRLKDLLKKRKITGLCIKSRRFQ 458
SSFSKNGGLIG R G+G RKSDGH+GKFTWRIENFTRLKDLLKKRKITGLCIKSRRFQ
Sbjct: 377 FSSFSKNGGLIGVRGGSGGTRKSDGHLGKFTWRIENFTRLKDLLKKRKITGLCIKSRRFQ 436
Query: 459 IGNRDCRLIVYPRGQSQPPCHLSVFLEVMDSRNTSSDWSCFVSHRLSVVNQKMEEKSVTK 518
IGNRDCRLIVYPRGQSQPPCHLSVFLEV DSRNTSSDWSCFVSHRLSVVNQ+ME+KSVTK
Sbjct: 437 IGNRDCRLIVYPRGQSQPPCHLSVFLEVTDSRNTSSDWSCFVSHRLSVVNQRMEDKSVTK 496
Query: 519 ESQNRYSKAAKDWGWREFVTLTSLFDQDSGFLVQDTVVFSAEVLILKETSIMQDFTDQDT 578
ESQNRYSKAAKDWGWREFVTLTSLFDQDSGFLVQDTVVFSAEVLILKETS M D TDQD+
Sbjct: 497 ESQNRYSKAAKDWGWREFVTLTSLFDQDSGFLVQDTVVFSAEVLILKETSTMLDLTDQDS 556
Query: 579 ESTNAGSQMDKIGKRSSFTWKVENFLSFKEIMETRKIFSKFFQAGGCELRIGVYESFDTI 638
ES+N+GSQ+DKIGKRSSFTW+VENF+SFKEIMETRKIFSKFFQAGGCELRIGVYESFDTI
Sbjct: 557 ESSNSGSQIDKIGKRSSFTWRVENFMSFKEIMETRKIFSKFFQAGGCELRIGVYESFDTI 616
Query: 639 CIYLESDQSVGSDLDKNFWVRYRMAVVNQKNPTKTVWKESSICTKTWNNSVLQFMKVSDM 698
CIYLESDQSVGSD DKNFWVRYRMAVVNQKNP KTVWKESSICTKTWNNSVLQFMKVSDM
Sbjct: 617 CIYLESDQSVGSDPDKNFWVRYRMAVVNQKNPAKTVWKESSICTKTWNNSVLQFMKVSDM 676
Query: 699 LEADAGFLMRDTVVFVCEILDCCPWFEFSDLEVLASEDDQDALTTDPDELIDSDDSEGIS 758
LEADAGFL+RDTVVFVCEILDCCPWFEFSDLEVLASEDDQDALTTDPDELIDS+DSEGIS
Sbjct: 677 LEADAGFLVRDTVVFVCEILDCCPWFEFSDLEVLASEDDQDALTTDPDELIDSEDSEGIS 736
Query: 759 GDEEDIVRNLLSRAGFHLTYGDNPSQPQVTLREKLLMDAGAIAGFLTGLRVYLDDPAKAK 818
GDEEDI RNLLSRAGFHLTYGDNP+QPQVTLREKLLMDAGAIAGFLTGLRVYLDDPAK K
Sbjct: 737 GDEEDIFRNLLSRAGFHLTYGDNPAQPQVTLREKLLMDAGAIAGFLTGLRVYLDDPAKVK 796
Query: 819 RLLLPTKLSGS-DGKKVAKTDESSPSVMNLLMGVKVLQQAIIDLLLDIMVECCQPSDGNY 877
RLLLPTKLSGS DGKKV KTDESSPS+MNLLMGVKVLQQAIIDLLLDIMVECCQPS+GN
Sbjct: 797 RLLLPTKLSGSNDGKKVTKTDESSPSLMNLLMGVKVLQQAIIDLLLDIMVECCQPSEGNS 856
Query: 878 YGDSSDANSKPPLDANGGARPLEADRENGASESAQFPLFERLDSGADDNSTTSAVQSSDL 937
DSSD NSK +G PLE+DRENGA+ESA+FP++ERLDSG +++ SAVQSSD+
Sbjct: 857 NDDSSDENSKLSPGGSGAVSPLESDRENGATESAEFPVYERLDSGVYESTNVSAVQSSDM 916
Query: 938 SGIDIAEKALPGQPIFPPETSAGGSLESASFRSKTKWPEQSAELLGLIVNSLRALDGAVP 997
+G + EKA+PGQPI PPETSAGGS+E+AS RSKTKWPEQS ELLGLIVNSLRALDGAVP
Sbjct: 917 NGTVVPEKAVPGQPISPPETSAGGSIENASLRSKTKWPEQSEELLGLIVNSLRALDGAVP 976
Query: 998 QGCPEPRRRPQSAQKISLVLDKAPKHLQPDLVALVPKLVEHSEHPLAADALIERLQKSDA 1057
QGCPEPRRRPQSAQKI+LVLDKAPKHLQPDLVALVPKLVEHSEHPLAA AL++RLQK DA
Sbjct: 977 QGCPEPRRRPQSAQKIALVLDKAPKHLQPDLVALVPKLVEHSEHPLAACALLDRLQKPDA 1036
Query: 1058 EPALRMPVFVALSQLDFGSEVWERILLKSLELLTDSNDEPLAVTIDFIFKAASQCQHLPE 1117
EPALR+PVF ALSQL+ GSEVWERIL +S ELL+DSNDEPLA TI+FIFKAASQCQHLPE
Sbjct: 1037 EPALRIPVFGALSQLECGSEVWERILFQSFELLSDSNDEPLAATINFIFKAASQCQHLPE 1096
Query: 1118 AVRSVRVRLKNLGAEVSPCVLDFLSKTVNSWGDVAETILRDIDCDDDFGDNCSTMPSGLF 1177
AVRS+RV+LK+LGAEVSPCVLDFL+KTVNSWGDVAETILRDIDCDDDFGDNCST+P GLF
Sbjct: 1097 AVRSIRVKLKHLGAEVSPCVLDFLNKTVNSWGDVAETILRDIDCDDDFGDNCSTIPCGLF 1156
Query: 1178 LFGENGPTSDSLHVMDEQAFRATRHFSDIYILIEMLSIPCIAVEAAQTFERAVARGTIVA 1237
LFGENGPTS+ LH +DEQAF ATRHFSDIY+LIEMLSIPC+AVEA+QTFERAVARG VA
Sbjct: 1157 LFGENGPTSERLHAIDEQAFCATRHFSDIYLLIEMLSIPCLAVEASQTFERAVARGAFVA 1216
Query: 1238 QSIALVLERRLAQRLNFNPGFVAENFQHTDVVVEG---EQLIVQRDDFTCVLGLAETLAL 1294
QS+A+VLE RLAQRLNFN FVAE+FQHTDVVVEG EQL QRDDF+ VLGLAETLAL
Sbjct: 1217 QSVAMVLESRLAQRLNFNSRFVAESFQHTDVVVEGETNEQLRAQRDDFSSVLGLAETLAL 1276
Query: 1295 SRDIRVREFVKILYTILLKWYPDESYRGRMLKRLVDRATSTTESSRGVDLDLEILVILVC 1354
SRD RV+ FVK+LYTIL KWY DESYRGRMLKRLVDRATSTT+SSR +DL+LEILVILVC
Sbjct: 1277 SRDPRVKGFVKVLYTILFKWYADESYRGRMLKRLVDRATSTTDSSREIDLELEILVILVC 1336
Query: 1355 EEQEIIRPVLSMLREVAELANVDRAALWHQLCASEDEIIRIRDERKAEISNMVREKAVFS 1414
EEQEI+RPVLSM+REVAELANVDRAALWHQLC SEDEIIR+R+ERKAEISN+V+EKA+ S
Sbjct: 1337 EEQEIVRPVLSMMREVAELANVDRAALWHQLCTSEDEIIRMREERKAEISNLVKEKAIIS 1396
Query: 1415 QKLAESEAAGNRLKSEMRAEMDRFAREKKELSEQMREVESQLEWLRSERDDEIAKLTTEK 1474
Q+L+ESEA NRLKSEMRAE DRFAREKKELSEQ++EVESQLEWLRSERD+EI KLT+EK
Sbjct: 1397 QRLSESEATSNRLKSEMRAEADRFAREKKELSEQIQEVESQLEWLRSERDEEITKLTSEK 1456
Query: 1475 KVLQDRLHDAETQLSQLKSRKRDELKRVVKEKNALAERLKSAEAARKRFDEELKRYATEN 1534
KVLQDRLHDAE QLSQLKSRKRDELKRVVKEKNALAERLKSAEAARKRFDEELKRYATEN
Sbjct: 1457 KVLQDRLHDAEAQLSQLKSRKRDELKRVVKEKNALAERLKSAEAARKRFDEELKRYATEN 1516
Query: 1535 VTREEICQSLQDEVRRLTQTVGQTEGEKREKEEQVARCEAYIDGMESKLQACQQYIHTLE 1594
VTREEI QSL+DEVRRLTQTVGQTEGEKREKEEQVARCEAYIDGMESKLQACQQYIHTLE
Sbjct: 1517 VTREEIRQSLEDEVRRLTQTVGQTEGEKREKEEQVARCEAYIDGMESKLQACQQYIHTLE 1576
Query: 1595 AQLQEEMSRHAPLYGAGLEALSMKELETLARIHEEGLRQIHTLQQCKGSPAASPLVSPHT 1654
A LQEEMSRHAPLYGAGLEALSMKELETLARIHEEGLRQIH +QQ KGSPA SPLVSPHT
Sbjct: 1577 ASLQEEMSRHAPLYGAGLEALSMKELETLARIHEEGLRQIHAIQQHKGSPAGSPLVSPHT 1636
Query: 1655 LPHNHGLYPTAPPPLAVGLPHSLVPNGVGIHGNGHVNGGVGPWFNHT 1701
L H+HGLYP APPP+AVGLP SL+PNGVGIH NGHVNG VG WFNH
Sbjct: 1637 LQHSHGLYPPAPPPMAVGLPPSLIPNGVGIHSNGHVNGAVGSWFNHN 1683
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356518240|ref|XP_003527787.1| PREDICTED: uncharacterized protein LOC100788511 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|109676322|gb|ABG37643.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|109676324|gb|ABG37644.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357466147|ref|XP_003603358.1| CGS1 mRNA stability [Medicago truncatula] gi|355492406|gb|AES73609.1| CGS1 mRNA stability [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449437160|ref|XP_004136360.1| PREDICTED: uncharacterized protein LOC101209841 [Cucumis sativus] gi|449516864|ref|XP_004165466.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101209841 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|145360308|ref|NP_180104.3| TRAF-like protein [Arabidopsis thaliana] gi|113208238|dbj|BAF03523.1| CGS1 mRNA stability 1 [Arabidopsis thaliana] gi|330252594|gb|AEC07688.1| TRAF-like protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|4567245|gb|AAD23659.1| unknown protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|168034797|ref|XP_001769898.1| predicted protein [Physcomitrella patens subsp. patens] gi|162678804|gb|EDQ65258.1| predicted protein [Physcomitrella patens subsp. patens] | Back alignment and taxonomy information |
|---|
| >gi|255548870|ref|XP_002515491.1| conserved hypothetical protein [Ricinus communis] gi|223545435|gb|EEF46940.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1701 | ||||||
| TAIR|locus:2059551 | 1673 | AT2G25320 [Arabidopsis thalian | 0.965 | 0.982 | 0.702 | 0.0 | |
| TAIR|locus:2059536 | 693 | AT2G25330 "AT2G25330" [Arabido | 0.292 | 0.718 | 0.756 | 1.4e-208 | |
| TAIR|locus:2085445 | 330 | AT3G58210 "AT3G58210" [Arabido | 0.090 | 0.466 | 0.329 | 3.9e-17 | |
| TAIR|locus:2089045 | 309 | AT3G17380 "AT3G17380" [Arabido | 0.161 | 0.889 | 0.227 | 1.6e-12 | |
| TAIR|locus:2098318 | 370 | AT3G28220 "AT3G28220" [Arabido | 0.144 | 0.664 | 0.228 | 4.9e-06 | |
| TAIR|locus:2085435 | 282 | AT3G58290 "AT3G58290" [Arabido | 0.107 | 0.648 | 0.306 | 1.3e-13 | |
| TAIR|locus:2179744 | 351 | AT5G26260 "AT5G26260" [Arabido | 0.146 | 0.712 | 0.223 | 4e-13 | |
| ZFIN|ZDB-GENE-050208-317 | 1422 | tnks1bp1 "tankyrase 1 binding | 0.142 | 0.170 | 0.264 | 6.9e-13 | |
| TAIR|locus:2081501 | 1115 | UBP13 "ubiquitin-specific prot | 0.075 | 0.114 | 0.366 | 1.3e-12 | |
| TAIR|locus:2118465 | 297 | AT4G09770 "AT4G09770" [Arabido | 0.149 | 0.855 | 0.206 | 3.6e-07 |
| TAIR|locus:2059551 AT2G25320 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 5983 (2111.2 bits), Expect = 0., P = 0.
Identities = 1174/1670 (70%), Positives = 1355/1670 (81%)
Query: 41 DQSQPV---TSSEKPQSSSFPAAATGGVEDLSLGT-RDGSGGAQESVAVDRRGEHSAVCR 96
DQS P +SSEKP SSS + A EDL +G+ RDGSGGAQE VAVDR GE+SA+CR
Sbjct: 19 DQSHPSVSSSSSEKPLSSSSISPA----EDLQVGSSRDGSGGAQEIVAVDRPGEYSALCR 74
Query: 97 WTVHNFPRIRARALWSKYFEVGGYDCRLLVYPKGDSQALPGYISIYLQIMDPRGTSSSKW 156
WTV +F R++A+ALWSKYF+VGGYDCRLLVYP+GDSQALPGYISIYLQIMDPRGT+SS+W
Sbjct: 75 WTVESFTRVKAKALWSKYFDVGGYDCRLLVYPRGDSQALPGYISIYLQIMDPRGTTSSRW 134
Query: 157 DCFASYRLAIVNLSDESKTIHRDSWHRFSSKKKSHGWCDFTPSSTVFDSKLGYLFNNDAV 216
DCFASYRL+IVNL D+S TIH+DSWHRFSSKKKSHGWCDFT +S++ D K+G+LFNND++
Sbjct: 135 DCFASYRLSIVNLVDDSLTIHKDSWHRFSSKKKSHGWCDFTLNSSILDPKMGFLFNNDSL 194
Query: 217 LITADILILNESVSFMRDNNELQSPSMVSSSVVAGPVSDVLSGKFTWKVHNFSLFKEMIK 276
LITADILILNESVSF RDNN + S+ + +AGP+ DVLSGKFTWKV+NFSLFK+MIK
Sbjct: 195 LITADILILNESVSFSRDNNN-EGQSLYKENSIAGPMPDVLSGKFTWKVNNFSLFKDMIK 253
Query: 277 TQKIMSPVFPAGECNLRISVYQSSVNGQEYLSMCLESKDMEKTVVSDRSCWCLFRMSVLN 336
TQKIMSPVFPAGECNLRISVYQS VN QEY+SMCLESK+ EKT+VSDRSCWCLFRMS LN
Sbjct: 254 TQKIMSPVFPAGECNLRISVYQSVVNSQEYISMCLESKETEKTLVSDRSCWCLFRMSALN 313
Query: 337 QSPGSNHMHRDSYGRFAADNKSGDNTSLGWNDYMKMADFVGHDSGFLVDDTAVFSTSFHV 396
Q PG HMHRDSYGRFAADNKSGDNTSLGWNDYMKM++FV ++GFL+DD AVFSTSFHV
Sbjct: 314 QKPGCTHMHRDSYGRFAADNKSGDNTSLGWNDYMKMSEFVNPEAGFLLDDMAVFSTSFHV 373
Query: 397 IKEISSFSKNGGLIGWRSGNGARKSDGHMGKFTWRIENFTRLKDLLKKRKITGLCIKSRR 456
IKE SSF+KNGGLIG R+G GARKSDGHMGKFTWRIENFTRLKDLLKKRKITGLCIKS+R
Sbjct: 374 IKEFSSFTKNGGLIGGRNGAGARKSDGHMGKFTWRIENFTRLKDLLKKRKITGLCIKSKR 433
Query: 457 FQIGNRDCRLIVYPRGQSQPPCHLSVFLEVMDSRNTSSDWSCFVSHRLSVVNQKMEEKSV 516
FQIGNRDCRLIVYPRGQSQPPCHLSVFLEV DSR+ SSDWSCFVSHRLSVVNQ++EEKSV
Sbjct: 434 FQIGNRDCRLIVYPRGQSQPPCHLSVFLEVTDSRS-SSDWSCFVSHRLSVVNQRLEEKSV 492
Query: 517 TKESQNRYSKAAKDWGWREFVTLTSLFDQDSGFLVQDTVVFSAEVLILKETSIMQDFTDQ 576
TKESQNRYSKAAKDWGWREFVTLTSLFDQDSGFLVQDTVVFSAEVLILKETS +++ +
Sbjct: 493 TKESQNRYSKAAKDWGWREFVTLTSLFDQDSGFLVQDTVVFSAEVLILKETSATKEYVEA 552
Query: 577 DTESTNAGSQMDKIGKRSSFTWKVENFLSFKEIMETRKIFSKFFQAGGCELRIGVYESFD 636
D STN+ S D K+SSFTWKVENFL+FKEIMETRKIFSKFFQAGGCELRIGVYESFD
Sbjct: 553 D--STNSVSPTDNSVKKSSFTWKVENFLAFKEIMETRKIFSKFFQAGGCELRIGVYESFD 610
Query: 637 TICIYLESDQSVGSDLDKNFWVRYRMAVVNQKNPTKTVWKESSICTKTWNNSVLQFMKVS 696
TICIYLESDQS G+D+D NFWV+Y+M ++NQKNP K+VWKESSICTKTWNNSVLQFMKVS
Sbjct: 611 TICIYLESDQSAGTDVDNNFWVKYKMGILNQKNPAKSVWKESSICTKTWNNSVLQFMKVS 670
Query: 697 DMLEADAGFLMRDTVVFVCEILDCCPWFEFSDLEVLASEDDQDALTTDPDELXXXXXXXX 756
DMLEADAGFL+RDTVVFVCEILDCCPWFEFSDLEVLAS+DDQDALTTDPDE+
Sbjct: 671 DMLEADAGFLVRDTVVFVCEILDCCPWFEFSDLEVLASDDDQDALTTDPDEIIDSEESEG 730
Query: 757 XXXXXXXXVRNLLSRAGFHLTYGDNPSQPQVTLREKLLMDAGAIAGFLTGLRVYLDDPAK 816
R+ LSRAGFHLT+G+NPSQPQVTLREKLLMDAGAIAGFLTGLRVYLDDP K
Sbjct: 731 ISGDEEDTFRDFLSRAGFHLTFGENPSQPQVTLREKLLMDAGAIAGFLTGLRVYLDDPTK 790
Query: 817 AKRLLLPTKLSGSDGKKVAKTDESSPSVMNLLMGVKVLQQAXXXXXXXXMVECCQPSDGN 876
KRLLLPTK+S +D K+ K+DESSPS+MNLLMGVKVLQQA MVECCQPS+
Sbjct: 791 VKRLLLPTKISCNDRSKLIKSDESSPSLMNLLMGVKVLQQAIIDLLLDIMVECCQPSEEG 850
Query: 877 YYGDSSDANSKPPLDANGGARPLEADRENGASESAQFPLFERLDSGADDNSTTSAVQSSD 936
+ + S + P D A E+ RE GA+E +Q + ER S D +TSAV SS+
Sbjct: 851 SHSEPSLLS--PKTDGCVAATSSESTRERGAAEPSQHLVDERFKSDTDATLSTSAVPSSE 908
Query: 937 LSGIDIAEKALPGQPIFPPETSAGGSLESASFRSKTKWPEQSAELLGLIVNSLRALDGAV 996
++GID+ EKAL +P+ PP TSAG S + AS +SKTKWPEQS ELLGLIVNSL+ LD AV
Sbjct: 909 MNGIDLLEKALAIEPMSPPTTSAGQSSD-ASVQSKTKWPEQSEELLGLIVNSLKTLDAAV 967
Query: 997 PQGCPEPRRRPQSAQKISLVLDKAPKHLQPDLVALVPKLVEHSEHPLAADALIERLQKSD 1056
PQGCPEPRRRP SAQKI+LVLD+APKHLQPDLV+LVPKLVEHSEHPLAA ALIERLQK +
Sbjct: 968 PQGCPEPRRRPHSAQKIALVLDRAPKHLQPDLVSLVPKLVEHSEHPLAALALIERLQKPE 1027
Query: 1057 AEPALRMPVFVALSQLDFGSEVWERILLKSLELLTDSNDEPLAVTIDFIFKAASQCQHLP 1116
AEPALR PV+ ALSQL+ SEVWE IL +S ELL+D N+E L I F FK ASQCQHLP
Sbjct: 1028 AEPALREPVYNALSQLECDSEVWEDILSQSFELLSDLNEESLVAAIHFTFKTASQCQHLP 1087
Query: 1117 EAVRSVRVRLKNLGAEVSPCVLDFLSKTVNSWGDVAETILRXXXXXXXXXXNCSTMPSGL 1176
EAV +VR RLK+LGA+VS CVLD+LSKTV+SW +AE ILR N +T+P G
Sbjct: 1088 EAVNAVRERLKSLGADVSLCVLDYLSKTVHSWPGIAEMILRDINTDDSVGANFATLPCGP 1147
Query: 1177 FLFGENGPTSDSLHVMDEQAFRATRHFSDIYILIEMLSIPCIAVEAAQTFERAVARGTIV 1236
FL GEN S+ +M+E F A R F D+YIL+EMLSI C+A EA+QTFERAVARG IV
Sbjct: 1148 FLIGENETASEMADLMEEHIFYANRQFFDVYILLEMLSISCLAEEASQTFERAVARGAIV 1207
Query: 1237 AQSIALVLERRLAQRLNFNPGFVAENFQHTDVVVEGE---QLIVQRDDFTCVLGLAETLA 1293
AQ++A+VLE++ Q N N + +H D V+EGE Q +F +L LAETL
Sbjct: 1208 AQAVAMVLEKQRVQSPNLNATSGDASLKHQDPVLEGEASEQPATGGTEFRIILNLAETLT 1267
Query: 1294 LSRDIRVREFVKILYTILLKWYPDESYRGRMLKRLVDRATSTTESSRGXXXXXXXXXXXX 1353
SRD +VR FVK+LYTIL KW+PD+ +R ++L+RLVDR TS T SS
Sbjct: 1268 HSRDPQVRGFVKMLYTILFKWFPDQPFRVQILRRLVDRFTSPTSSSHDLDLELEILAILI 1327
Query: 1354 XXXXXXXRPVLSMLREVAELANVDRAALWHQLCASEDEIIRIRDERKAEISNMVREKAVF 1413
RPVL+ML++V E AN+DRAALWHQL A+++E++R+++E+K EI +M +EK+
Sbjct: 1328 FQEQEVARPVLAMLKKVVEHANIDRAALWHQLRANKEELVRLKEEKKIEIQSMTKEKSSI 1387
Query: 1414 SQKLAESEAAGNRLKSEMRAEMDRFAREKKELSEQMREVESQLEWLRSERDDEIAKLTTE 1473
+QKL+ESEAA RLKSEM+AE DRF+REKK+L EQ R+VESQLEW+RSER DEI KL++E
Sbjct: 1388 TQKLSESEAANTRLKSEMKAEADRFSREKKDLVEQFRDVESQLEWIRSERQDEIDKLSSE 1447
Query: 1474 KKVLQDRLHDAETQLSQLKSRKRDELKRVVKEKNALAERLKSAEAARKRFDEELKRYATE 1533
KK L DRLH+AETQL+ K+RKRDELK+V KEKNAL E+LK EAARKRF+EELKRYATE
Sbjct: 1448 KKTLLDRLHEAETQLALQKTRKRDELKKVGKEKNALTEKLKVTEAARKRFEEELKRYATE 1507
Query: 1534 NVTREEICQSLQDEVRRLTQTVGQTEGEKREKEEQVARCEAYIDGMESKLQACQQYIHTL 1593
NVTREE+ +SL+D++R+LTQTVGQT+ EKREKE+Q+ARCEAYIDGMESKLQACQQYIHTL
Sbjct: 1508 NVTREELRKSLEDQIRQLTQTVGQTKEEKREKEDQIARCEAYIDGMESKLQACQQYIHTL 1567
Query: 1594 EAQLQEEMSRHAPLYGAGLEALSMKELETLARIHEEGLRQIHTLQQCKGSPAASPLVSPH 1653
E+ L+EE+SRHAPLYGA LE+LSMKEL+T+ARIHEEGLRQIH LQQ KG + H
Sbjct: 1568 ESSLREEISRHAPLYGANLESLSMKELDTIARIHEEGLRQIHALQQRKGHTLS------H 1621
Query: 1654 TLPHNHGLYPTAPP---PLAVGLPHSLVPXXXXXXXXXXXXXXXXPWFNH 1700
LP H LYPT PP P+A+GLP L+P PWF+H
Sbjct: 1622 GLPQGHTLYPTTPPQLPPMAIGLPPQLIPNGSGVHSNGHINGSVRPWFSH 1671
|
|
| TAIR|locus:2059536 AT2G25330 "AT2G25330" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2085445 AT3G58210 "AT3G58210" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2089045 AT3G17380 "AT3G17380" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2098318 AT3G28220 "AT3G28220" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2085435 AT3G58290 "AT3G58290" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2179744 AT5G26260 "AT5G26260" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050208-317 tnks1bp1 "tankyrase 1 binding protein 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2081501 UBP13 "ubiquitin-specific protease 13" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2118465 AT4G09770 "AT4G09770" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | GSVIVG00032679001 | SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (1683 aa) | ||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1701 | |||
| cd00121 | 126 | cd00121, MATH, MATH (meprin and TRAF-C homology) d | 9e-29 | |
| cd00121 | 126 | cd00121, MATH, MATH (meprin and TRAF-C homology) d | 6e-21 | |
| cd00121 | 126 | cd00121, MATH, MATH (meprin and TRAF-C homology) d | 1e-16 | |
| cd00121 | 126 | cd00121, MATH, MATH (meprin and TRAF-C homology) d | 1e-13 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-13 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 9e-13 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 9e-13 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-12 | |
| cd03775 | 134 | cd03775, MATH_Ubp21p, Ubiquitin-specific protease | 5e-12 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 9e-12 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-11 | |
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 1e-10 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-10 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-10 | |
| COG5077 | 1089 | COG5077, COG5077, Ubiquitin carboxyl-terminal hydr | 4e-10 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 5e-10 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 3e-09 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-09 | |
| pfam00917 | 116 | pfam00917, MATH, MATH domain | 4e-09 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 7e-09 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 8e-09 | |
| cd03772 | 137 | cd03772, MATH_HAUSP, Herpesvirus-associated ubiqui | 8e-09 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 9e-09 | |
| pfam00917 | 116 | pfam00917, MATH, MATH domain | 1e-08 | |
| COG4372 | 499 | COG4372, COG4372, Uncharacterized protein conserve | 2e-08 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 3e-08 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 3e-08 | |
| cd11721 | 1161 | cd11721, FANCD2, Fanconi anemia D2 protein | 3e-08 | |
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 4e-08 | |
| cd03775 | 134 | cd03775, MATH_Ubp21p, Ubiquitin-specific protease | 5e-08 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 5e-08 | |
| smart00061 | 95 | smart00061, MATH, meprin and TRAF homology | 6e-08 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 7e-08 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 1e-07 | |
| COG4372 | 499 | COG4372, COG4372, Uncharacterized protein conserve | 2e-07 | |
| smart00061 | 95 | smart00061, MATH, meprin and TRAF homology | 2e-07 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 2e-07 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 4e-07 | |
| cd03774 | 139 | cd03774, MATH_SPOP, Speckle-type POZ protein (SPOP | 1e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-06 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 3e-06 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 3e-06 | |
| COG1579 | 239 | COG1579, COG1579, Zn-ribbon protein, possibly nucl | 3e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-06 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 4e-06 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 4e-06 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 5e-06 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 5e-06 | |
| cd03773 | 132 | cd03773, MATH_TRIM37, Tripartite motif containing | 5e-06 | |
| COG5077 | 1089 | COG5077, COG5077, Ubiquitin carboxyl-terminal hydr | 6e-06 | |
| cd03776 | 147 | cd03776, MATH_TRAF6, Tumor Necrosis Factor Recepto | 7e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 8e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 8e-06 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 8e-06 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 8e-06 | |
| pfam05667 | 536 | pfam05667, DUF812, Protein of unknown function (DU | 8e-06 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 9e-06 | |
| TIGR02680 | 1353 | TIGR02680, TIGR02680, TIGR02680 family protein | 9e-06 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 1e-05 | |
| pfam05911 | 767 | pfam05911, DUF869, Plant protein of unknown functi | 1e-05 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 1e-05 | |
| pfam13166 | 713 | pfam13166, AAA_13, AAA domain | 1e-05 | |
| cd03773 | 132 | cd03773, MATH_TRIM37, Tripartite motif containing | 2e-05 | |
| pfam09726 | 680 | pfam09726, Macoilin, Transmembrane protein | 2e-05 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 2e-05 | |
| pfam13514 | 1118 | pfam13514, AAA_27, AAA domain | 2e-05 | |
| PHA02562 | 562 | PHA02562, 46, endonuclease subunit; Provisional | 2e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-05 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 3e-05 | |
| pfam07111 | 739 | pfam07111, HCR, Alpha helical coiled-coil rod prot | 3e-05 | |
| COG3206 | 458 | COG3206, GumC, Uncharacterized protein involved in | 3e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 5e-05 | |
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 5e-05 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 6e-05 | |
| COG1842 | 225 | COG1842, PspA, Phage shock protein A (IM30), suppr | 7e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 8e-05 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 9e-05 | |
| TIGR00606 | 1311 | TIGR00606, rad50, rad50 | 1e-04 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 1e-04 | |
| TIGR03007 | 498 | TIGR03007, pepcterm_ChnLen, polysaccharide chain l | 1e-04 | |
| pfam00038 | 312 | pfam00038, Filament, Intermediate filament protein | 1e-04 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 2e-04 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 2e-04 | |
| PRK04863 | 1486 | PRK04863, mukB, cell division protein MukB; Provis | 2e-04 | |
| pfam10211 | 189 | pfam10211, Ax_dynein_light, Axonemal dynein light | 2e-04 | |
| pfam04012 | 220 | pfam04012, PspA_IM30, PspA/IM30 family | 2e-04 | |
| pfam03961 | 450 | pfam03961, DUF342, Protein of unknown function (DU | 2e-04 | |
| pfam09755 | 308 | pfam09755, DUF2046, Uncharacterized conserved prot | 2e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-04 | |
| cd03772 | 137 | cd03772, MATH_HAUSP, Herpesvirus-associated ubiqui | 3e-04 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 3e-04 | |
| COG1340 | 294 | COG1340, COG1340, Uncharacterized archaeal coiled- | 3e-04 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 3e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 4e-04 | |
| COG1579 | 239 | COG1579, COG1579, Zn-ribbon protein, possibly nucl | 4e-04 | |
| PRK04863 | 1486 | PRK04863, mukB, cell division protein MukB; Provis | 4e-04 | |
| TIGR00618 | 1042 | TIGR00618, sbcc, exonuclease SbcC | 4e-04 | |
| pfam09731 | 493 | pfam09731, Mitofilin, Mitochondrial inner membrane | 4e-04 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 5e-04 | |
| pfam12718 | 143 | pfam12718, Tropomyosin_1, Tropomyosin like | 5e-04 | |
| pfam05557 | 722 | pfam05557, MAD, Mitotic checkpoint protein | 5e-04 | |
| pfam00769 | 244 | pfam00769, ERM, Ezrin/radixin/moesin family | 5e-04 | |
| TIGR01843 | 423 | TIGR01843, type_I_hlyD, type I secretion membrane | 5e-04 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 6e-04 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 6e-04 | |
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 7e-04 | |
| smart00061 | 95 | smart00061, MATH, meprin and TRAF homology | 7e-04 | |
| TIGR00606 | 1311 | TIGR00606, rad50, rad50 | 9e-04 | |
| COG1340 | 294 | COG1340, COG1340, Uncharacterized archaeal coiled- | 0.001 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 0.001 | |
| cd00270 | 149 | cd00270, MATH_TRAF_C, Tumor Necrosis Factor Recept | 0.001 | |
| pfam01456 | 143 | pfam01456, Mucin, Mucin-like glycoprotein | 0.001 | |
| PRK01156 | 895 | PRK01156, PRK01156, chromosome segregation protein | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.002 | |
| pfam05911 | 767 | pfam05911, DUF869, Plant protein of unknown functi | 0.002 | |
| pfam00769 | 244 | pfam00769, ERM, Ezrin/radixin/moesin family | 0.002 | |
| pfam04156 | 186 | pfam04156, IncA, IncA protein | 0.002 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 0.002 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 0.002 | |
| pfam07888 | 546 | pfam07888, CALCOCO1, Calcium binding and coiled-co | 0.002 | |
| TIGR01000 | 457 | TIGR01000, bacteriocin_acc, bacteriocin secretion | 0.002 | |
| smart00787 | 312 | smart00787, Spc7, Spc7 kinetochore protein | 0.002 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 0.003 | |
| TIGR00618 | 1042 | TIGR00618, sbcc, exonuclease SbcC | 0.003 | |
| pfam04156 | 186 | pfam04156, IncA, IncA protein | 0.003 | |
| COG5185 | 622 | COG5185, HEC1, Protein involved in chromosome segr | 0.003 | |
| COG4717 | 984 | COG4717, COG4717, Uncharacterized conserved protei | 0.003 | |
| smart00935 | 140 | smart00935, OmpH, Outer membrane protein (OmpH-lik | 0.003 | |
| PRK08476 | 141 | PRK08476, PRK08476, F0F1 ATP synthase subunit B'; | 0.003 | |
| pfam12037 | 276 | pfam12037, DUF3523, Domain of unknown function (DU | 0.003 | |
| TIGR02680 | 1353 | TIGR02680, TIGR02680, TIGR02680 family protein | 0.004 | |
| PRK01156 | 895 | PRK01156, PRK01156, chromosome segregation protein | 0.004 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 0.004 | |
| TIGR00634 | 563 | TIGR00634, recN, DNA repair protein RecN | 0.004 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.004 | |
| pfam13863 | 126 | pfam13863, DUF4200, Domain of unknown function (DU | 0.004 |
| >gnl|CDD|238068 cd00121, MATH, MATH (meprin and TRAF-C homology) domain; an independent folding unit with an eight-stranded beta-sandwich structure found in meprins, TRAFs and other proteins | Back alignment and domain information |
|---|
Score = 112 bits (281), Expect = 9e-29
Identities = 39/136 (28%), Positives = 65/136 (47%), Gaps = 11/136 (8%)
Query: 426 GKFTWRIENFTRLKDLLKKRKITGLCIKSRRFQIGNRDCRLIVYPRGQSQPPCHLSVFLE 485
GK TW+I NF+ L+ G I S F++G R+ +YP G + +LS++LE
Sbjct: 1 GKHTWKIVNFSELE---------GESIYSPPFEVGGYKWRIRIYPNGDGESGDYLSLYLE 51
Query: 486 VMDSRNTSSDWSCFVSHRLSVVNQKMEEKSVTKESQNRYSKAAKDWGWREFVTLTSLFDQ 545
+ + WS L +VNQ + + +S+ WG+ +F++ L +
Sbjct: 52 LDKGESDLEKWSVRAEFTLKLVNQNGGKSLSKSFTHVFFSEKGSGWGFPKFISWDDL--E 109
Query: 546 DSGFLVQDTVVFSAEV 561
DS +LV D++ EV
Sbjct: 110 DSYYLVDDSLTIEVEV 125
|
Meprins comprise a class of extracellular metalloproteases which are anchored to the membrane and are capable of cleaving growth factors, extracellular matrix proteins, and biologically active peptides. TRAF molecules serve as adapter proteins that link cell surface receptors of the Tumor Necrosis Factor and 1nterleukin-1/Toll-like families to downstream kinase cascades, which results in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses in the immune and inflammatory systems. Other members include the ubiquitin ligases, TRIM37 and SPOP, and the ubiquitin-specific proteases, HAUSP and Ubp21p. A large number of uncharacterized members mostly from lineage-specific expansions in C. elegans and rice contain MATH and BTB domains, similar to SPOP. The MATH domain has been shown to bind peptide/protein substrates in TRAFs and HAUSP. It is possible that the MATH domain in other members of this superfamily also interacts with various protein substrates. The TRAF domain may also be involved in the trimerization of TRAFs. Based on homology, it is postulated that the MATH domain in meprins may be involved in its tetramer assembly and that the MATH domain, in general, may take part in diverse modular arrangements defined by adjacent multimerization domains. Length = 126 |
| >gnl|CDD|238068 cd00121, MATH, MATH (meprin and TRAF-C homology) domain; an independent folding unit with an eight-stranded beta-sandwich structure found in meprins, TRAFs and other proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238068 cd00121, MATH, MATH (meprin and TRAF-C homology) domain; an independent folding unit with an eight-stranded beta-sandwich structure found in meprins, TRAFs and other proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238068 cd00121, MATH, MATH (meprin and TRAF-C homology) domain; an independent folding unit with an eight-stranded beta-sandwich structure found in meprins, TRAFs and other proteins | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|239744 cd03775, MATH_Ubp21p, Ubiquitin-specific protease 21 (Ubp21p) family, MATH domain; composed of fungal proteins with similarity to Ubp21p of fission yeast | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|227409 COG5077, COG5077, Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216189 pfam00917, MATH, MATH domain | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|239741 cd03772, MATH_HAUSP, Herpesvirus-associated ubiquitin-specific protease (HAUSP, also known as USP7) family, N-terminal MATH (TRAF-like) domain; composed of proteins similar to human HAUSP, an enzyme that specifically catalyzes the deubiquitylation of p53 and MDM2, hence playing an important role in the p53-MDM2 pathway | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216189 pfam00917, MATH, MATH domain | Back alignment and domain information |
|---|
| >gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|212595 cd11721, FANCD2, Fanconi anemia D2 protein | Back alignment and domain information |
|---|
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
| >gnl|CDD|239744 cd03775, MATH_Ubp21p, Ubiquitin-specific protease 21 (Ubp21p) family, MATH domain; composed of fungal proteins with similarity to Ubp21p of fission yeast | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214496 smart00061, MATH, meprin and TRAF homology | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|214496 smart00061, MATH, meprin and TRAF homology | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|239743 cd03774, MATH_SPOP, Speckle-type POZ protein (SPOP) family, MATH domain; composed of proteins with similarity to human SPOP | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239742 cd03773, MATH_TRIM37, Tripartite motif containing protein 37 (TRIM37) family, MATH domain; TRIM37 is a peroxisomal protein and is a member of the tripartite motif (TRIM) protein subfamily, also known as the RING-B-box-coiled-coil (RBCC) subfamily of zinc-finger proteins | Back alignment and domain information |
|---|
| >gnl|CDD|227409 COG5077, COG5077, Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|239745 cd03776, MATH_TRAF6, Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF6 subfamily, TRAF domain, C-terminal MATH subdomain; composed of proteins with similarity to human TRAF6, including the Drosophila protein DTRAF2 | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|218681 pfam05667, DUF812, Protein of unknown function (DUF812) | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218806 pfam05911, DUF869, Plant protein of unknown function (DUF869) | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|221952 pfam13166, AAA_13, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|239742 cd03773, MATH_TRIM37, Tripartite motif containing protein 37 (TRIM37) family, MATH domain; TRIM37 is a peroxisomal protein and is a member of the tripartite motif (TRIM) protein subfamily, also known as the RING-B-box-coiled-coil (RBCC) subfamily of zinc-finger proteins | Back alignment and domain information |
|---|
| >gnl|CDD|220365 pfam09726, Macoilin, Transmembrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|205692 pfam13514, AAA_27, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|222878 PHA02562, 46, endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|148617 pfam07111, HCR, Alpha helical coiled-coil rod protein (HCR) | Back alignment and domain information |
|---|
| >gnl|CDD|225747 COG3206, GumC, Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|224755 COG1842, PspA, Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|129694 TIGR00606, rad50, rad50 | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|234084 TIGR03007, pepcterm_ChnLen, polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|200948 pfam00038, Filament, Intermediate filament protein | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|204414 pfam10211, Ax_dynein_light, Axonemal dynein light chain | Back alignment and domain information |
|---|
| >gnl|CDD|217843 pfam04012, PspA_IM30, PspA/IM30 family | Back alignment and domain information |
|---|
| >gnl|CDD|217817 pfam03961, DUF342, Protein of unknown function (DUF342) | Back alignment and domain information |
|---|
| >gnl|CDD|150430 pfam09755, DUF2046, Uncharacterized conserved protein H4 (DUF2046) | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|239741 cd03772, MATH_HAUSP, Herpesvirus-associated ubiquitin-specific protease (HAUSP, also known as USP7) family, N-terminal MATH (TRAF-like) domain; composed of proteins similar to human HAUSP, an enzyme that specifically catalyzes the deubiquitylation of p53 and MDM2, hence playing an important role in the p53-MDM2 pathway | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224259 COG1340, COG1340, Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC | Back alignment and domain information |
|---|
| >gnl|CDD|220369 pfam09731, Mitofilin, Mitochondrial inner membrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|205039 pfam12718, Tropomyosin_1, Tropomyosin like | Back alignment and domain information |
|---|
| >gnl|CDD|218636 pfam05557, MAD, Mitotic checkpoint protein | Back alignment and domain information |
|---|
| >gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family | Back alignment and domain information |
|---|
| >gnl|CDD|130902 TIGR01843, type_I_hlyD, type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
| >gnl|CDD|214496 smart00061, MATH, meprin and TRAF homology | Back alignment and domain information |
|---|
| >gnl|CDD|129694 TIGR00606, rad50, rad50 | Back alignment and domain information |
|---|
| >gnl|CDD|224259 COG1340, COG1340, Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|238168 cd00270, MATH_TRAF_C, Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF domain, C-terminal MATH subdomain; TRAF molecules serve as adapter proteins that link cell surface TNFRs and receptors of the interleukin-1/Toll-like family to downstream kinase signaling cascades which results in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses in the immune and inflammatory systems | Back alignment and domain information |
|---|
| >gnl|CDD|216513 pfam01456, Mucin, Mucin-like glycoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|100796 PRK01156, PRK01156, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218806 pfam05911, DUF869, Plant protein of unknown function (DUF869) | Back alignment and domain information |
|---|
| >gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family | Back alignment and domain information |
|---|
| >gnl|CDD|217933 pfam04156, IncA, IncA protein | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|116500 pfam07888, CALCOCO1, Calcium binding and coiled-coil domain (CALCOCO1) like | Back alignment and domain information |
|---|
| >gnl|CDD|233230 TIGR01000, bacteriocin_acc, bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >gnl|CDD|197874 smart00787, Spc7, Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC | Back alignment and domain information |
|---|
| >gnl|CDD|217933 pfam04156, IncA, IncA protein | Back alignment and domain information |
|---|
| >gnl|CDD|227512 COG5185, HEC1, Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|227061 COG4717, COG4717, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|214922 smart00935, OmpH, Outer membrane protein (OmpH-like) | Back alignment and domain information |
|---|
| >gnl|CDD|181442 PRK08476, PRK08476, F0F1 ATP synthase subunit B'; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|221389 pfam12037, DUF3523, Domain of unknown function (DUF3523) | Back alignment and domain information |
|---|
| >gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|100796 PRK01156, PRK01156, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|233065 TIGR00634, recN, DNA repair protein RecN | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|206034 pfam13863, DUF4200, Domain of unknown function (DUF4200) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1701 | |||
| PF14631 | 1426 | FancD2: Fanconi anaemia protein FancD2 nuclease; P | 100.0 | |
| KOG4712 | 1335 | consensus Uncharacterized conserved protein [Funct | 100.0 | |
| cd03772 | 137 | MATH_HAUSP Herpesvirus-associated ubiquitin-specif | 99.88 | |
| cd03772 | 137 | MATH_HAUSP Herpesvirus-associated ubiquitin-specif | 99.88 | |
| cd03775 | 134 | MATH_Ubp21p Ubiquitin-specific protease 21 (Ubp21p | 99.87 | |
| cd03775 | 134 | MATH_Ubp21p Ubiquitin-specific protease 21 (Ubp21p | 99.86 | |
| cd03780 | 148 | MATH_TRAF5 Tumor Necrosis Factor Receptor (TNFR)-A | 99.85 | |
| cd03777 | 186 | MATH_TRAF3 Tumor Necrosis Factor Receptor (TNFR)-A | 99.85 | |
| cd03778 | 164 | MATH_TRAF2 Tumor Necrosis Factor Receptor (TNFR) A | 99.84 | |
| cd03779 | 147 | MATH_TRAF1 Tumor Necrosis Factor Receptor (TNFR) A | 99.84 | |
| cd03776 | 147 | MATH_TRAF6 Tumor Necrosis Factor Receptor (TNFR)-A | 99.84 | |
| cd03774 | 139 | MATH_SPOP Speckle-type POZ protein (SPOP) family, | 99.84 | |
| cd00270 | 149 | MATH_TRAF_C Tumor Necrosis Factor Receptor (TNFR)- | 99.84 | |
| cd03771 | 167 | MATH_Meprin Meprin family, MATH domain; Meprins ar | 99.83 | |
| cd03781 | 154 | MATH_TRAF4 Tumor Necrosis Factor Receptor (TNFR)-A | 99.82 | |
| cd03773 | 132 | MATH_TRIM37 Tripartite motif containing protein 37 | 99.81 | |
| cd00270 | 149 | MATH_TRAF_C Tumor Necrosis Factor Receptor (TNFR)- | 99.81 | |
| cd03774 | 139 | MATH_SPOP Speckle-type POZ protein (SPOP) family, | 99.8 | |
| cd03776 | 147 | MATH_TRAF6 Tumor Necrosis Factor Receptor (TNFR)-A | 99.8 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 99.79 | |
| cd03781 | 154 | MATH_TRAF4 Tumor Necrosis Factor Receptor (TNFR)-A | 99.78 | |
| cd03780 | 148 | MATH_TRAF5 Tumor Necrosis Factor Receptor (TNFR)-A | 99.78 | |
| cd03773 | 132 | MATH_TRIM37 Tripartite motif containing protein 37 | 99.78 | |
| cd03777 | 186 | MATH_TRAF3 Tumor Necrosis Factor Receptor (TNFR)-A | 99.77 | |
| cd03783 | 167 | MATH_Meprin_Alpha Meprin family, Alpha subunit, MA | 99.76 | |
| cd03779 | 147 | MATH_TRAF1 Tumor Necrosis Factor Receptor (TNFR) A | 99.75 | |
| cd03782 | 167 | MATH_Meprin_Beta Meprin family, Beta subunit, MATH | 99.74 | |
| cd03771 | 167 | MATH_Meprin Meprin family, MATH domain; Meprins ar | 99.72 | |
| cd00121 | 126 | MATH MATH (meprin and TRAF-C homology) domain; an | 99.71 | |
| cd00121 | 126 | MATH MATH (meprin and TRAF-C homology) domain; an | 99.71 | |
| cd03778 | 164 | MATH_TRAF2 Tumor Necrosis Factor Receptor (TNFR) A | 99.7 | |
| PF00917 | 119 | MATH: MATH domain; InterPro: IPR002083 Although ap | 99.65 | |
| PF00917 | 119 | MATH: MATH domain; InterPro: IPR002083 Although ap | 99.64 | |
| smart00061 | 95 | MATH meprin and TRAF homology. | 99.48 | |
| smart00061 | 95 | MATH meprin and TRAF homology. | 99.48 | |
| COG5077 | 1089 | Ubiquitin carboxyl-terminal hydrolase [Posttransla | 99.44 | |
| cd03782 | 167 | MATH_Meprin_Beta Meprin family, Beta subunit, MATH | 99.4 | |
| cd03783 | 167 | MATH_Meprin_Alpha Meprin family, Alpha subunit, MA | 99.36 | |
| COG5077 | 1089 | Ubiquitin carboxyl-terminal hydrolase [Posttransla | 99.27 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 99.16 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 99.08 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 99.07 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 99.05 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 99.03 | |
| KOG1987 | 297 | consensus Speckle-type POZ protein SPOP and relate | 99.01 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 99.01 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 99.0 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 98.94 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 98.88 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 98.88 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 98.86 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 98.82 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.81 | |
| KOG1987 | 297 | consensus Speckle-type POZ protein SPOP and relate | 98.81 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 98.79 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 98.79 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 98.78 | |
| PRK11637 | 428 | AmiB activator; Provisional | 98.76 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.76 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 98.75 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 98.71 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 98.69 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 98.68 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 98.68 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 98.66 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 98.65 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 98.64 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 98.63 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 98.59 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 98.58 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 98.57 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 98.57 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 98.57 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 98.52 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 98.51 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 98.5 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 98.5 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 98.5 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 98.5 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 98.49 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 98.49 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 98.48 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 98.45 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 98.44 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 98.44 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 98.43 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 98.43 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 98.43 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 98.42 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 98.42 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 98.4 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 98.39 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 98.37 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 98.36 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 98.35 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 98.33 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 98.33 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 98.33 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 98.33 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 98.32 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 98.31 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 98.3 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 98.3 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 98.3 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 98.29 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 98.28 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 98.28 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 98.28 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 98.27 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 98.27 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 98.24 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 98.24 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 98.24 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 98.22 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 98.2 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 98.19 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 98.19 | |
| KOG1937 | 521 | consensus Uncharacterized conserved protein [Funct | 98.18 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 98.12 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 98.11 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 98.11 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 98.11 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 98.08 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 98.07 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 98.06 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 98.06 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 98.06 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 98.02 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 97.99 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 97.96 | |
| PRK09039 | 343 | hypothetical protein; Validated | 97.93 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 97.93 | |
| KOG1937 | 521 | consensus Uncharacterized conserved protein [Funct | 97.9 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 97.9 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 97.9 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 97.88 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 97.88 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 97.87 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 97.86 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 97.85 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 97.85 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 97.84 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 97.84 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 97.83 | |
| KOG1863 | 1093 | consensus Ubiquitin carboxyl-terminal hydrolase [P | 97.82 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 97.81 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 97.8 | |
| KOG4809 | 654 | consensus Rab6 GTPase-interacting protein involved | 97.79 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 97.79 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 97.78 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 97.76 | |
| KOG0249 | 916 | consensus LAR-interacting protein and related prot | 97.76 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 97.75 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 97.75 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 97.75 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 97.72 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 97.72 | |
| PF06637 | 442 | PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 Th | 97.71 | |
| KOG2072 | 988 | consensus Translation initiation factor 3, subunit | 97.71 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 97.71 | |
| PRK09039 | 343 | hypothetical protein; Validated | 97.69 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 97.69 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 97.67 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 97.67 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 97.66 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 97.65 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 97.65 | |
| PF15397 | 258 | DUF4618: Domain of unknown function (DUF4618) | 97.63 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 97.63 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 97.63 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 97.62 | |
| PF13514 | 1111 | AAA_27: AAA domain | 97.61 | |
| KOG1863 | 1093 | consensus Ubiquitin carboxyl-terminal hydrolase [P | 97.58 | |
| PF13514 | 1111 | AAA_27: AAA domain | 97.52 | |
| PTZ00121 | 2084 | MAEBL; Provisional | 97.51 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 97.5 | |
| COG4717 | 984 | Uncharacterized conserved protein [Function unknow | 97.49 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 97.49 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 97.48 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 97.47 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 97.47 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 97.47 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 97.46 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 97.46 | |
| KOG2072 | 988 | consensus Translation initiation factor 3, subunit | 97.46 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 97.46 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 97.45 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 97.44 | |
| KOG2129 | 552 | consensus Uncharacterized conserved protein H4 [Fu | 97.44 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 97.44 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 97.44 | |
| KOG4809 | 654 | consensus Rab6 GTPase-interacting protein involved | 97.43 | |
| KOG4807 | 593 | consensus F-actin binding protein, regulates actin | 97.41 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 97.4 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 97.4 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 97.4 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 97.39 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 97.39 | |
| PF14988 | 206 | DUF4515: Domain of unknown function (DUF4515) | 97.38 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 97.36 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 97.36 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 97.35 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 97.35 | |
| KOG4807 | 593 | consensus F-actin binding protein, regulates actin | 97.34 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 97.34 | |
| KOG4593 | 716 | consensus Mitotic checkpoint protein MAD1 [Cell cy | 97.32 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 97.32 | |
| KOG0249 | 916 | consensus LAR-interacting protein and related prot | 97.32 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 97.3 | |
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 97.27 | |
| KOG1924 | 1102 | consensus RhoA GTPase effector DIA/Diaphanous [Sig | 97.27 | |
| PTZ00121 | 2084 | MAEBL; Provisional | 97.27 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 97.26 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 97.26 | |
| KOG1899 | 861 | consensus LAR transmembrane tyrosine phosphatase-i | 97.26 | |
| PF03148 | 384 | Tektin: Tektin family; InterPro: IPR000435 Tektin | 97.26 | |
| PLN02939 | 977 | transferase, transferring glycosyl groups | 97.24 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 97.24 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 97.23 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 97.2 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 97.18 | |
| KOG4677 | 554 | consensus Golgi integral membrane protein [Intrace | 97.17 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 97.15 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 97.13 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 97.12 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 97.12 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 97.11 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 97.08 | |
| KOG1850 | 391 | consensus Myosin-like coiled-coil protein [Cytoske | 97.05 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 97.05 | |
| PF06705 | 247 | SF-assemblin: SF-assemblin/beta giardin | 97.04 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 97.0 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 97.0 | |
| KOG2008 | 426 | consensus BTK-associated SH3-domain binding protei | 96.98 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 96.98 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 96.94 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 96.93 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 96.93 | |
| KOG2129 | 552 | consensus Uncharacterized conserved protein H4 [Fu | 96.91 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 96.9 | |
| KOG4677 | 554 | consensus Golgi integral membrane protein [Intrace | 96.87 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 96.86 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 96.85 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 96.84 | |
| PF15254 | 861 | CCDC14: Coiled-coil domain-containing protein 14 | 96.84 | |
| PF06637 | 442 | PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 Th | 96.83 | |
| PLN03188 | 1320 | kinesin-12 family protein; Provisional | 96.81 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 96.81 | |
| PRK10698 | 222 | phage shock protein PspA; Provisional | 96.77 | |
| KOG0992 | 613 | consensus Uncharacterized conserved protein [Funct | 96.76 | |
| PF06705 | 247 | SF-assemblin: SF-assemblin/beta giardin | 96.76 | |
| PF03148 | 384 | Tektin: Tektin family; InterPro: IPR000435 Tektin | 96.75 | |
| PF14988 | 206 | DUF4515: Domain of unknown function (DUF4515) | 96.73 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 96.7 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 96.7 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 96.69 | |
| KOG1103 | 561 | consensus Predicted coiled-coil protein [Function | 96.69 | |
| PF15450 | 531 | DUF4631: Domain of unknown function (DUF4631) | 96.68 | |
| COG1842 | 225 | PspA Phage shock protein A (IM30), suppresses sigm | 96.6 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 96.6 | |
| PLN02939 | 977 | transferase, transferring glycosyl groups | 96.6 | |
| PF15254 | 861 | CCDC14: Coiled-coil domain-containing protein 14 | 96.6 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 96.57 | |
| KOG2685 | 421 | consensus Cystoskeletal protein Tektin [Cytoskelet | 96.57 | |
| PRK10698 | 222 | phage shock protein PspA; Provisional | 96.56 | |
| COG4717 | 984 | Uncharacterized conserved protein [Function unknow | 96.55 | |
| KOG4572 | 1424 | consensus Predicted DNA-binding transcription fact | 96.54 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 96.54 | |
| PRK10361 | 475 | DNA recombination protein RmuC; Provisional | 96.53 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 96.52 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 96.49 | |
| KOG1899 | 861 | consensus LAR transmembrane tyrosine phosphatase-i | 96.48 | |
| PF15450 | 531 | DUF4631: Domain of unknown function (DUF4631) | 96.37 | |
| PRK10361 | 475 | DNA recombination protein RmuC; Provisional | 96.33 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 96.32 | |
| KOG4302 | 660 | consensus Microtubule-associated protein essential | 96.32 | |
| COG1842 | 225 | PspA Phage shock protein A (IM30), suppresses sigm | 96.3 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 96.29 | |
| PF14073 | 178 | Cep57_CLD: Centrosome localisation domain of Cep57 | 96.28 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 96.27 | |
| KOG0244 | 913 | consensus Kinesin-like protein [Cytoskeleton] | 96.23 | |
| COG3206 | 458 | GumC Uncharacterized protein involved in exopolysa | 96.23 | |
| PF15397 | 258 | DUF4618: Domain of unknown function (DUF4618) | 96.23 | |
| KOG1850 | 391 | consensus Myosin-like coiled-coil protein [Cytoske | 96.22 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 96.21 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 96.19 | |
| PF14992 | 280 | TMCO5: TMCO5 family | 96.19 | |
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 96.17 | |
| TIGR02977 | 219 | phageshock_pspA phage shock protein A. Members of | 96.16 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 96.16 | |
| TIGR00618 | 1042 | sbcc exonuclease SbcC. This family is based on the | 96.15 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 96.1 | |
| KOG4572 | 1424 | consensus Predicted DNA-binding transcription fact | 96.07 | |
| PF15294 | 278 | Leu_zip: Leucine zipper | 96.06 | |
| TIGR02977 | 219 | phageshock_pspA phage shock protein A. Members of | 96.04 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 96.01 | |
| COG3096 | 1480 | MukB Uncharacterized protein involved in chromosom | 95.95 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 95.93 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 95.92 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 95.9 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 95.87 | |
| KOG0239 | 670 | consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | 95.87 | |
| PF04094 | 828 | DUF390: Protein of unknown function (DUF390); Inte | 95.86 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 95.85 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 95.84 | |
| KOG1103 | 561 | consensus Predicted coiled-coil protein [Function | 95.79 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 95.75 | |
| KOG4787 | 852 | consensus Uncharacterized conserved protein [Funct | 95.7 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 95.68 | |
| PF12795 | 240 | MscS_porin: Mechanosensitive ion channel porin dom | 95.66 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 95.66 | |
| PF14073 | 178 | Cep57_CLD: Centrosome localisation domain of Cep57 | 95.65 | |
| PF10212 | 518 | TTKRSYEDQ: Predicted coiled-coil domain-containing | 95.63 | |
| COG3096 | 1480 | MukB Uncharacterized protein involved in chromosom | 95.58 | |
| PF04912 | 388 | Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit | 95.57 | |
| KOG2991 | 330 | consensus Splicing regulator [RNA processing and m | 95.57 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 95.54 | |
| TIGR00618 | 1042 | sbcc exonuclease SbcC. This family is based on the | 95.49 | |
| KOG0992 | 613 | consensus Uncharacterized conserved protein [Funct | 95.48 | |
| COG0497 | 557 | RecN ATPase involved in DNA repair [DNA replicatio | 95.44 | |
| KOG4302 | 660 | consensus Microtubule-associated protein essential | 95.38 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 95.34 | |
| PF05384 | 159 | DegS: Sensor protein DegS; InterPro: IPR008595 Thi | 95.31 | |
| KOG0240 | 607 | consensus Kinesin (SMY1 subfamily) [Cytoskeleton] | 95.16 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 95.15 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 95.13 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 95.09 | |
| PLN03188 | 1320 | kinesin-12 family protein; Provisional | 95.07 | |
| KOG4403 | 575 | consensus Cell surface glycoprotein STIM, contains | 95.05 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 95.05 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 95.0 | |
| PF04912 | 388 | Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit | 94.95 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 94.93 | |
| PF12795 | 240 | MscS_porin: Mechanosensitive ion channel porin dom | 94.88 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 94.84 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 94.84 | |
| KOG0163 | 1259 | consensus Myosin class VI heavy chain [Cytoskeleto | 94.81 | |
| KOG4403 | 575 | consensus Cell surface glycoprotein STIM, contains | 94.77 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 94.68 | |
| KOG0577 | 948 | consensus Serine/threonine protein kinase [Signal | 94.62 | |
| PF04094 | 828 | DUF390: Protein of unknown function (DUF390); Inte | 94.44 | |
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 94.38 | |
| PF05262 | 489 | Borrelia_P83: Borrelia P83/100 protein; InterPro: | 94.38 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 94.38 | |
| PF12777 | 344 | MT: Microtubule-binding stalk of dynein motor; Int | 94.34 | |
| KOG0579 | 1187 | consensus Ste20-like serine/threonine protein kina | 94.32 | |
| PF10212 | 518 | TTKRSYEDQ: Predicted coiled-coil domain-containing | 94.3 | |
| KOG4438 | 446 | consensus Centromere-associated protein NUF2 [Cell | 94.27 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 94.23 | |
| PF14992 | 280 | TMCO5: TMCO5 family | 94.19 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 94.03 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 93.98 | |
| PF15294 | 278 | Leu_zip: Leucine zipper | 93.89 | |
| KOG4687 | 389 | consensus Uncharacterized coiled-coil protein [Fun | 93.83 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 93.81 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 93.78 | |
| KOG0240 | 607 | consensus Kinesin (SMY1 subfamily) [Cytoskeleton] | 93.77 | |
| COG3206 | 458 | GumC Uncharacterized protein involved in exopolysa | 93.71 | |
| PF07058 | 351 | Myosin_HC-like: Myosin II heavy chain-like; InterP | 93.7 | |
| KOG0244 | 913 | consensus Kinesin-like protein [Cytoskeleton] | 93.68 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 93.62 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 93.58 | |
| KOG2891 | 445 | consensus Surface glycoprotein [General function p | 93.57 | |
| PF09731 | 582 | Mitofilin: Mitochondrial inner membrane protein; I | 93.56 | |
| PF12252 | 1439 | SidE: Dot/Icm substrate protein; InterPro: IPR0210 | 93.55 | |
| KOG0577 | 948 | consensus Serine/threonine protein kinase [Signal | 93.51 | |
| KOG2685 | 421 | consensus Cystoskeletal protein Tektin [Cytoskelet | 93.46 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 93.35 | |
| PRK11519 | 719 | tyrosine kinase; Provisional | 93.26 | |
| PF09738 | 302 | DUF2051: Double stranded RNA binding protein (DUF2 | 93.21 | |
| PF07889 | 126 | DUF1664: Protein of unknown function (DUF1664); In | 93.15 | |
| KOG2991 | 330 | consensus Splicing regulator [RNA processing and m | 93.14 | |
| PF15358 | 558 | TSKS: Testis-specific serine kinase substrate | 93.06 | |
| PF05276 | 239 | SH3BP5: SH3 domain-binding protein 5 (SH3BP5); Int | 93.04 | |
| COG0497 | 557 | RecN ATPase involved in DNA repair [DNA replicatio | 93.03 | |
| PF03999 | 619 | MAP65_ASE1: Microtubule associated protein (MAP65/ | 92.97 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 92.97 | |
| PF08580 | 683 | KAR9: Yeast cortical protein KAR9; InterPro: IPR01 | 92.95 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 92.88 | |
| PRK06569 | 155 | F0F1 ATP synthase subunit B'; Validated | 92.83 | |
| KOG1265 | 1189 | consensus Phospholipase C [Lipid transport and met | 92.82 | |
| PF12072 | 201 | DUF3552: Domain of unknown function (DUF3552); Int | 92.81 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 92.8 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 92.79 | |
| KOG4460 | 741 | consensus Nuclear pore complex, Nup88/rNup84 compo | 92.61 | |
| PF07798 | 177 | DUF1640: Protein of unknown function (DUF1640); In | 92.61 | |
| PF02841 | 297 | GBP_C: Guanylate-binding protein, C-terminal domai | 92.47 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 92.27 | |
| PF15272 | 196 | BBP1_C: Spindle pole body component BBP1, C-termin | 92.08 | |
| KOG2077 | 832 | consensus JNK/SAPK-associated protein-1 [Signal tr | 92.04 | |
| PF06548 | 488 | Kinesin-related: Kinesin-related; InterPro: IPR010 | 91.99 | |
| PF15035 | 182 | Rootletin: Ciliary rootlet component, centrosome c | 91.99 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 91.96 | |
| PF09744 | 158 | Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; Inte | 91.84 | |
| PRK11519 | 719 | tyrosine kinase; Provisional | 91.83 | |
| KOG4787 | 852 | consensus Uncharacterized conserved protein [Funct | 91.83 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 91.78 | |
| PF05262 | 489 | Borrelia_P83: Borrelia P83/100 protein; InterPro: | 91.75 | |
| PF10234 | 267 | Cluap1: Clusterin-associated protein-1; InterPro: | 91.62 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 91.59 | |
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 91.55 | |
| PF12240 | 205 | Angiomotin_C: Angiomotin C terminal; InterPro: IPR | 91.35 | |
| PF11802 | 268 | CENP-K: Centromere-associated protein K; InterPro: | 91.3 | |
| KOG1923 | 830 | consensus Rac1 GTPase effector FRL [Signal transdu | 91.26 | |
| KOG4438 | 446 | consensus Centromere-associated protein NUF2 [Cell | 91.1 | |
| KOG0163 | 1259 | consensus Myosin class VI heavy chain [Cytoskeleto | 91.09 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 91.05 | |
| KOG0239 | 670 | consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | 91.0 | |
| PF02994 | 370 | Transposase_22: L1 transposable element; InterPro: | 90.96 | |
| PF15272 | 196 | BBP1_C: Spindle pole body component BBP1, C-termin | 90.91 | |
| KOG2412 | 591 | consensus Nuclear-export-signal (NES)-containing p | 90.86 | |
| TIGR01010 | 362 | BexC_CtrB_KpsE polysaccharide export inner-membran | 90.83 | |
| PF10267 | 395 | Tmemb_cc2: Predicted transmembrane and coiled-coil | 90.77 | |
| PF04949 | 159 | Transcrip_act: Transcriptional activator; InterPro | 90.54 | |
| KOG0517 | 2473 | consensus Beta-spectrin [Cytoskeleton] | 90.49 | |
| cd07651 | 236 | F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology | 90.32 | |
| KOG0993 | 542 | consensus Rab5 GTPase effector Rabaptin-5 [Intrace | 90.29 | |
| PRK14474 | 250 | F0F1 ATP synthase subunit B; Provisional | 90.28 | |
| PRK00409 | 782 | recombination and DNA strand exchange inhibitor pr | 90.2 | |
| PF11180 | 192 | DUF2968: Protein of unknown function (DUF2968); In | 90.13 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 90.06 | |
| PF03915 | 424 | AIP3: Actin interacting protein 3; InterPro: IPR02 | 90.05 | |
| KOG0579 | 1187 | consensus Ste20-like serine/threonine protein kina | 90.05 | |
| PRK00409 | 782 | recombination and DNA strand exchange inhibitor pr | 90.01 | |
| PF04642 | 311 | DUF601: Protein of unknown function, DUF601; Inter | 89.97 | |
| KOG4451 | 286 | consensus Uncharacterized conserved protein (tumor | 89.94 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 89.82 | |
| TIGR01010 | 362 | BexC_CtrB_KpsE polysaccharide export inner-membran | 89.76 | |
| KOG4722 | 672 | consensus Zn-finger protein [General function pred | 89.66 | |
| PF05816 | 333 | TelA: Toxic anion resistance protein (TelA); Inter | 89.65 | |
| KOG2077 | 832 | consensus JNK/SAPK-associated protein-1 [Signal tr | 89.58 | |
| PF09731 | 582 | Mitofilin: Mitochondrial inner membrane protein; I | 89.51 | |
| PF10267 | 395 | Tmemb_cc2: Predicted transmembrane and coiled-coil | 89.48 | |
| PF04108 | 412 | APG17: Autophagy protein Apg17 ; InterPro: IPR0072 | 89.44 | |
| COG5022 | 1463 | Myosin heavy chain [Cytoskeleton] | 89.41 | |
| KOG4364 | 811 | consensus Chromatin assembly factor-I [Chromatin s | 89.35 | |
| PRK06569 | 155 | F0F1 ATP synthase subunit B'; Validated | 89.35 | |
| PF06548 | 488 | Kinesin-related: Kinesin-related; InterPro: IPR010 | 89.32 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 89.22 | |
| PRK09174 | 204 | F0F1 ATP synthase subunit B'; Validated | 89.15 | |
| KOG1265 | 1189 | consensus Phospholipase C [Lipid transport and met | 89.03 | |
| PF09403 | 126 | FadA: Adhesion protein FadA; InterPro: IPR018543 F | 89.01 | |
| PF12240 | 205 | Angiomotin_C: Angiomotin C terminal; InterPro: IPR | 89.01 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 89.0 | |
| PF11855 | 478 | DUF3375: Protein of unknown function (DUF3375); In | 88.96 | |
| KOG3595 | 1395 | consensus Dyneins, heavy chain [Cytoskeleton] | 88.93 | |
| PF12329 | 74 | TMF_DNA_bd: TATA element modulatory factor 1 DNA b | 88.86 | |
| smart00502 | 127 | BBC B-Box C-terminal domain. Coiled coil region C- | 88.81 | |
| PRK15178 | 434 | Vi polysaccharide export inner membrane protein Ve | 88.68 | |
| KOG2891 | 445 | consensus Surface glycoprotein [General function p | 88.62 | |
| PF10211 | 189 | Ax_dynein_light: Axonemal dynein light chain; Inte | 88.6 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 88.45 | |
| PF15233 | 134 | SYCE1: Synaptonemal complex central element protei | 88.37 | |
| COG1382 | 119 | GimC Prefoldin, chaperonin cofactor [Posttranslati | 88.3 | |
| PF09403 | 126 | FadA: Adhesion protein FadA; InterPro: IPR018543 F | 88.15 | |
| PRK06568 | 154 | F0F1 ATP synthase subunit B; Validated | 88.12 | |
| PF05278 | 269 | PEARLI-4: Arabidopsis phospholipase-like protein ( | 88.08 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 87.99 | |
| KOG4460 | 741 | consensus Nuclear pore complex, Nup88/rNup84 compo | 87.85 | |
| CHL00118 | 156 | atpG ATP synthase CF0 B' subunit; Validated | 87.82 | |
| PF05149 | 289 | Flagellar_rod: Paraflagellar rod protein; InterPro | 87.8 | |
| PF05276 | 239 | SH3BP5: SH3 domain-binding protein 5 (SH3BP5); Int | 87.59 | |
| PTZ00332 | 589 | paraflagellar rod protein; Provisional | 87.56 | |
| PRK08476 | 141 | F0F1 ATP synthase subunit B'; Validated | 87.52 | |
| PF15290 | 305 | Syntaphilin: Golgi-localised syntaxin-1-binding cl | 87.41 | |
| KOG4552 | 272 | consensus Vitamin-D-receptor interacting protein c | 87.39 | |
| COG4913 | 1104 | Uncharacterized protein conserved in bacteria [Fun | 87.38 | |
| KOG2751 | 447 | consensus Beclin-like protein [Signal transduction | 87.37 | |
| TIGR02338 | 110 | gimC_beta prefoldin, beta subunit, archaeal. Chape | 87.35 | |
| COG5293 | 591 | Predicted ATPase [General function prediction only | 87.3 | |
| PF13863 | 126 | DUF4200: Domain of unknown function (DUF4200) | 87.22 | |
| PRK14474 | 250 | F0F1 ATP synthase subunit B; Provisional | 87.19 | |
| PF07058 | 351 | Myosin_HC-like: Myosin II heavy chain-like; InterP | 87.1 | |
| KOG2751 | 447 | consensus Beclin-like protein [Signal transduction | 87.09 | |
| COG1382 | 119 | GimC Prefoldin, chaperonin cofactor [Posttranslati | 87.08 | |
| PRK15178 | 434 | Vi polysaccharide export inner membrane protein Ve | 87.07 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 87.06 | |
| PRK06975 | 656 | bifunctional uroporphyrinogen-III synthetase/uropo | 87.04 | |
| PF05278 | 269 | PEARLI-4: Arabidopsis phospholipase-like protein ( | 87.01 | |
| PF13949 | 296 | ALIX_LYPXL_bnd: ALIX V-shaped domain binding to HI | 86.97 | |
| PRK05771 | 646 | V-type ATP synthase subunit I; Validated | 86.93 | |
| PRK03947 | 140 | prefoldin subunit alpha; Reviewed | 86.92 | |
| cd00632 | 105 | Prefoldin_beta Prefoldin beta; Prefoldin is a hexa | 86.86 | |
| PF04582 | 326 | Reo_sigmaC: Reovirus sigma C capsid protein; Inter | 86.69 | |
| KOG3771 | 460 | consensus Amphiphysin [Intracellular trafficking, | 86.62 | |
| PF07889 | 126 | DUF1664: Protein of unknown function (DUF1664); In | 86.62 | |
| KOG1924 | 1102 | consensus RhoA GTPase effector DIA/Diaphanous [Sig | 86.47 | |
| PF11180 | 192 | DUF2968: Protein of unknown function (DUF2968); In | 86.45 | |
| KOG3759 | 621 | consensus Uncharacterized RUN domain protein [Sign | 86.43 | |
| KOG4429 | 421 | consensus Uncharacterized conserved protein, conta | 86.37 | |
| KOG4687 | 389 | consensus Uncharacterized coiled-coil protein [Fun | 86.31 | |
| KOG1118 | 366 | consensus Lysophosphatidic acid acyltransferase en | 86.21 | |
| PF09744 | 158 | Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; Inte | 86.12 | |
| PF15290 | 305 | Syntaphilin: Golgi-localised syntaxin-1-binding cl | 86.03 | |
| PRK13453 | 173 | F0F1 ATP synthase subunit B; Provisional | 85.94 | |
| smart00502 | 127 | BBC B-Box C-terminal domain. Coiled coil region C- | 85.94 | |
| cd07666 | 243 | BAR_SNX7 The Bin/Amphiphysin/Rvs (BAR) domain of S | 85.91 | |
| PF13747 | 89 | DUF4164: Domain of unknown function (DUF4164) | 85.81 | |
| PF06120 | 301 | Phage_HK97_TLTM: Tail length tape measure protein; | 85.8 | |
| PRK13454 | 181 | F0F1 ATP synthase subunit B'; Provisional | 85.76 |
| >PF14631 FancD2: Fanconi anaemia protein FancD2 nuclease; PDB: 3S4W_B | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.6e-73 Score=758.50 Aligned_cols=437 Identities=29% Similarity=0.451 Sum_probs=350.3
Q ss_pred hhHHHHHHHhhcceeecCCCCCCCc---hhHHHHhh-------cccHHHHHHHHhhhhhccCChHHHhhhcCCccccCCC
Q 000301 761 EEDIVRNLLSRAGFHLTYGDNPSQP---QVTLREKL-------LMDAGAIAGFLTGLRVYLDDPAKAKRLLLPTKLSGSD 830 (1701)
Q Consensus 761 ~~~~f~~~l~~~g~~l~~g~~~~~~---q~~~~~~~-------~~~~~~i~~f~~gl~~~~~~~~~~~~~llp~~~~~~~ 830 (1701)
++++|+.+|++||++|..|++||++ ||.|++|| +.||.+|++|++||+.||+|+++|++|||||.+.+++
T Consensus 44 ~~~~f~~~L~~aG~~L~~g~~~~~l~~d~i~f~~kL~~~L~~~~~yp~~v~~F~~gl~~~i~~~~~~~~~Ll~~~~~~~~ 123 (1426)
T PF14631_consen 44 NDSVFESVLKDAGVTLKTGEGPNVLSVDQIIFQKKLRKILRKSPSYPENVEEFLSGLESYIEDRDNFRNCLLPCCPSQNA 123 (1426)
T ss_dssp ---HHHHHHHHTTEE---TTS--EESS-TTHHHHHHHHHHHHSS-HHHHHHHHHHHHHHHTTSHHHHHHHSSB-B-----
T ss_pred CccHHHHHHHHcCeeeCCCCCCceeccCHHHHHHHHHHHHHhCCCchHHHHHHHHHHHHHhcCHHHHHHHhcCCCccccc
Confidence 5689999999999999999999998 99999998 6899999999999999999999999999999988744
Q ss_pred CcccccCCCCchhHHHhhhcchhhHHHHHHHHHHHHhhhcCCCCCCCCCCCCCCCCCCCCCCCCCCCCcccccccCCccc
Q 000301 831 GKKVAKTDESSPSVMNLLMGVKVLQQAIIDLLLDIMVECCQPSDGNYYGDSSDANSKPPLDANGGARPLEADRENGASES 910 (1701)
Q Consensus 831 ~~~~~~~~~~~~sl~~ll~~v~~lq~~ii~~l~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 910 (1701)
+. .+....+++||||+||||+.||++||++||+||+||+..+
T Consensus 124 ~~-~~~~~~~~~Slir~LL~i~~lQ~~~i~~LleKl~e~~~~~------------------------------------- 165 (1426)
T PF14631_consen 124 EA-ESIGQSSQESLIRLLLGIDFLQPALIEMLLEKLPEFAFES------------------------------------- 165 (1426)
T ss_dssp ------------BHHHHHHHSTTTHHHHHHHHHHHHHHHHS---------------------------------------
T ss_pred cc-ccccccccHHHHHHHhCCccccHHHHHHHHHHHHHHHhcc-------------------------------------
Confidence 33 2455668899999999999999999999999999999774
Q ss_pred cccccccccCCCCCCCCCcccccccCCCCcccccccCCCCCCCCCCcCCCCCcccccccccCCCchhHHHHHHHHHhhhh
Q 000301 911 AQFPLFERLDSGADDNSTTSAVQSSDLSGIDIAEKALPGQPIFPPETSAGGSLESASFRSKTKWPEQSAELLGLIVNSLR 990 (1701)
Q Consensus 911 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~li~~~l~ 990 (1701)
.+..|.++| +||+||||
T Consensus 166 ------------------------~~~~~~~~~---------------------------------------~Lil~Qlr 182 (1426)
T PF14631_consen 166 ------------------------SGSDGINIP---------------------------------------RLILNQLR 182 (1426)
T ss_dssp --------------------------TT---HH---------------------------------------HHHHGGGT
T ss_pred ------------------------ccCCCCChH---------------------------------------HHHHHHhh
Confidence 122345666 99999999
Q ss_pred hccccCCCCCCCCCCCchhHHHHHHHhccCCCCcchhHHhhccccccCCCchHHHHHHHHHhccCCCCCccchhHHhhhc
Q 000301 991 ALDGAVPQGCPEPRRRPQSAQKISLVLDKAPKHLQPDLVALVPKLVEHSEHPLAADALIERLQKSDAEPALRMPVFVALS 1070 (1701)
Q Consensus 991 ~ld~~~~~~~~~~~~~~~~~~k~~~~l~~~p~~lq~d~i~~~p~~~~~~~h~~~a~~l~~~l~~~~~~~~l~~p~~~als 1070 (1701)
|||++|++ .+++.||++||++||.++|+|||++||+|++|++|..|+.+|.++|+++ +.|++|||||||
T Consensus 183 wLd~i~d~--------~~l~~kl~~~l~~ap~~lq~eiI~~LPeIl~ds~h~~v~~~L~~ll~~~---~~L~~~iLd~Ls 251 (1426)
T PF14631_consen 183 WLDRIVDS--------EELTDKLFEVLSIAPVELQKEIISSLPEILDDSQHDEVVEELLELLQEN---PELTVPILDALS 251 (1426)
T ss_dssp T-S--SSH--------HHHHHHHHHHHHHS-TTTHHHHHHTHHHHS-GGGHHHHHHHHHHHHHH----STTHHHHHHHHH
T ss_pred ccccccCH--------HHHHHHHHHHHHhCCHHHHHHHHHHHHHHhcchhHHHHHHHHHHHHhcC---CchhhhHHHHHh
Confidence 99999999 9999999999999999999999999999999999999999999999995 899999999999
Q ss_pred cccCChHHHHHHHHHHHhhhcCCCCCCchhhhhhhhhccccccchHHHHHHHHHHHH------------------hcCCC
Q 000301 1071 QLDFGSEVWERILLKSLELLTDSNDEPLAVTIDFIFKAASQCQHLPEAVRSVRVRLK------------------NLGAE 1132 (1701)
Q Consensus 1071 ~l~~~~~~~~~v~~~~~~~l~~~~~e~l~~~i~f~~~~~~~~~~~~~~~~~~r~~l~------------------~~~~~ 1132 (1701)
+|+|+++++++||+.+|+.|++++.|+||++|+|||++++... ..++|..+|.+|+ +.|.+
T Consensus 252 ~L~Ls~~~l~~vr~~vl~~L~s~~~e~LP~lirFLL~s~t~~d-a~evI~~LR~~L~~~~~v~~~~~~~s~~~~k~~~~~ 330 (1426)
T PF14631_consen 252 NLNLSPELLEEVREKVLEKLSSVDLEDLPVLIRFLLQSITPSD-AVEVISELRENLDFEQCVLPSRIQASQRKLKNKGNA 330 (1426)
T ss_dssp HS---HHHHHHHHHHHHHSTTSS-TTHHHHHHHHHHHS-SSTT-HHHHHHHHHHHHH-----------------------
T ss_pred cCCCCHHHHHHHHHHHHHHHhcCChhhhHHHHHHHHHhCCccc-HHHHHHHHHHHccccccccchhhcccccccccCccc
Confidence 9999999999999999999999999999999999999987666 4567777777664 44444
Q ss_pred CCh------------hHHHHHHhhhccChhhHHHHHHhhccCcCCCCCCCCCCCcccccCCCCCCCCccchhhhhhhccc
Q 000301 1133 VSP------------CVLDFLSKTVNSWGDVAETILRDIDCDDDFGDNCSTMPSGLFLFGENGPTSDSLHVMDEQAFRAT 1200 (1701)
Q Consensus 1133 ~~~------------~~~~~~~~~v~~~~~~~e~~l~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1200 (1701)
.++ +++|+|+++|+++++++|||+|+|++..+..+
T Consensus 331 ~~~~~~~~s~~~~~~lil~~lks~lr~~k~l~eawiK~I~~~~~~~~--------------------------------- 377 (1426)
T PF14631_consen 331 SSSGNQENSSQDCEKLILDVLKSGLRFSKDLSEAWIKAIESLEDASD--------------------------------- 377 (1426)
T ss_dssp --------HHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHGGGSTT---------------------------------
T ss_pred ccccccccccccHHHHHHHHHHHHHHhccHHHHHHHHHHhcCCCccc---------------------------------
Confidence 332 69999999999999999999999999987766
Q ss_pred cchhhHHHHHHHhcCC-chhHHHHHHHHHHHhcCcchhHHHHHHHHHHhhhcccCCCCcccccccccccccccccccccc
Q 000301 1201 RHFSDIYILIEMLSIP-CIAVEAAQTFERAVARGTIVAQSIALVLERRLAQRLNFNPGFVAENFQHTDVVVEGEQLIVQR 1279 (1701)
Q Consensus 1201 ~~~~d~~~l~~~~s~~-~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1279 (1701)
|+++|+|||++||+++ ..++.|+++|++||+.|+|++++|.- +| . .|..|++
T Consensus 378 hkv~Dl~lLlil~s~~~~~~k~ie~ilkkKI~~g~it~~ll~~--------------~f-~------------~~~~vL~ 430 (1426)
T PF14631_consen 378 HKVIDLWLLLILYSINEDNRKSIEKILKKKIKSGHITEQLLDQ--------------TF-K------------GHSEVLK 430 (1426)
T ss_dssp --THHHHHHHHHHHH-HHHHHHHHHHHHHHHTTT-S-HHHHHH--------------HH-H------------HHHHHHT
T ss_pred cchHHHHHHHHHHcCCccchHHHHHHHHHHHHhCcccHHHHHH--------------HH-h------------hhHHHHH
Confidence 9999999999999998 56799999999999999999999932 33 1 3456889
Q ss_pred hhhhHHHHHHHHHhcCcChhHHHHHHHHHHHHHhhcCCchhHHHHHHHHHHhhcCCCCCcccccchHHHHHHHHhhhcc-
Q 000301 1280 DDFTCVLGLAETLALSRDIRVREFVKILYTILLKWYPDESYRGRMLKRLVDRATSTTESSRGVDLDLEILVILVCEEQE- 1358 (1701)
Q Consensus 1280 ~~f~~~l~la~~l~~s~~~~v~~f~~~~y~~~f~~~~~~~~~~~~~~~lv~~~~s~~~~~~ev~~~l~vL~~l~~~~~~- 1358 (1701)
+||+++|.||+.|++|.|+.|++||++||+++|+.| |+|||||||++||+|+||| +..||+.+|+||+.|+..+++
T Consensus 431 ~~f~siL~la~~Ll~S~e~~v~~FG~~~Y~~lF~~f-ds~~qqeVv~~Lvthi~sg--~~~ev~~aL~vL~~L~~~~~~~ 507 (1426)
T PF14631_consen 431 DYFPSILSLAQSLLRSKEPSVREFGSHLYKYLFKEF-DSYCQQEVVGALVTHIGSG--NSQEVDAALDVLCELAEKNPSE 507 (1426)
T ss_dssp TSHHHHHHHHHHHHTSSSHHHHHHHHHHHHHHHHSS--HHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHH-HHH
T ss_pred HHHHHHHHHHHHHHhCCCHHHHHHHHHHHHHHHhhc-cchhHHHHHHHHHHHHcCC--cHHHHHHHHHHHHHHHhccHHH
Confidence 999999999999999999999999999999999999 8999999999999999999 899999999999999988875
Q ss_pred ------ccchhHHHHHHHHHH
Q 000301 1359 ------IIRPVLSMLREVAEL 1373 (1701)
Q Consensus 1359 ------~VKPlLq~lRqe~E~ 1373 (1701)
+++++|+++..-...
T Consensus 508 l~~fa~~l~giLD~l~~Ls~~ 528 (1426)
T PF14631_consen 508 LQPFATFLKGILDYLDNLSLQ 528 (1426)
T ss_dssp HHHTHHHHHGGGGGGGG--HH
T ss_pred HHHHHHHHHHHHHHHhcCCHH
Confidence 889999999876555
|
|
| >KOG4712 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd03772 MATH_HAUSP Herpesvirus-associated ubiquitin-specific protease (HAUSP, also known as USP7) family, N-terminal MATH (TRAF-like) domain; composed of proteins similar to human HAUSP, an enzyme that specifically catalyzes the deubiquitylation of p53 and MDM2, hence playing an important role in the p53-MDM2 pathway | Back alignment and domain information |
|---|
| >cd03772 MATH_HAUSP Herpesvirus-associated ubiquitin-specific protease (HAUSP, also known as USP7) family, N-terminal MATH (TRAF-like) domain; composed of proteins similar to human HAUSP, an enzyme that specifically catalyzes the deubiquitylation of p53 and MDM2, hence playing an important role in the p53-MDM2 pathway | Back alignment and domain information |
|---|
| >cd03775 MATH_Ubp21p Ubiquitin-specific protease 21 (Ubp21p) family, MATH domain; composed of fungal proteins with similarity to Ubp21p of fission yeast | Back alignment and domain information |
|---|
| >cd03775 MATH_Ubp21p Ubiquitin-specific protease 21 (Ubp21p) family, MATH domain; composed of fungal proteins with similarity to Ubp21p of fission yeast | Back alignment and domain information |
|---|
| >cd03780 MATH_TRAF5 Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF5 subfamily, TRAF domain, C-terminal MATH subdomain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses | Back alignment and domain information |
|---|
| >cd03777 MATH_TRAF3 Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF3 subfamily, TRAF domain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses | Back alignment and domain information |
|---|
| >cd03778 MATH_TRAF2 Tumor Necrosis Factor Receptor (TNFR) Associated Factor (TRAF) family, TRAF2 subfamily, TRAF domain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses | Back alignment and domain information |
|---|
| >cd03779 MATH_TRAF1 Tumor Necrosis Factor Receptor (TNFR) Associated Factor (TRAF) family, TRAF1 subfamily, TRAF domain, C-terminal MATH subdomain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses | Back alignment and domain information |
|---|
| >cd03776 MATH_TRAF6 Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF6 subfamily, TRAF domain, C-terminal MATH subdomain; composed of proteins with similarity to human TRAF6, including the Drosophila protein DTRAF2 | Back alignment and domain information |
|---|
| >cd03774 MATH_SPOP Speckle-type POZ protein (SPOP) family, MATH domain; composed of proteins with similarity to human SPOP | Back alignment and domain information |
|---|
| >cd00270 MATH_TRAF_C Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF domain, C-terminal MATH subdomain; TRAF molecules serve as adapter proteins that link cell surface TNFRs and receptors of the interleukin-1/Toll-like family to downstream kinase signaling cascades which results in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses in the immune and inflammatory systems | Back alignment and domain information |
|---|
| >cd03771 MATH_Meprin Meprin family, MATH domain; Meprins are multidomain, highly glycosylated extracellular metalloproteases, which are either anchored to the membrane or secreted into extracellular spaces | Back alignment and domain information |
|---|
| >cd03781 MATH_TRAF4 Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF4 subfamily, TRAF domain, C-terminal MATH subdomain; composed of proteins with similarity to human TRAF4, including the Drosophila protein DTRAF1 | Back alignment and domain information |
|---|
| >cd03773 MATH_TRIM37 Tripartite motif containing protein 37 (TRIM37) family, MATH domain; TRIM37 is a peroxisomal protein and is a member of the tripartite motif (TRIM) protein subfamily, also known as the RING-B-box-coiled-coil (RBCC) subfamily of zinc-finger proteins | Back alignment and domain information |
|---|
| >cd00270 MATH_TRAF_C Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF domain, C-terminal MATH subdomain; TRAF molecules serve as adapter proteins that link cell surface TNFRs and receptors of the interleukin-1/Toll-like family to downstream kinase signaling cascades which results in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses in the immune and inflammatory systems | Back alignment and domain information |
|---|
| >cd03774 MATH_SPOP Speckle-type POZ protein (SPOP) family, MATH domain; composed of proteins with similarity to human SPOP | Back alignment and domain information |
|---|
| >cd03776 MATH_TRAF6 Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF6 subfamily, TRAF domain, C-terminal MATH subdomain; composed of proteins with similarity to human TRAF6, including the Drosophila protein DTRAF2 | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd03781 MATH_TRAF4 Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF4 subfamily, TRAF domain, C-terminal MATH subdomain; composed of proteins with similarity to human TRAF4, including the Drosophila protein DTRAF1 | Back alignment and domain information |
|---|
| >cd03780 MATH_TRAF5 Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF5 subfamily, TRAF domain, C-terminal MATH subdomain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses | Back alignment and domain information |
|---|
| >cd03773 MATH_TRIM37 Tripartite motif containing protein 37 (TRIM37) family, MATH domain; TRIM37 is a peroxisomal protein and is a member of the tripartite motif (TRIM) protein subfamily, also known as the RING-B-box-coiled-coil (RBCC) subfamily of zinc-finger proteins | Back alignment and domain information |
|---|
| >cd03777 MATH_TRAF3 Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF3 subfamily, TRAF domain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses | Back alignment and domain information |
|---|
| >cd03783 MATH_Meprin_Alpha Meprin family, Alpha subunit, MATH domain; Meprins are multidomain extracellular metalloproteases capable of cleaving growth factors, cytokines, extracellular matrix proteins, and biologically active peptides | Back alignment and domain information |
|---|
| >cd03779 MATH_TRAF1 Tumor Necrosis Factor Receptor (TNFR) Associated Factor (TRAF) family, TRAF1 subfamily, TRAF domain, C-terminal MATH subdomain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses | Back alignment and domain information |
|---|
| >cd03782 MATH_Meprin_Beta Meprin family, Beta subunit, MATH domain; Meprins are multidomain extracellular metalloproteases capable of cleaving growth factors, cytokines, extracellular matrix proteins, and biologically active peptides | Back alignment and domain information |
|---|
| >cd03771 MATH_Meprin Meprin family, MATH domain; Meprins are multidomain, highly glycosylated extracellular metalloproteases, which are either anchored to the membrane or secreted into extracellular spaces | Back alignment and domain information |
|---|
| >cd00121 MATH MATH (meprin and TRAF-C homology) domain; an independent folding unit with an eight-stranded beta-sandwich structure found in meprins, TRAFs and other proteins | Back alignment and domain information |
|---|
| >cd00121 MATH MATH (meprin and TRAF-C homology) domain; an independent folding unit with an eight-stranded beta-sandwich structure found in meprins, TRAFs and other proteins | Back alignment and domain information |
|---|
| >cd03778 MATH_TRAF2 Tumor Necrosis Factor Receptor (TNFR) Associated Factor (TRAF) family, TRAF2 subfamily, TRAF domain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses | Back alignment and domain information |
|---|
| >PF00917 MATH: MATH domain; InterPro: IPR002083 Although apparently functionally unrelated, intracellular TRAFs and extracellular meprins share a conserved region of about 180 residues, the meprin and TRAF homology (MATH) domain [] | Back alignment and domain information |
|---|
| >PF00917 MATH: MATH domain; InterPro: IPR002083 Although apparently functionally unrelated, intracellular TRAFs and extracellular meprins share a conserved region of about 180 residues, the meprin and TRAF homology (MATH) domain [] | Back alignment and domain information |
|---|
| >smart00061 MATH meprin and TRAF homology | Back alignment and domain information |
|---|
| >smart00061 MATH meprin and TRAF homology | Back alignment and domain information |
|---|
| >COG5077 Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03782 MATH_Meprin_Beta Meprin family, Beta subunit, MATH domain; Meprins are multidomain extracellular metalloproteases capable of cleaving growth factors, cytokines, extracellular matrix proteins, and biologically active peptides | Back alignment and domain information |
|---|
| >cd03783 MATH_Meprin_Alpha Meprin family, Alpha subunit, MATH domain; Meprins are multidomain extracellular metalloproteases capable of cleaving growth factors, cytokines, extracellular matrix proteins, and biologically active peptides | Back alignment and domain information |
|---|
| >COG5077 Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >KOG1987 consensus Speckle-type POZ protein SPOP and related proteins with TRAF, MATH and BTB/POZ domains [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG1987 consensus Speckle-type POZ protein SPOP and related proteins with TRAF, MATH and BTB/POZ domains [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1937 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1937 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1863 consensus Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >PF06637 PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 This family consists of several PV-1 (PLVAP) proteins, which seem to be specific to mammals | Back alignment and domain information |
|---|
| >KOG2072 consensus Translation initiation factor 3, subunit a (eIF-3a) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PF15397 DUF4618: Domain of unknown function (DUF4618) | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >KOG1863 consensus Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PTZ00121 MAEBL; Provisional | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >COG4717 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >KOG2072 consensus Translation initiation factor 3, subunit a (eIF-3a) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF14988 DUF4515: Domain of unknown function (DUF4515) | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PTZ00121 MAEBL; Provisional | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] | Back alignment and domain information |
|---|
| >PF03148 Tektin: Tektin family; InterPro: IPR000435 Tektin heteropolymers form unique protofilaments of flagellar microtubules [] | Back alignment and domain information |
|---|
| >PLN02939 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >KOG4677 consensus Golgi integral membrane protein [Intracellular trafficking, secretion, and vesicular transport; General function prediction only] | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >KOG1850 consensus Myosin-like coiled-coil protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >PF06705 SF-assemblin: SF-assemblin/beta giardin | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >KOG2008 consensus BTK-associated SH3-domain binding protein SAB [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >KOG4677 consensus Golgi integral membrane protein [Intracellular trafficking, secretion, and vesicular transport; General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PF15254 CCDC14: Coiled-coil domain-containing protein 14 | Back alignment and domain information |
|---|
| >PF06637 PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 This family consists of several PV-1 (PLVAP) proteins, which seem to be specific to mammals | Back alignment and domain information |
|---|
| >PLN03188 kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >KOG0992 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF06705 SF-assemblin: SF-assemblin/beta giardin | Back alignment and domain information |
|---|
| >PF03148 Tektin: Tektin family; InterPro: IPR000435 Tektin heteropolymers form unique protofilaments of flagellar microtubules [] | Back alignment and domain information |
|---|
| >PF14988 DUF4515: Domain of unknown function (DUF4515) | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >KOG1103 consensus Predicted coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF15450 DUF4631: Domain of unknown function (DUF4631) | Back alignment and domain information |
|---|
| >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >PLN02939 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >PF15254 CCDC14: Coiled-coil domain-containing protein 14 | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >KOG2685 consensus Cystoskeletal protein Tektin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >COG4717 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4572 consensus Predicted DNA-binding transcription factor, interacts with stathmin [Transcription; General function prediction only; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK10361 DNA recombination protein RmuC; Provisional | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] | Back alignment and domain information |
|---|
| >PF15450 DUF4631: Domain of unknown function (DUF4631) | Back alignment and domain information |
|---|
| >PRK10361 DNA recombination protein RmuC; Provisional | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >PF14073 Cep57_CLD: Centrosome localisation domain of Cep57 | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >KOG0244 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF15397 DUF4618: Domain of unknown function (DUF4618) | Back alignment and domain information |
|---|
| >KOG1850 consensus Myosin-like coiled-coil protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >PF14992 TMCO5: TMCO5 family | Back alignment and domain information |
|---|
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR02977 phageshock_pspA phage shock protein A | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >TIGR00618 sbcc exonuclease SbcC | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >KOG4572 consensus Predicted DNA-binding transcription factor, interacts with stathmin [Transcription; General function prediction only; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF15294 Leu_zip: Leucine zipper | Back alignment and domain information |
|---|
| >TIGR02977 phageshock_pspA phage shock protein A | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >COG3096 MukB Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF04094 DUF390: Protein of unknown function (DUF390); InterPro: IPR007228 This domain is found in a family of long proteins that are currently found only in rice | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1103 consensus Predicted coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4787 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PF12795 MscS_porin: Mechanosensitive ion channel porin domain | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF14073 Cep57_CLD: Centrosome localisation domain of Cep57 | Back alignment and domain information |
|---|
| >PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif | Back alignment and domain information |
|---|
| >COG3096 MukB Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) [] | Back alignment and domain information |
|---|
| >KOG2991 consensus Splicing regulator [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR00618 sbcc exonuclease SbcC | Back alignment and domain information |
|---|
| >KOG0992 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins | Back alignment and domain information |
|---|
| >KOG0240 consensus Kinesin (SMY1 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PLN03188 kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) [] | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >PF12795 MscS_porin: Mechanosensitive ion channel porin domain | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF04094 DUF390: Protein of unknown function (DUF390); InterPro: IPR007228 This domain is found in a family of long proteins that are currently found only in rice | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >PF05262 Borrelia_P83: Borrelia P83/100 protein; InterPro: IPR007926 This family consists of several Borrelia P83/P100 antigen proteins | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif | Back alignment and domain information |
|---|
| >KOG4438 consensus Centromere-associated protein NUF2 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >PF14992 TMCO5: TMCO5 family | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >PF15294 Leu_zip: Leucine zipper | Back alignment and domain information |
|---|
| >KOG4687 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0240 consensus Kinesin (SMY1 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF07058 Myosin_HC-like: Myosin II heavy chain-like; InterPro: IPR009768 This family represents a conserved region within a number of myosin II heavy chain-like proteins that seem to be specific to Arabidopsis thaliana | Back alignment and domain information |
|---|
| >KOG0244 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >KOG2891 consensus Surface glycoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >PF09731 Mitofilin: Mitochondrial inner membrane protein; InterPro: IPR019133 Mitofilin controls mitochondrial cristae morphology | Back alignment and domain information |
|---|
| >PF12252 SidE: Dot/Icm substrate protein; InterPro: IPR021014 This entry represents bacterial proteins that are typically between 397 and 1543 amino acids in length including SidE protein in the Dot/Icm pathway of Legionella pneumophila bacteria | Back alignment and domain information |
|---|
| >KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2685 consensus Cystoskeletal protein Tektin [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11519 tyrosine kinase; Provisional | Back alignment and domain information |
|---|
| >PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA | Back alignment and domain information |
|---|
| >PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG2991 consensus Splicing regulator [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF15358 TSKS: Testis-specific serine kinase substrate | Back alignment and domain information |
|---|
| >PF05276 SH3BP5: SH3 domain-binding protein 5 (SH3BP5); InterPro: IPR007940 The SH3 domain-binding protein inhibits the auto and transphophorylation of BTK and acts as a negative regulator of BTK-related signalling in B cells | Back alignment and domain information |
|---|
| >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF03999 MAP65_ASE1: Microtubule associated protein (MAP65/ASE1 family); InterPro: IPR007145 This is a family of microtubule associated proteins | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF08580 KAR9: Yeast cortical protein KAR9; InterPro: IPR013889 The KAR9 protein in Saccharomyces cerevisiae (Baker's yeast) is a cytoskeletal protein required for karyogamy, correct positioning of the mitotic spindle and for orientation of cytoplasmic microtubules [] | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK06569 F0F1 ATP synthase subunit B'; Validated | Back alignment and domain information |
|---|
| >KOG1265 consensus Phospholipase C [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF12072 DUF3552: Domain of unknown function (DUF3552); InterPro: IPR022711 This presumed domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins | Back alignment and domain information |
|---|
| >PF02841 GBP_C: Guanylate-binding protein, C-terminal domain; InterPro: IPR003191 Guanylate-binding protein is a GTPase that is induced by interferon (IFN)-gamma | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >PF15272 BBP1_C: Spindle pole body component BBP1, C-terminal | Back alignment and domain information |
|---|
| >KOG2077 consensus JNK/SAPK-associated protein-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF06548 Kinesin-related: Kinesin-related; InterPro: IPR010544 This entry represents a domain within kinesin-related proteins from higher plants | Back alignment and domain information |
|---|
| >PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF09744 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; InterPro: IPR019143 This entry represents the N-terminal 200 residues of a set of proteins conserved from yeasts to humans | Back alignment and domain information |
|---|
| >PRK11519 tyrosine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4787 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >PF05262 Borrelia_P83: Borrelia P83/100 protein; InterPro: IPR007926 This family consists of several Borrelia P83/P100 antigen proteins | Back alignment and domain information |
|---|
| >PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >PF12240 Angiomotin_C: Angiomotin C terminal; InterPro: IPR024646 This domain represents the C-terminal region of angiomotin | Back alignment and domain information |
|---|
| >PF11802 CENP-K: Centromere-associated protein K; InterPro: IPR020993 Cenp-K is one of seven new Cenp-A-nucleosome distal (CAD) centromere components (the others being Cenp-L, Cenp-O, Cenp-P, Cenp-Q, Cenp-R and Cenp-S) that are identified as assembling on the Cenp-A nucleosome associated complex, NAC [] | Back alignment and domain information |
|---|
| >KOG1923 consensus Rac1 GTPase effector FRL [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4438 consensus Centromere-associated protein NUF2 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF02994 Transposase_22: L1 transposable element; InterPro: IPR004244 Many human L1 elements are capable of retrotransposition | Back alignment and domain information |
|---|
| >PF15272 BBP1_C: Spindle pole body component BBP1, C-terminal | Back alignment and domain information |
|---|
| >KOG2412 consensus Nuclear-export-signal (NES)-containing protein/polyadenylated-RNA export factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family | Back alignment and domain information |
|---|
| >PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans | Back alignment and domain information |
|---|
| >PF04949 Transcrip_act: Transcriptional activator; InterPro: IPR007033 Golgins are a family of coiled-coil proteins associated with the Golgi apparatus necessary for tethering events in membrane fusion and as structural supports for Golgi cisternae [] | Back alignment and domain information |
|---|
| >KOG0517 consensus Beta-spectrin [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd07651 F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Schizosaccharomyces pombe Cdc15, and similar proteins | Back alignment and domain information |
|---|
| >KOG0993 consensus Rab5 GTPase effector Rabaptin-5 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK14474 F0F1 ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >PF11180 DUF2968: Protein of unknown function (DUF2968); InterPro: IPR021350 This family of proteins has no known function | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >PF03915 AIP3: Actin interacting protein 3; InterPro: IPR022782 This entry represents a domain found in yeast actin interacting protein 3 and bud site selection protein 6 | Back alignment and domain information |
|---|
| >KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >PF04642 DUF601: Protein of unknown function, DUF601; InterPro: IPR006736 This family consists of several uncharacterised plant proteins which share a conserved region | Back alignment and domain information |
|---|
| >KOG4451 consensus Uncharacterized conserved protein (tumor-associated antigen HCA127 in humans) [Function unknown] | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family | Back alignment and domain information |
|---|
| >KOG4722 consensus Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF05816 TelA: Toxic anion resistance protein (TelA); InterPro: IPR008863 This family consists of several prokaryotic TelA like proteins | Back alignment and domain information |
|---|
| >KOG2077 consensus JNK/SAPK-associated protein-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF09731 Mitofilin: Mitochondrial inner membrane protein; InterPro: IPR019133 Mitofilin controls mitochondrial cristae morphology | Back alignment and domain information |
|---|
| >PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans | Back alignment and domain information |
|---|
| >PF04108 APG17: Autophagy protein Apg17 ; InterPro: IPR007240 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >COG5022 Myosin heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4364 consensus Chromatin assembly factor-I [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PRK06569 F0F1 ATP synthase subunit B'; Validated | Back alignment and domain information |
|---|
| >PF06548 Kinesin-related: Kinesin-related; InterPro: IPR010544 This entry represents a domain within kinesin-related proteins from higher plants | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >PRK09174 F0F1 ATP synthase subunit B'; Validated | Back alignment and domain information |
|---|
| >KOG1265 consensus Phospholipase C [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF09403 FadA: Adhesion protein FadA; InterPro: IPR018543 FadA (Fusobacterium adhesin A) is an adhesin which forms two alpha helices | Back alignment and domain information |
|---|
| >PF12240 Angiomotin_C: Angiomotin C terminal; InterPro: IPR024646 This domain represents the C-terminal region of angiomotin | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >PF11855 DUF3375: Protein of unknown function (DUF3375); InterPro: IPR021804 This family of proteins are functionally uncharacterised | Back alignment and domain information |
|---|
| >KOG3595 consensus Dyneins, heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures | Back alignment and domain information |
|---|
| >smart00502 BBC B-Box C-terminal domain | Back alignment and domain information |
|---|
| >PRK15178 Vi polysaccharide export inner membrane protein VexD; Provisional | Back alignment and domain information |
|---|
| >KOG2891 consensus Surface glycoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >PF15233 SYCE1: Synaptonemal complex central element protein 1 | Back alignment and domain information |
|---|
| >COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF09403 FadA: Adhesion protein FadA; InterPro: IPR018543 FadA (Fusobacterium adhesin A) is an adhesin which forms two alpha helices | Back alignment and domain information |
|---|
| >PRK06568 F0F1 ATP synthase subunit B; Validated | Back alignment and domain information |
|---|
| >PF05278 PEARLI-4: Arabidopsis phospholipase-like protein (PEARLI 4); InterPro: IPR007942 This family contains several phospholipase-like proteins from Arabidopsis thaliana and other members of the Streptophyta which are homologous to PEARLI 4 | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >CHL00118 atpG ATP synthase CF0 B' subunit; Validated | Back alignment and domain information |
|---|
| >PF05149 Flagellar_rod: Paraflagellar rod protein; InterPro: IPR007824 This family consists of several eukaryotic paraflagellar rod component proteins | Back alignment and domain information |
|---|
| >PF05276 SH3BP5: SH3 domain-binding protein 5 (SH3BP5); InterPro: IPR007940 The SH3 domain-binding protein inhibits the auto and transphophorylation of BTK and acts as a negative regulator of BTK-related signalling in B cells | Back alignment and domain information |
|---|
| >PTZ00332 paraflagellar rod protein; Provisional | Back alignment and domain information |
|---|
| >PRK08476 F0F1 ATP synthase subunit B'; Validated | Back alignment and domain information |
|---|
| >PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp | Back alignment and domain information |
|---|
| >KOG4552 consensus Vitamin-D-receptor interacting protein complex component [Transcription] | Back alignment and domain information |
|---|
| >COG4913 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG2751 consensus Beclin-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02338 gimC_beta prefoldin, beta subunit, archaeal | Back alignment and domain information |
|---|
| >COG5293 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF13863 DUF4200: Domain of unknown function (DUF4200) | Back alignment and domain information |
|---|
| >PRK14474 F0F1 ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >PF07058 Myosin_HC-like: Myosin II heavy chain-like; InterPro: IPR009768 This family represents a conserved region within a number of myosin II heavy chain-like proteins that seem to be specific to Arabidopsis thaliana | Back alignment and domain information |
|---|
| >KOG2751 consensus Beclin-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15178 Vi polysaccharide export inner membrane protein VexD; Provisional | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >PRK06975 bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF05278 PEARLI-4: Arabidopsis phospholipase-like protein (PEARLI 4); InterPro: IPR007942 This family contains several phospholipase-like proteins from Arabidopsis thaliana and other members of the Streptophyta which are homologous to PEARLI 4 | Back alignment and domain information |
|---|
| >PF13949 ALIX_LYPXL_bnd: ALIX V-shaped domain binding to HIV ; PDB: 2XS1_A 2XS8_A 2R03_A 2R02_A 2OEX_B 2OEV_A 2OJQ_A 2R05_A | Back alignment and domain information |
|---|
| >PRK05771 V-type ATP synthase subunit I; Validated | Back alignment and domain information |
|---|
| >PRK03947 prefoldin subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >cd00632 Prefoldin_beta Prefoldin beta; Prefoldin is a hexameric molecular chaperone complex, composed of two evolutionarily related subunits (alpha and beta), which are found in both eukaryotes and archaea | Back alignment and domain information |
|---|
| >PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer | Back alignment and domain information |
|---|
| >KOG3771 consensus Amphiphysin [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF11180 DUF2968: Protein of unknown function (DUF2968); InterPro: IPR021350 This family of proteins has no known function | Back alignment and domain information |
|---|
| >KOG3759 consensus Uncharacterized RUN domain protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4429 consensus Uncharacterized conserved protein, contains SH3 and FCH domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4687 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1118 consensus Lysophosphatidic acid acyltransferase endophilin/SH3GL, involved in synaptic vesicle formation [Lipid transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF09744 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; InterPro: IPR019143 This entry represents the N-terminal 200 residues of a set of proteins conserved from yeasts to humans | Back alignment and domain information |
|---|
| >PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp | Back alignment and domain information |
|---|
| >PRK13453 F0F1 ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >smart00502 BBC B-Box C-terminal domain | Back alignment and domain information |
|---|
| >cd07666 BAR_SNX7 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 7 | Back alignment and domain information |
|---|
| >PF13747 DUF4164: Domain of unknown function (DUF4164) | Back alignment and domain information |
|---|
| >PF06120 Phage_HK97_TLTM: Tail length tape measure protein; InterPro: IPR009302 This entry consists of the tail length tape measure protein from Bacteriophage HK97 and related sequences from Escherichia coli (strain K12) | Back alignment and domain information |
|---|
| >PRK13454 F0F1 ATP synthase subunit B'; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1701 | ||||
| 2f1z_A | 522 | Crystal Structure Of Hausp Length = 522 | 8e-07 | ||
| 2f1x_A | 161 | Crystal Structure Of The Traf-Like Domain Of HauspU | 9e-07 | ||
| 2f1y_A | 159 | Crystal Structure Of The Traf-Like Domain Of HauspU | 1e-06 | ||
| 2f1w_A | 158 | Crystal Structure Of The Traf-Like Domain Of HauspU | 2e-06 | ||
| 1yy6_A | 155 | The Crystal Strucure Of The N-Terminal Domain Of Ha | 2e-06 | ||
| 2xxn_A | 143 | Structure Of The Virf4-Hausp Traf Domain Complex Le | 3e-06 |
| >pdb|2F1Z|A Chain A, Crystal Structure Of Hausp Length = 522 | Back alignment and structure |
|
| >pdb|2F1X|A Chain A, Crystal Structure Of The Traf-Like Domain Of HauspUSP7 Bound To A P53 Peptide Length = 161 | Back alignment and structure |
| >pdb|2F1Y|A Chain A, Crystal Structure Of The Traf-Like Domain Of HauspUSP7 Bound To A Mdm2 Peptide Length = 159 | Back alignment and structure |
| >pdb|2F1W|A Chain A, Crystal Structure Of The Traf-Like Domain Of HauspUSP7 Length = 158 | Back alignment and structure |
| >pdb|1YY6|A Chain A, The Crystal Strucure Of The N-Terminal Domain Of HauspUSP7 Complexed With An Ebna1 Peptide Length = 155 | Back alignment and structure |
| >pdb|2XXN|A Chain A, Structure Of The Virf4-Hausp Traf Domain Complex Length = 143 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3s4w_B Protein FACD2, fanconi anemia group D2 protein homolog; DNA repair, DNA binding protein; 3.41A {Mus musculus} Length = 1323 | Back alignment and structure |
|---|
Score = 183 bits (464), Expect = 1e-46
Identities = 92/572 (16%), Positives = 188/572 (32%), Gaps = 72/572 (12%)
Query: 963 LESASFRSKTKWPEQSAELLGLIVNSLRALDGAVPQGCPEPRRRPQSAQKISLVLDKAPK 1022
E + LI+N L+ LD V ++ ++ AP
Sbjct: 120 FEKVPQFLFESENRDGINMARLIINQLKWLDRIVD--------GKDLTAQMMQLISVAPV 171
Query: 1023 HLQPDLVALVPKLVEHSEHPLAADALIERLQKSDAEPALRMPVFVALSQLDFGSEVWERI 1082
+LQ D + +P+++ S+H L E L + +L +P+ S L +I
Sbjct: 172 NLQHDFITSLPEILGDSQHANVGKELGELLVQ---NTSLTVPILDVFSSLRLDPNFLSKI 228
Query: 1083 LLKSLELLTDSNDEPLAVTIDFIFKAASQCQHLPEAVRSVRVRLKNLGAEVSPCVLDFLS 1142
+ L+ E V + F+ + + E + +R L N+ + P +
Sbjct: 229 RQLVMGKLSSVRLEDFPVIVKFLLHSVTD-TTSLEVIAELRENL-NVQQFILPSRIQASQ 286
Query: 1143 KTVNSWGDVAETILRDIDCDDDFGDNCSTMPSGLFLFGENGPTSDSLHVMDEQAFRATRH 1202
+ S G + + ++ D + S + ++ A
Sbjct: 287 SKLKSKGLASSSGNQENSDKDCIVLVFDVIKSAIRYEKTISEA--WFKAIERIESAAEHK 344
Query: 1203 FSDIYILIEMLSIPCIAVEAAQTFERAVARGTIVAQSIALVLERRLAQRLNFNPGFVAEN 1262
D+ +L+ + S + + L R Q +
Sbjct: 345 SLDVVMLLIIYSTSTQTKKGVEK------------------LLRNKIQSDCIQEQLLDSA 386
Query: 1263 FQHTDVVVEGEQLIVQRDDFTCVLGLAETLALSRDIRVREFVKILYTILLKWYPDESYRG 1322
F +V+ +D +L LA+TL S+D R+ F +LY K++ D +
Sbjct: 387 FSTHYLVL--------KDICPSILLLAQTLFHSQDQRIILFGSLLYKYAFKFF-DTYCQQ 437
Query: 1323 RMLKRLVDRATSTTESSRGVDLDLEILVILVCEEQEIIRPVLSMLREVAELANVDRAALW 1382
++ LV S TE+ VD L++L+ L+ +R + ++ + +
Sbjct: 438 EVVGALVTHVCSGTEAE--VDTALDVLLELIVLNASAMRLNAAFVKGILD---------- 485
Query: 1383 HQLCASEDEIIRIRDERKAEISNMVREKAVFSQKLAESEAAGNRLKSEMRAEMDRFAREK 1442
+ S +I +I + FSQ+ S + + +R ++ +
Sbjct: 486 YLENMSPQQIRKI---------FCILSTLAFSQQPGTSNHIQDDMHLVIRKQLSSTVFKY 536
Query: 1443 K--------ELSEQMREVESQLEWLRSERDDEIAKLTTEKKVLQDRLHDAETQLSQLKSR 1494
K ++ M E S + ++ T+ L +H S
Sbjct: 537 KLIGIIGAVTMAGIMAEDRSVPSNSSQRSANVSSEQRTQVTSLLQLVHSCTEHSPWASSL 596
Query: 1495 KRDELKRVVKEKNALAERLKS-AEAARKRFDE 1525
DE +++E+ + L+ + F +
Sbjct: 597 YYDEFANLIQERKLAPKTLEWVGQTIFNDFQD 628
|
| >3s4w_B Protein FACD2, fanconi anemia group D2 protein homolog; DNA repair, DNA binding protein; 3.41A {Mus musculus} Length = 1323 | Back alignment and structure |
|---|
| >2foj_A Ubiquitin carboxyl-terminal hydrolase 7; MATH domain, hydrolase; 1.60A {Homo sapiens} PDB: 1yze_A 1yy6_A 2foo_A 2fop_A 3mqr_A 3mqs_C 2f1w_A 2f1x_A 2f1y_A 2xxn_A Length = 155 | Back alignment and structure |
|---|
| >2foj_A Ubiquitin carboxyl-terminal hydrolase 7; MATH domain, hydrolase; 1.60A {Homo sapiens} PDB: 1yze_A 1yy6_A 2foo_A 2fop_A 3mqr_A 3mqs_C 2f1w_A 2f1x_A 2f1y_A 2xxn_A Length = 155 | Back alignment and structure |
|---|
| >2foj_A Ubiquitin carboxyl-terminal hydrolase 7; MATH domain, hydrolase; 1.60A {Homo sapiens} PDB: 1yze_A 1yy6_A 2foo_A 2fop_A 3mqr_A 3mqs_C 2f1w_A 2f1x_A 2f1y_A 2xxn_A Length = 155 | Back alignment and structure |
|---|
| >2foj_A Ubiquitin carboxyl-terminal hydrolase 7; MATH domain, hydrolase; 1.60A {Homo sapiens} PDB: 1yze_A 1yy6_A 2foo_A 2fop_A 3mqr_A 3mqs_C 2f1w_A 2f1x_A 2f1y_A 2xxn_A Length = 155 | Back alignment and structure |
|---|
| >3ivv_A Speckle-type POZ protein; protein binding, nucleus, UBL conjugation pathway, ligase; 1.25A {Homo sapiens} PDB: 3ivq_A 3ivb_A 3hsv_A 3hqh_A 3hqm_A 3hql_A 2cr2_A Length = 145 | Back alignment and structure |
|---|
| >3ivv_A Speckle-type POZ protein; protein binding, nucleus, UBL conjugation pathway, ligase; 1.25A {Homo sapiens} PDB: 3ivq_A 3ivb_A 3hsv_A 3hqh_A 3hqm_A 3hql_A 2cr2_A Length = 145 | Back alignment and structure |
|---|
| >3ivv_A Speckle-type POZ protein; protein binding, nucleus, UBL conjugation pathway, ligase; 1.25A {Homo sapiens} PDB: 3ivq_A 3ivb_A 3hsv_A 3hqh_A 3hqm_A 3hql_A 2cr2_A Length = 145 | Back alignment and structure |
|---|
| >3ivv_A Speckle-type POZ protein; protein binding, nucleus, UBL conjugation pathway, ligase; 1.25A {Homo sapiens} PDB: 3ivq_A 3ivb_A 3hsv_A 3hqh_A 3hqm_A 3hql_A 2cr2_A Length = 145 | Back alignment and structure |
|---|
| >1lb6_A TNF receptor-associated factor 6; TRAF6-CD40 complex, signaling protein; 1.80A {Homo sapiens} SCOP: b.8.1.1 PDB: 1lb5_A 1lb4_A Length = 160 | Back alignment and structure |
|---|
| >1lb6_A TNF receptor-associated factor 6; TRAF6-CD40 complex, signaling protein; 1.80A {Homo sapiens} SCOP: b.8.1.1 PDB: 1lb5_A 1lb4_A Length = 160 | Back alignment and structure |
|---|
| >1lb6_A TNF receptor-associated factor 6; TRAF6-CD40 complex, signaling protein; 1.80A {Homo sapiens} SCOP: b.8.1.1 PDB: 1lb5_A 1lb4_A Length = 160 | Back alignment and structure |
|---|
| >1lb6_A TNF receptor-associated factor 6; TRAF6-CD40 complex, signaling protein; 1.80A {Homo sapiens} SCOP: b.8.1.1 PDB: 1lb5_A 1lb4_A Length = 160 | Back alignment and structure |
|---|
| >2f1z_A Ubiquitin carboxyl-terminal hydrolase 7; hausp, USP7, UBP, deubiquitinating enzyme, substrate recognition; 3.20A {Homo sapiens} Length = 522 | Back alignment and structure |
|---|
| >2f1z_A Ubiquitin carboxyl-terminal hydrolase 7; hausp, USP7, UBP, deubiquitinating enzyme, substrate recognition; 3.20A {Homo sapiens} Length = 522 | Back alignment and structure |
|---|
| >2f1z_A Ubiquitin carboxyl-terminal hydrolase 7; hausp, USP7, UBP, deubiquitinating enzyme, substrate recognition; 3.20A {Homo sapiens} Length = 522 | Back alignment and structure |
|---|
| >2f1z_A Ubiquitin carboxyl-terminal hydrolase 7; hausp, USP7, UBP, deubiquitinating enzyme, substrate recognition; 3.20A {Homo sapiens} Length = 522 | Back alignment and structure |
|---|
| >1d00_A Tumor necrosis factor receptor associated protein 2; B-sandwich, protein-peptide complex, apoptosis; 2.00A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1ca4_A 1d0j_A 1f3v_B 1czy_A 1d01_A 1d0a_A Length = 168 | Back alignment and structure |
|---|
| >1d00_A Tumor necrosis factor receptor associated protein 2; B-sandwich, protein-peptide complex, apoptosis; 2.00A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1ca4_A 1d0j_A 1f3v_B 1czy_A 1d01_A 1d0a_A Length = 168 | Back alignment and structure |
|---|
| >1d00_A Tumor necrosis factor receptor associated protein 2; B-sandwich, protein-peptide complex, apoptosis; 2.00A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1ca4_A 1d0j_A 1f3v_B 1czy_A 1d01_A 1d0a_A Length = 168 | Back alignment and structure |
|---|
| >1d00_A Tumor necrosis factor receptor associated protein 2; B-sandwich, protein-peptide complex, apoptosis; 2.00A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1ca4_A 1d0j_A 1f3v_B 1czy_A 1d01_A 1d0a_A Length = 168 | Back alignment and structure |
|---|
| >1ca9_A TRAF2, protein (TNF receptor associated factor 2); TNF signaling, TRAF, adapter protein, cell surviVal; 2.30A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1qsc_A 1czz_A Length = 192 | Back alignment and structure |
|---|
| >1ca9_A TRAF2, protein (TNF receptor associated factor 2); TNF signaling, TRAF, adapter protein, cell surviVal; 2.30A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1qsc_A 1czz_A Length = 192 | Back alignment and structure |
|---|
| >1ca9_A TRAF2, protein (TNF receptor associated factor 2); TNF signaling, TRAF, adapter protein, cell surviVal; 2.30A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1qsc_A 1czz_A Length = 192 | Back alignment and structure |
|---|
| >1ca9_A TRAF2, protein (TNF receptor associated factor 2); TNF signaling, TRAF, adapter protein, cell surviVal; 2.30A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1qsc_A 1czz_A Length = 192 | Back alignment and structure |
|---|
| >2gkw_A TNF receptor-associated factor 3; CD40, NF-KB signaling, BAFF receptor, TRAF3, apoptosis; 2.70A {Homo sapiens} PDB: 1kzz_A 1l0a_A 1zms_A 1rf3_A Length = 192 | Back alignment and structure |
|---|
| >2gkw_A TNF receptor-associated factor 3; CD40, NF-KB signaling, BAFF receptor, TRAF3, apoptosis; 2.70A {Homo sapiens} PDB: 1kzz_A 1l0a_A 1zms_A 1rf3_A Length = 192 | Back alignment and structure |
|---|
| >2gkw_A TNF receptor-associated factor 3; CD40, NF-KB signaling, BAFF receptor, TRAF3, apoptosis; 2.70A {Homo sapiens} PDB: 1kzz_A 1l0a_A 1zms_A 1rf3_A Length = 192 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1flk_A TNF receptor associated factor 3; TNF signaling, TRAF3, CD40-binding protein, apoptosis; 2.80A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1fll_A Length = 228 | Back alignment and structure |
|---|
| >1flk_A TNF receptor associated factor 3; TNF signaling, TRAF3, CD40-binding protein, apoptosis; 2.80A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1fll_A Length = 228 | Back alignment and structure |
|---|
| >1flk_A TNF receptor associated factor 3; TNF signaling, TRAF3, CD40-binding protein, apoptosis; 2.80A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1fll_A Length = 228 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 | Back alignment and structure |
|---|
| >3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 | Back alignment and structure |
|---|
| >3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 | Back alignment and structure |
|---|
| >3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Length = 256 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Length = 155 | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Length = 155 | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Length = 155 | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Length = 189 | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Length = 189 | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Length = 168 | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Length = 168 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704 | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Length = 129 | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Length = 129 | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Length = 129 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >4f61_I Stathmin-like domain R4; alpha-tubulin, beta-tubulin, GTPase, microtubule, RB3, stath tubulin, cell cycle; HET: GTP GDP; 4.17A {Artificial gene} Length = 240 | Back alignment and structure |
|---|
| >2xnx_M M protein, M1-BC1; cell adhesion, virulence factor, streptococcal toxic shock S; 3.30A {Streptococcus pyogenes} Length = 146 | Back alignment and structure |
|---|
| >3iyk_A VP5; icosahedral virus; HET: MNA; 7.00A {Bluetongue virus} Length = 526 | Back alignment and structure |
|---|
| >3l4q_C Phosphatidylinositol 3-kinase regulatory subunit beta; PI3K, phosphoinositide-3-kinase, influenza virus, NS1; 2.30A {Bos taurus} PDB: 2v1y_B Length = 170 | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 Length = 147 | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 | Back alignment and structure |
|---|
| >4emc_A Monopolin complex subunit CSM1; RWD domain, kinetochore-binding, kinetoch replication-replication complex; 3.05A {Saccharomyces cerevisiae} PDB: 3n7n_A 3n4x_A Length = 190 | Back alignment and structure |
|---|
| >2a01_A Apolipoprotein A-I; four-helix bundle, lipid transport; HET: AC9; 2.40A {Homo sapiens} PDB: 3k2s_A* 1av1_A 3j00_0* Length = 243 | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Length = 154 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1701 | ||||
| d2cr2a1 | 146 | b.8.1.1 (A:8-153) Speckle-type poz protein SPOP {H | 6e-26 | |
| d2cr2a1 | 146 | b.8.1.1 (A:8-153) Speckle-type poz protein SPOP {H | 5e-23 | |
| d2cr2a1 | 146 | b.8.1.1 (A:8-153) Speckle-type poz protein SPOP {H | 2e-22 | |
| d2cr2a1 | 146 | b.8.1.1 (A:8-153) Speckle-type poz protein SPOP {H | 5e-15 | |
| d1czya1 | 152 | b.8.1.1 (A:350-501) TNF receptor associated factor | 7e-24 | |
| d1czya1 | 152 | b.8.1.1 (A:350-501) TNF receptor associated factor | 2e-19 | |
| d1czya1 | 152 | b.8.1.1 (A:350-501) TNF receptor associated factor | 8e-17 | |
| d1czya1 | 152 | b.8.1.1 (A:350-501) TNF receptor associated factor | 8e-11 | |
| d1lb6a_ | 155 | b.8.1.1 (A:) TNF receptor associated factor 6 (TRA | 1e-22 | |
| d1lb6a_ | 155 | b.8.1.1 (A:) TNF receptor associated factor 6 (TRA | 1e-18 | |
| d1lb6a_ | 155 | b.8.1.1 (A:) TNF receptor associated factor 6 (TRA | 9e-16 | |
| d1lb6a_ | 155 | b.8.1.1 (A:) TNF receptor associated factor 6 (TRA | 5e-12 | |
| d1l0aa1 | 155 | b.8.1.1 (A:350-504) TNF receptor associated factor | 1e-22 | |
| d1l0aa1 | 155 | b.8.1.1 (A:350-504) TNF receptor associated factor | 9e-17 | |
| d1l0aa1 | 155 | b.8.1.1 (A:350-504) TNF receptor associated factor | 2e-16 | |
| d1l0aa1 | 155 | b.8.1.1 (A:350-504) TNF receptor associated factor | 8e-08 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 5e-07 | |
| d2es4d1 | 280 | a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) | 5e-05 | |
| d2es4d1 | 280 | a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) | 9e-05 |
| >d2cr2a1 b.8.1.1 (A:8-153) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]} Length = 146 | Back information, alignment and structure |
|---|
class: All beta proteins fold: TRAF domain-like superfamily: TRAF domain-like family: MATH domain domain: Speckle-type poz protein SPOP species: Human (Homo sapiens) [TaxId: 9606]
Score = 102 bits (256), Expect = 6e-26
Identities = 35/147 (23%), Positives = 63/147 (42%), Gaps = 14/147 (9%)
Query: 426 GKFTWRIENFTRLKDLLKKRKITGLCIKSRRFQIGNRD---CRLIVYPRGQSQ-PPCHLS 481
+ W I NF+ + + G IKS F G D L V P+G + +LS
Sbjct: 5 FSYMWTINNFSFCR------EEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLS 58
Query: 482 VFLEVMDSRNTSSDWSCFVSHRLSVVNQKMEEKSVTKESQNRYSKAAKDWGWREFVTLTS 541
++L ++ + S++N K EE + + KDWG+++F+
Sbjct: 59 LYLLLVSCPK----SEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDF 114
Query: 542 LFDQDSGFLVQDTVVFSAEVLILKETS 568
L D+ +G L D + EV +++++
Sbjct: 115 LLDEANGLLPDDKLTLFCEVSVVQDSV 141
|
| >d2cr2a1 b.8.1.1 (A:8-153) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]} Length = 146 | Back information, alignment and structure |
|---|
| >d2cr2a1 b.8.1.1 (A:8-153) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]} Length = 146 | Back information, alignment and structure |
|---|
| >d2cr2a1 b.8.1.1 (A:8-153) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]} Length = 146 | Back information, alignment and structure |
|---|
| >d1czya1 b.8.1.1 (A:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens) [TaxId: 9606]} Length = 152 | Back information, alignment and structure |
|---|
| >d1czya1 b.8.1.1 (A:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens) [TaxId: 9606]} Length = 152 | Back information, alignment and structure |
|---|
| >d1czya1 b.8.1.1 (A:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens) [TaxId: 9606]} Length = 152 | Back information, alignment and structure |
|---|
| >d1czya1 b.8.1.1 (A:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens) [TaxId: 9606]} Length = 152 | Back information, alignment and structure |
|---|
| >d1lb6a_ b.8.1.1 (A:) TNF receptor associated factor 6 (TRAF6) {Human (Homo sapiens) [TaxId: 9606]} Length = 155 | Back information, alignment and structure |
|---|
| >d1lb6a_ b.8.1.1 (A:) TNF receptor associated factor 6 (TRAF6) {Human (Homo sapiens) [TaxId: 9606]} Length = 155 | Back information, alignment and structure |
|---|
| >d1lb6a_ b.8.1.1 (A:) TNF receptor associated factor 6 (TRAF6) {Human (Homo sapiens) [TaxId: 9606]} Length = 155 | Back information, alignment and structure |
|---|
| >d1lb6a_ b.8.1.1 (A:) TNF receptor associated factor 6 (TRAF6) {Human (Homo sapiens) [TaxId: 9606]} Length = 155 | Back information, alignment and structure |
|---|
| >d1l0aa1 b.8.1.1 (A:350-504) TNF receptor associated factor 3 (TRAF3) {Human (Homo sapiens) [TaxId: 9606]} Length = 155 | Back information, alignment and structure |
|---|
| >d1l0aa1 b.8.1.1 (A:350-504) TNF receptor associated factor 3 (TRAF3) {Human (Homo sapiens) [TaxId: 9606]} Length = 155 | Back information, alignment and structure |
|---|
| >d1l0aa1 b.8.1.1 (A:350-504) TNF receptor associated factor 3 (TRAF3) {Human (Homo sapiens) [TaxId: 9606]} Length = 155 | Back information, alignment and structure |
|---|
| >d1l0aa1 b.8.1.1 (A:350-504) TNF receptor associated factor 3 (TRAF3) {Human (Homo sapiens) [TaxId: 9606]} Length = 155 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1701 | |||
| d1czya1 | 152 | TNF receptor associated factor 2 (TRAF2) {Human (H | 99.84 | |
| d1lb6a_ | 155 | TNF receptor associated factor 6 (TRAF6) {Human (H | 99.83 | |
| d1czya1 | 152 | TNF receptor associated factor 2 (TRAF2) {Human (H | 99.83 | |
| d2cr2a1 | 146 | Speckle-type poz protein SPOP {Human (Homo sapiens | 99.83 | |
| d1l0aa1 | 155 | TNF receptor associated factor 3 (TRAF3) {Human (H | 99.82 | |
| d1l0aa1 | 155 | TNF receptor associated factor 3 (TRAF3) {Human (H | 99.82 | |
| d2cr2a1 | 146 | Speckle-type poz protein SPOP {Human (Homo sapiens | 99.82 | |
| d1lb6a_ | 155 | TNF receptor associated factor 6 (TRAF6) {Human (H | 99.8 |
| >d1czya1 b.8.1.1 (A:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: TRAF domain-like superfamily: TRAF domain-like family: MATH domain domain: TNF receptor associated factor 2 (TRAF2) species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.84 E-value=4.8e-21 Score=177.65 Aligned_cols=137 Identities=14% Similarity=0.237 Sum_probs=82.0
Q ss_pred CCEEEEEECCCCCCCCCC---CCCCCCCCCCCCC--CCEEEEEEEECCCC--CCCCEEEEEEECCCCCCCCCCCCEEEEE
Q ss_conf 768999992632220112---5571128942148--84189999966878--8654578999426775556898189999
Q 000301 258 SGKFTWKVHNFSLFKEMI---KTQKIMSPVFPAG--ECNLRISVYQSSVN--GQEYLSMCLESKDMEKTVVSDRSCWCLF 330 (1701)
Q Consensus 258 ~g~ftwkI~nFS~l~e~~---k~~~i~S~~F~vg--G~~WrI~vYPnG~~--~~~yLSiyL~l~~~e~~~~~~w~~~~~f 330 (1701)
+|+|+|+|.|||.+++.. ++..++||.|++| ||+|+|.+||+|.+ ..+|+|+||++.+++++....|++++.|
T Consensus 2 ~g~f~W~I~nFs~l~~~~~~~~~~~~~Sp~F~~g~~Gy~w~l~~yP~G~~~~~~~~lSlyL~l~~~~~d~~~~~~~~~~~ 81 (152)
T d1czya1 2 DGVFIWKISDFPRKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKV 81 (152)
T ss_dssp SSEEEEEECSHHHHHHHHHTTSCCCEECCCEESSTTSCEEEEEEETTCCGGGTTTEEEEEEEEECCTTGGGSCSSCCCCE
T ss_pred CCEEEEEECCCHHHHHHHHCCCCCEEECCCEECCCCCEEEEEEEEECCCCCCCCCEEEEEEEECCCCCCCCCCCCEEEEE
T ss_conf 97899999992898776542798568891988089982999999818999889988999999726776766665366678
Q ss_pred EEEEEECCCCCCCEEE----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEE
Q ss_conf 9999718999985232----24234457888998775582332232122448887435881799989999
Q 000301 331 RMSVLNQSPGSNHMHR----DSYGRFAADNKSGDNTSLGWNDYMKMADFVGHDSGFLVDDTAVFSTSFHV 396 (1701)
Q Consensus 331 tl~LLnQ~~g~~~~~k----~~~~rF~~~~~~~~n~~~G~~~FI~~sdL~d~~~GYLvdDSliIev~V~V 396 (1701)
+|+|+||......... .....|+++. ...+.+|||.+||++++|. +++|||+||+|+|+|+|.|
T Consensus 82 ~~~l~d~~~~~~~~~~~~~~~~~~~~~r~~-~~~~~~~G~~~fi~~~~L~-~~~gfl~dD~l~I~~~V~v 149 (152)
T d1czya1 82 TLMLLDQNNREHVIDAFRPDVTSSSFQRPV-NDMNIASGCPLFCPVSKME-AKNSYVRDDAIFIKAIVDL 149 (152)
T ss_dssp EEEECCTTSSCCEEEEECCCTTSGGGSCCS-SSBCCCEEEEEEEETCCCC-CSTTTSCSSCEEEEEEECC
T ss_pred EEEEECCCCCCCCEEEECCCCCCCCCCCCC-CCCCCCCCHHHEEEHHHHC-CCCCCEECCEEEEEEEEEE
T ss_conf 999974788854215512563422436777-5543662245588999944-1489484999999999993
|
| >d1lb6a_ b.8.1.1 (A:) TNF receptor associated factor 6 (TRAF6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1czya1 b.8.1.1 (A:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cr2a1 b.8.1.1 (A:8-153) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l0aa1 b.8.1.1 (A:350-504) TNF receptor associated factor 3 (TRAF3) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l0aa1 b.8.1.1 (A:350-504) TNF receptor associated factor 3 (TRAF3) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cr2a1 b.8.1.1 (A:8-153) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lb6a_ b.8.1.1 (A:) TNF receptor associated factor 6 (TRAF6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|