Citrus Sinensis ID: 000302
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1698 | 2.2.26 [Sep-21-2011] | |||||||
| Q9T048 | 985 | Disease resistance protei | yes | no | 0.405 | 0.699 | 0.287 | 4e-60 | |
| Q42484 | 909 | Disease resistance protei | no | no | 0.474 | 0.886 | 0.255 | 6e-58 | |
| O81825 | 919 | Probable disease resistan | no | no | 0.447 | 0.826 | 0.276 | 8e-49 | |
| Q940K0 | 889 | Probable disease resistan | no | no | 0.319 | 0.609 | 0.280 | 2e-43 | |
| O82484 | 892 | Putative disease resistan | no | no | 0.333 | 0.635 | 0.262 | 1e-42 | |
| Q8RXS5 | 888 | Probable disease resistan | no | no | 0.332 | 0.636 | 0.250 | 3e-42 | |
| O64789 | 925 | Probable disease resistan | no | no | 0.433 | 0.795 | 0.264 | 2e-40 | |
| Q9C8T9 | 898 | Putative disease resistan | no | no | 0.356 | 0.673 | 0.256 | 2e-39 | |
| O64973 | 889 | Disease resistance protei | no | no | 0.339 | 0.649 | 0.267 | 1e-38 | |
| O22727 | 967 | Probable disease resistan | no | no | 0.316 | 0.555 | 0.261 | 3e-38 |
| >sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 234 bits (597), Expect = 4e-60, Method: Compositional matrix adjust.
Identities = 222/772 (28%), Positives = 373/772 (48%), Gaps = 83/772 (10%)
Query: 138 VSFRPTVERTTPVSYTAYEQFDSRMKIFQNIMEVLKDTNVGMIGVYGVNGVGKTTLVKQI 197
+S T ER V + + I + L IGV+G+ GVGKTTLV+ +
Sbjct: 125 LSVESTPERVEHVPGVSVVHQTMASNMLAKIRDGLTSEKAQKIGVWGMGGVGKTTLVRTL 184
Query: 198 AMQVIED---KLFDKVVFV--------------------------ERAEKLRQR----LK 224
++ E+ + F V+FV E EKL +R L
Sbjct: 185 NNKLREEGATQPFGLVIFVIVSKEFDPREVQKQIAERLDIDTQMEESEEKLARRIYVGLM 244
Query: 225 NVKRVLVILDNIWKLLNLDAVGIPFGDVKKERNDDRSRCTVLLTSRNRDVLCNDMNSQKF 284
++ L+ILD++WK ++LD +GIP R ++ V+LTSR +V C M +
Sbjct: 245 KERKFLLILDDVWKPIDLDLLGIP-------RTEENKGSKVILTSRFLEV-CRSMKTDLD 296
Query: 285 FLIEVLSYEEAWCLFEKIVGDSAKASDFRVIADEIVRRCGGLPVAIKTIANALKNKR-LY 343
++ L E+AW LF K GD ++ R IA + + CGGLP+AI T+ A++ K+ +
Sbjct: 297 VRVDCLLEEDAWELFCKNAGDVVRSDHVRKIAKAVSQECGGLPLAIITVGTAMRGKKNVK 356
Query: 344 VWNDSLERLRNSTSRQIHGMEENVYSSIELSYSFLKSEEEKSMFRLCALRKDGSPIPIDD 403
+WN L +L S I +EE ++ ++LSY FL+ ++ K F LCAL + I + +
Sbjct: 357 LWNHVLSKLSKSVP-WIKSIEEKIFQPLKLSYDFLE-DKAKFCFLLCALFPEDYSIEVTE 414
Query: 404 LMRYGIGLGLFSNVRTSEAARNRVYTLVDNLKASSLLLDGD-KDEVKLHDIIYAVAVSI- 461
++RY + G + + E + N T V++LK LL DGD +D VK+HD++ A+ I
Sbjct: 415 VVRYWMAEGFMEELGSQEDSMNEGITTVESLKDYCLLEDGDRRDTVKMHDVVRDFAIWIM 474
Query: 462 --ARDEFMFNIQSKDELKDKTQKDSIA-----ISLPNRDIDELPERLE--CPKLSLFLLF 512
++D+ + S L+D ++D +A +SL N ++ LP+ +E C K S+ LL
Sbjct: 475 SSSQDDSHSLVMSGTGLQD-IRQDKLAPSLRRVSLMNNKLESLPDLVEEFCVKTSVLLLQ 533
Query: 513 AKYDSSLKIPDLFFEGMNELRVVHFTRTCFLSLPS-SLVCLISLRTLSLEGC-QVGDVAI 570
+ ++P F + LR+++ + T S PS SL+ L SL +L L C ++ +
Sbjct: 534 GNFLLK-EVPIGFLQAFPTLRILNLSGTRIKSFPSCSLLRLFSLHSLFLRDCFKLVKLPS 592
Query: 571 VGQLKKLEILSFRNSDIQQLPREIGQLVQLRLLDLRNCRRLQAIAPNVISKLSRLEELYM 630
+ L KLE+L + I + PR + +L + R LDL L++I V+S+LS LE L M
Sbjct: 593 LETLAKLELLDLCGTHILEFPRGLEELKRFRHLDLSRTLHLESIPARVVSRLSSLETLDM 652
Query: 631 GDSFSQWEKVEGGS---NASLVELKGLSKLTTLEIHIRDARIM--PQDLISMKLEIFRMF 685
S +W V+G + A++ E+ L +L L I + + + ++ +L+ F++
Sbjct: 653 TSSHYRW-SVQGETQKGQATVEEIGCLQRLQVLSIRLHSSPFLLNKRNTWIKRLKKFQLV 711
Query: 686 IGNVVDWYHKFERSRLVKLDKLEKNILLGQGMKMFLKRTEDLYLHDLKGFQNVVHEL-DD 744
+G+ + ++ RL + +G L T L L+ +G + ++ +L D
Sbjct: 712 VGSRYILRTRHDKRRLTISHLNVSQVSIG----WLLAYTTSLALNHCQGIEAMMKKLVSD 767
Query: 745 GEVFSELKHLHVEHSYEILHIVSSIGQVCCK----------VFPLLESLSLCRLFNLEKI 794
+ F LK L +E+ I++ S + V + P LE L L R+ +LE
Sbjct: 768 NKGFKNLKSLTIENV--IINTNSWVEMVSTNTSKQSSDILDLLPNLEELHLRRV-DLETF 824
Query: 795 CHNRLHEDESFSNLRIIKVGECDKLRHLFSFSMAKNLLRLQKISVFDCKSLE 846
+ H L+II++ C KLR L + L++I + C SL+
Sbjct: 825 SELQTHLGLKLETLKIIEITMCRKLRTLLDKRNFLTIPNLEEIEISYCDSLQ 876
|
Disease resistance protein. Arabidopsis thaliana (taxid: 3702) |
| >sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q940K0|DRL15_ARATH Probable disease resistance protein At1g61180 OS=Arabidopsis thaliana GN=At1g61180 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|O82484|DRL23_ARATH Putative disease resistance protein At4g10780 OS=Arabidopsis thaliana GN=At4g10780 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|O64789|DRL18_ARATH Probable disease resistance protein At1g61310 OS=Arabidopsis thaliana GN=At1g61310 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9C8T9|DRL19_ARATH Putative disease resistance protein At1g63350 OS=Arabidopsis thaliana GN=At1g63350 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O64973|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|O22727|DRL16_ARATH Probable disease resistance protein At1g61190 OS=Arabidopsis thaliana GN=At1g61190 PE=3 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1698 | ||||||
| 359488025 | 1781 | PREDICTED: uncharacterized protein LOC10 | 0.879 | 0.838 | 0.348 | 0.0 | |
| 147865073 | 1694 | hypothetical protein VITISV_021876 [Viti | 0.872 | 0.874 | 0.347 | 0.0 | |
| 255542484 | 2460 | phosphoprotein phosphatase, putative [Ri | 0.871 | 0.601 | 0.337 | 0.0 | |
| 224111296 | 1315 | cc-nbs-lrr resistance protein [Populus t | 0.700 | 0.904 | 0.394 | 0.0 | |
| 296087869 | 1711 | unnamed protein product [Vitis vinifera] | 0.845 | 0.839 | 0.334 | 0.0 | |
| 255563252 | 1603 | Disease resistance protein RPS5, putativ | 0.699 | 0.741 | 0.392 | 0.0 | |
| 359488103 | 1530 | PREDICTED: disease resistance protein At | 0.770 | 0.855 | 0.347 | 0.0 | |
| 359488101 | 1677 | PREDICTED: disease resistance protein At | 0.868 | 0.879 | 0.327 | 0.0 | |
| 359488027 | 1520 | PREDICTED: disease resistance protein At | 0.779 | 0.871 | 0.351 | 0.0 | |
| 224111284 | 1340 | cc-nbs-lrr resistance protein [Populus t | 0.716 | 0.907 | 0.387 | 0.0 |
| >gi|359488025|ref|XP_003633688.1| PREDICTED: uncharacterized protein LOC100852821 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 829 bits (2142), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 605/1735 (34%), Positives = 913/1735 (52%), Gaps = 241/1735 (13%)
Query: 7 VVSGFASKFAEVILGPIRREISYVFNYQSNVEELRTLDKELAYKREMVEQPVIQARRQGD 66
+V A+K +E ++GP+ R++ Y+FNY++N+E+L ++L R ++ V +A R G
Sbjct: 4 IVVSVAAKVSEYLVGPVVRQLGYLFNYRTNIEDLSQKVEKLRGARARLQHSVDEAIRNGH 63
Query: 67 EIYKRVEDWLNNVDDFTEDVVKSITGGEDEAKKRCFKGLCPNLIKRYSLGKKAVKAAKEG 126
+I V W+ D F + K + ++EA+K CF GLCPNL RY L ++A K A
Sbjct: 64 KIEDDVCKWMTRADGFIQKDCKFLE--DEEARKSCFNGLCPNLKSRYQLSREARKKAGVA 121
Query: 127 ADLLGTGNFGTVSFRPTVE--RTTPVSYTAYEQFDSRMKIFQNIMEVLKDTNVGMIGVYG 184
++ G F S+R ++ R+ P E +SRM +M+ L+D + IGV+G
Sbjct: 122 VEIHEAGQFERASYRAPLQEIRSAP-----SEALESRMLTLNEVMKALRDAKINKIGVWG 176
Query: 185 VNGVGKTTLVKQIAMQVIEDKLFDKVVFVE-----------------------------R 215
+ GVGKTTLVKQ+A Q ++KLFDKVV R
Sbjct: 177 LGGVGKTTLVKQVAEQAAQEKLFDKVVTAAVLETPDLKKIQGELADLLGMKFEEESEQGR 236
Query: 216 AEKLRQRLKNVKRVLVILDNIWKLLNLDAVGIPFGDVKKERNDDRSRCTVLLTSRNRDVL 275
A +L QR+ K +L+ILD+IW L+L+ +GIP D K C ++LTSRN +L
Sbjct: 237 AARLYQRMNEEKTILIILDDIWAKLDLEKIGIPSPDHHK-------GCKLVLTSRNEHIL 289
Query: 276 CNDMNSQKFFLIEVLSYEEAWCLFEKIVGDSAKASDFRVIADEIVRRCGGLPVAIKTIAN 335
N+M++QK F ++ L +E W LF+ G S + + + IA ++ + C GLP+A+ T+A
Sbjct: 290 SNEMDTQKDFRVQPLQEDETWILFKNTAG-SIENPELQPIAVDVAKECAGLPLAVVTVAT 348
Query: 336 ALKN-KRLYVWNDSLERLRNSTSRQIHGMEENVYSSIELSYSFLKSEEEKSMFRLCALRK 394
ALK K + +W D+ +L++ TS + G+ NVYSS++LSY LK E KS F LC L
Sbjct: 349 ALKGEKSVSIWEDARLQLKSQTSTNVTGLTTNVYSSLKLSYEHLKGVEVKSFFLLCGLIS 408
Query: 395 DGSPIPIDDLMRYGIGLGLFSNVRTSEAARNRVYTLVDNLKASSLLLD-GDKDEVKLHDI 453
I I DL++YG+GL LF T E A+NR+ TLV NLK+S+LLL+ G V++HD+
Sbjct: 409 QND-IHIWDLLKYGVGLRLFQGTNTLEEAKNRIDTLVGNLKSSNLLLETGHNAVVRMHDL 467
Query: 454 IYAVAVSIARDEF-MFNIQSK----------DELKDKTQKDSIAISLPNRDIDELPERLE 502
+ + A IA D+ +F +Q+ DEL+ T +SL + DI ELPE L
Sbjct: 468 VRSTARKIASDQHHVFTLQNTTVRVEGWPRIDELQKVTW-----VSLHDCDIHELPEGLV 522
Query: 503 CPKLSLFLLF-AKYDSSLKIPDLFFEGMNELRVVHFTRTCFLSLPSSLVCLISLRTLSLE 561
CPKL LF + +S+++IP+ FFE M +L+V+ +R SLP SL CL +LRTL L+
Sbjct: 523 CPKLELFGCYDVNTNSAVQIPNKFFEEMKQLKVLDLSRMQLPSLPLSLHCLTNLRTLCLD 582
Query: 562 GCQVGDVAIVGQLKKLEILSFRNSDIQQLPREIGQLVQLRLLDLRNCRRLQAIAPNVISK 621
GC+VGD+ I+ +LKKLEILS ++SD++QLPREI QL LRLLDL +L+ I +VIS
Sbjct: 583 GCKVGDIVIIAKLKKLEILSLKDSDMEQLPREIAQLTHLRLLDLSGSSKLKVIPSDVISS 642
Query: 622 LSRLEELYMGDSFSQWEKVEGGSNASLVELKGLSKLTTLEIHIRDARIMPQDLISMKLEI 681
LS+LE L M +SF+QWE E SNA L ELK LS LT+L+I IRDA+++P+D++ L
Sbjct: 643 LSQLENLCMANSFTQWEG-EAKSNACLAELKHLSHLTSLDIQIRDAKLLPKDIVFDNLVR 701
Query: 682 FRMFIGNVVDWYHKFERSRLVKLDKLEKNILLGQGMKMFLKRTEDLYLHDLKGFQNVVHE 741
+R+F+G+V W FE ++ +KL+K + ++ L G+ LKRTEDL+L +L G NV+ +
Sbjct: 702 YRIFVGDVWRWRENFETNKTLKLNKFDTSLHLVHGIIKLLKRTEDLHLRELCGGTNVLSK 761
Query: 742 LDDGEVFSELKHLHVEHSYEILHIVSSIGQVCCK-VFPLLESLSLCRLFNLEKICHNRLH 800
LD GE F +LKHL+VE S EI +IV+S+ FP++E+LSL +L NL+++C +
Sbjct: 762 LD-GEGFLKLKHLNVESSPEIQYIVNSMDLTPSHGAFPVMETLSLNQLINLQEVCRGQFP 820
Query: 801 EDESFSNLRIIKVGECDKLRHLFSFSMAKNLLRLQKISVFDCKSL------------EII 848
SF LR ++V +C+ L+ LFS S+A+ L RL++I V C+S+ E
Sbjct: 821 AG-SFGYLRKVEVKDCNGLKCLFSLSVARGLSRLEEIKVTRCESMVEMVSQGRKEIKEAA 879
Query: 849 VGLDMEKQRTTLGF-------------NGITTKDDPDEKVIFPSLEELDLYSLITIEKLW 895
V + + + +L N + +K P ++ PS L+ + + L
Sbjct: 880 VNVPLFPELRSLTLEDLPKLSNFCFEENPVLSK--PPSTIVGPSTPPLNQPEIRDGQLL- 936
Query: 896 PKQFQGMSSCQNLTKVTVAFCDRLKYLFSYSMVNSLVQLQHLEICYCWSMEGVVETNSTE 955
+S NL + + C L LF S+ L L+ L + C +E V + E
Sbjct: 937 ------LSLGGNLRSLELKNCMSLLKLFPPSL---LQNLEELRVENCGQLEHVFDLE--E 985
Query: 956 SRRDEGRLIEIVFPKLLYLRLIDLPKLMGF---------------SIGIHSVEFPSLLEL 1000
D+G +E++ PKL L L LPKL S + ++ FP L ++
Sbjct: 986 LNVDDGH-VELL-PKLKELMLSGLPKLRHICNCDSSRNHFPSSMASAPVGNIIFPKLSDI 1043
Query: 1001 QIDDCPNMKRFIS--ISSSQDNIHAN---PQP-LFDEKVGTPNLMTLRVSYCHNIEEIIR 1054
++ PN+ F+S S Q HA+ P P LFDEK +L V C ++E +
Sbjct: 1044 TLESLPNLTSFVSPGYHSLQRLHHADLDTPFPVLFDEK-------SLVVENCSSLEAVFD 1096
Query: 1055 HVGEDVKENRITFNQLKNLELDDLPSLTSFCLGNCTLEFPSLERVFVRNCRNMKTFSEGV 1114
G +V + L+ L +DD +E P L + + + N+ +F
Sbjct: 1097 VEGTNVNVD------LEELNVDD-----------GHVELPKLFHISLESLPNLTSF---- 1135
Query: 1115 VCAPKLKKVQVTKKEQEEDEWCSCWEGNLNSTIQKLF--VVGFHDIKDLKLSQFPHLKEI 1172
+P +Q +L++ LF V F + L +S ++K+I
Sbjct: 1136 -VSPGYHSLQ------------RLHHADLDTPFPVLFDERVAFPSLNFLTISGLDNVKKI 1182
Query: 1173 WHGQALNVSIFSNLRSLGVDNCTNMSSAIPANLLRCLNNLERLKVRNCDSLEEVFH---- 1228
W Q S FS L + + +C + + P++LL+ L +LERL V +C SLE VF
Sbjct: 1183 WPNQIPQDS-FSKLEKVTISSCGQLLNIFPSSLLKRLQSLERLFVDDCSSLEAVFDVEGT 1241
Query: 1229 -----LEDVNADEHFGPLFPKLYELELIDLPKLKRFCNFK---------------WNIIE 1268
LE++N D+ L PKL EL LIDLPKL+ CN NII
Sbjct: 1242 NVNVDLEELNVDDGHVELLPKLKELMLIDLPKLRHICNCGSSRNHFPSSMASAPVGNII- 1300
Query: 1269 LLSLSSLWIENCPNMETFISNSTSINLAESMEPQEMTSADVQP----LFDEKVALPILRQ 1324
LS +++ + PN+ +F+S Q + AD+ +FDE+VA P L
Sbjct: 1301 FPKLSDIFLNSLPNLTSFVSPGYH-------SLQRLHHADLDTPFPVVFDERVAFPSLDC 1353
Query: 1325 LTIICMDNLK-IWQEKLTLDSFCNLYYLRIENCNKLSNIFPWSMLERLQNLDDLRVVCCD 1383
L I +DN+K IW ++ DSF L +++ +C +L NIFP ML+RLQ+L+ L V C
Sbjct: 1354 LYIEGLDNVKKIWPNQIPQDSFSKLEVVKVASCGELLNIFPSCMLKRLQSLERLSVHVCS 1413
Query: 1384 SVQEIFELRALNGWDTHNRTTTQLPETIPSFVFPQLTFLILRGLPRLKSFYPGVHISEWP 1443
S++ +F++ N N + L T V P++T L LR LP+L+SFYPG H S+WP
Sbjct: 1414 SLEAVFDVEGTNV----NVDCSSLGNT---NVVPKITLLALRNLPQLRSFYPGAHTSQWP 1466
Query: 1444 VLKKLVVWECAEVELLASEFFGLQETPANSQHDINVPQPLFSIYKIGFRCLEDLELSTLP 1503
+LK L V C ++++LA Q+ D+ P LE+LEL L
Sbjct: 1467 LLKYLTVEMCPKLDVLA-----FQQRHYEGNLDVAFPN------------LEELELG-LN 1508
Query: 1504 KLLHLWKGKSKLSHVFQNLTTLDVSICDGLINLVTLAAAESLVKLARMKIAACGKMEKVI 1563
+ +W + + F L LDV ++ ++ + L L +K+ C +E+V
Sbjct: 1509 RDTEIWPEQFPMDS-FPRLRVLDVYDYRDILVVIPSFMLQRLHNLEVLKVGRCSSVEEVF 1567
Query: 1564 QQVGAEVVEEDSIATFNQLQYLGIDCLPSLTCFCFGRSKNKLEFPSLEQVVVREC 1618
Q G + EE+ QL+ + +D LP LT SK L+ SLE + V +C
Sbjct: 1568 QLEGLD--EENQAKRLGQLREIKLDDLPGLTHLWKENSKPGLDLQSLESLEVLDC 1620
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147865073|emb|CAN83232.1| hypothetical protein VITISV_021876 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255542484|ref|XP_002512305.1| phosphoprotein phosphatase, putative [Ricinus communis] gi|223548266|gb|EEF49757.1| phosphoprotein phosphatase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|296087869|emb|CBI35152.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255563252|ref|XP_002522629.1| Disease resistance protein RPS5, putative [Ricinus communis] gi|223538105|gb|EEF39716.1| Disease resistance protein RPS5, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359488103|ref|XP_002263579.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359488101|ref|XP_002263761.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359488027|ref|XP_002269288.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224111284|ref|XP_002332949.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834261|gb|EEE72738.1| cc-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1698 | ||||||
| TAIR|locus:2136447 | 985 | AT4G27190 [Arabidopsis thalian | 0.371 | 0.639 | 0.288 | 6.5e-58 | |
| TAIR|locus:2131689 | 919 | AT4G27220 [Arabidopsis thalian | 0.376 | 0.695 | 0.290 | 1.3e-51 | |
| TAIR|locus:2005517 | 909 | RPS2 "RESISTANT TO P. SYRINGAE | 0.213 | 0.398 | 0.314 | 1e-48 | |
| TAIR|locus:2166320 | 888 | AT5G63020 [Arabidopsis thalian | 0.219 | 0.420 | 0.278 | 5.1e-43 | |
| TAIR|locus:2008510 | 967 | AT1G61190 "AT1G61190" [Arabido | 0.225 | 0.396 | 0.279 | 1.6e-41 | |
| TAIR|locus:2031366 | 898 | AT1G63350 "AT1G63350" [Arabido | 0.222 | 0.419 | 0.283 | 3.3e-41 | |
| TAIR|locus:2132741 | 892 | AT4G10780 [Arabidopsis thalian | 0.200 | 0.381 | 0.291 | 3.2e-40 | |
| TAIR|locus:2034770 | 894 | SUMM2 "AT1G12280" [Arabidopsis | 0.213 | 0.404 | 0.290 | 2.1e-39 | |
| TAIR|locus:2170892 | 848 | AT5G43730 [Arabidopsis thalian | 0.220 | 0.442 | 0.286 | 1.2e-36 | |
| TAIR|locus:2170902 | 862 | AT5G43740 [Arabidopsis thalian | 0.347 | 0.684 | 0.258 | 1.2e-36 |
| TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 571 (206.1 bits), Expect = 6.5e-58, Sum P(3) = 6.5e-58
Identities = 196/680 (28%), Positives = 340/680 (50%)
Query: 195 KQIAMQVIEDKLFDKVVFVERAEKLRQR----LKNVKRVLVILDNIWKLLNLDAVGIPFG 250
+++ Q+ E +L E EKL +R L ++ L+ILD++WK ++LD +GIP
Sbjct: 212 REVQKQIAE-RLDIDTQMEESEEKLARRIYVGLMKERKFLLILDDVWKPIDLDLLGIP-- 268
Query: 251 DVKKERNDDRSRCTVLLTSRNRDVLCNDMNSQKFFLIEVLSYEEAWCLFEKIVGDSAKAS 310
R ++ V+LTSR +V C M + ++ L E+AW LF K GD ++
Sbjct: 269 -----RTEENKGSKVILTSRFLEV-CRSMKTDLDVRVDCLLEEDAWELFCKNAGDVVRSD 322
Query: 311 DFRVIADEIVRRCGGLPVAIKTIANALKNKR-LYVWNDSLERLRNSTSRQIHGMEENVYS 369
R IA + + CGGLP+AI T+ A++ K+ + +WN L +L S I +EE ++
Sbjct: 323 HVRKIAKAVSQECGGLPLAIITVGTAMRGKKNVKLWNHVLSKLSKSVP-WIKSIEEKIFQ 381
Query: 370 SIELSYSFLKSEEEKSMFRLCALRKDGSPIPIDDLMRYGIGLGLFSNVRTSEAARNRVYT 429
++LSY FL+ ++ K F LCAL + I + +++RY + G + + E + N T
Sbjct: 382 PLKLSYDFLE-DKAKFCFLLCALFPEDYSIEVTEVVRYWMAEGFMEELGSQEDSMNEGIT 440
Query: 430 LVDNLKASSLLLDGDK-DEVKLHDII--YAVAV-SIARDEFMFNIQSKDELKDKTQKDSI 485
V++LK LL DGD+ D VK+HD++ +A+ + S ++D+ + S L+D Q D +
Sbjct: 441 TVESLKDYCLLEDGDRRDTVKMHDVVRDFAIWIMSSSQDDSHSLVMSGTGLQDIRQ-DKL 499
Query: 486 A-----ISLPNRDIDELPERLE--CPKLSLFLLFAKYDSSLK-IPDLFFEGMNELRVVHF 537
A +SL N ++ LP+ +E C K S+ LL + LK +P F + LR+++
Sbjct: 500 APSLRRVSLMNNKLESLPDLVEEFCVKTSVLLLQGNF--LLKEVPIGFLQAFPTLRILNL 557
Query: 538 TRTCFLSLPS-SLVCLISLRTLSLEGC-QVGDVAIVGQLKKLEILSFRNSDIQQLPREIG 595
+ T S PS SL+ L SL +L L C ++ + + L KLE+L + I + PR +
Sbjct: 558 SGTRIKSFPSCSLLRLFSLHSLFLRDCFKLVKLPSLETLAKLELLDLCGTHILEFPRGLE 617
Query: 596 QLVQXXXXXXXXXXXXQAIAPNVISKLSRLEELYMGDSFSQWEKVEGGSN---ASLVELK 652
+L + ++I V+S+LS LE L M S +W V+G + A++ E+
Sbjct: 618 ELKRFRHLDLSRTLHLESIPARVVSRLSSLETLDMTSSHYRWS-VQGETQKGQATVEEIG 676
Query: 653 GLSKLTTLEIHIRDARIM--PQDLISMKLEIFRMFIGNVVDWYHKFERSRLVKLDKLEKN 710
L +L L I + + + ++ +L+ F++ +G+ + ++ RL
Sbjct: 677 CLQRLQVLSIRLHSSPFLLNKRNTWIKRLKKFQLVVGSRYILRTRHDKRRLTISHLNVSQ 736
Query: 711 ILLGQGMKMFLKRTEDLYLHDLKGFQNVVHEL-DDGEVFSELKHLHVEHSYEILHIVSSI 769
+ +G L T L L+ +G + ++ +L D + F LK L +E+ I++ S +
Sbjct: 737 VSIG----WLLAYTTSLALNHCQGIEAMMKKLVSDNKGFKNLKSLTIENV--IINTNSWV 790
Query: 770 GQVCCKVFPLLESLSLCRLFNLEKICHNRLHEDESFSNLRIIKVGECDKLRHLFSFSMAK 829
V + L L NLE++ H R + E+FS L+ + + L+ + +M +
Sbjct: 791 EMVSTNTSKQSSDI-LDLLPNLEEL-HLRRVDLETFSELQTHLGLKLETLK-IIEITMCR 847
Query: 830 NLLRL-QKISVFDCKSLEII 848
L L K + +LE I
Sbjct: 848 KLRTLLDKRNFLTIPNLEEI 867
|
|
| TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2031366 AT1G63350 "AT1G63350" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2170892 AT5G43730 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2170902 AT5G43740 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | eugene3.03110007 | cc-nbs-lrr resistance protein (1315 aa) | ||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1698 | |||
| pfam00931 | 285 | pfam00931, NB-ARC, NB-ARC domain | 8e-34 | |
| smart00382 | 148 | smart00382, AAA, ATPases associated with a variety | 2e-04 | |
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 5e-04 | |
| pfam13481 | 154 | pfam13481, AAA_25, AAA domain | 0.001 |
| >gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain | Back alignment and domain information |
|---|
Score = 132 bits (334), Expect = 8e-34
Identities = 79/274 (28%), Positives = 118/274 (43%), Gaps = 48/274 (17%)
Query: 176 NVGMIGVYGVNGVGKTTLVKQIAMQVIEDKLFDKVVFV---------------------- 213
N+G++G+ G+ GVGKTTL KQI FD V +V
Sbjct: 18 NLGVVGIVGMGGVGKTTLAKQIYNDDSVGGHFDSVAWVVVSKTYTEFRLQKDILQELGLD 77
Query: 214 ----------ERAEKLRQRLKNVKRVLVILDNIWKLLNLDAVGIPFGDVKKERNDDRSRC 263
E A K+++ L KR L++LD++W+ + D +G+PF D +
Sbjct: 78 DSDWVEKNESELAVKIKEALLR-KRFLLVLDDVWEKNDWDKIGVPFPDG-------ENGS 129
Query: 264 TVLLTSRNRDVLCNDMNSQKFFL-IEVLSYEEAWCLFEKIVG--DSAKASDFRVIADEIV 320
V++T+R+ V M +E L EE+W LF V + + +A EIV
Sbjct: 130 RVIVTTRSESV-AGRMGGTSKPHEVESLEPEESWELFSNKVFEKELPPCPELEEVAKEIV 188
Query: 321 RRCGGLPVAIKTIANALKNKR-LYVWNDSLERLRNSTSRQIHGMEENVYSSIELSYSFLK 379
+C GLP+A+K + L K + W LE+L N G+ E V S + LSY L
Sbjct: 189 EKCKGLPLALKVLGGLLAFKSTVQEWEHVLEQLNN-ELAGRDGLNE-VLSILSLSYDNLP 246
Query: 380 SEEEKSMFRLCALRKDGSPIPIDDLMRYGIGLGL 413
K F AL + I + L++ I G
Sbjct: 247 M-HLKRCFLYLALFPEDYNIRKEQLIKLWIAEGF 279
|
Length = 285 |
| >gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
| >gnl|CDD|222165 pfam13481, AAA_25, AAA domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1698 | |||
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 100.0 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 100.0 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 100.0 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.97 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.96 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.83 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.8 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.76 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.76 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.76 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.75 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.74 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.71 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.65 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.55 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.33 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.3 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 99.3 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.21 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.18 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.17 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.11 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.11 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 98.95 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 98.93 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 98.89 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 98.84 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 98.78 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 98.77 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.76 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.76 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 98.71 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 98.71 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 98.66 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 98.65 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.64 | |
| PF05729 | 166 | NACHT: NACHT domain | 98.63 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 98.62 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 98.59 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 98.55 | |
| COG2909 | 894 | MalT ATP-dependent transcriptional regulator [Tran | 98.49 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 98.47 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 98.42 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 98.38 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.36 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 98.36 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 98.31 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 98.3 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 98.28 | |
| PF13173 | 128 | AAA_14: AAA domain | 98.25 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 98.22 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 98.19 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 98.19 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 98.18 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 98.18 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 98.18 | |
| PRK09087 | 226 | hypothetical protein; Validated | 98.17 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 98.17 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 98.15 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 98.14 | |
| COG3899 | 849 | Predicted ATPase [General function prediction only | 98.12 | |
| COG3903 | 414 | Predicted ATPase [General function prediction only | 98.12 | |
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 98.11 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 98.11 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 98.09 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 98.08 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 98.07 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 98.07 | |
| PRK08727 | 233 | hypothetical protein; Validated | 98.06 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 98.06 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.06 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 98.05 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 98.05 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 98.05 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 98.04 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 98.02 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 98.02 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 98.01 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 98.01 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 98.0 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 97.98 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.98 | |
| KOG0989 | 346 | consensus Replication factor C, subunit RFC4 [Repl | 97.98 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 97.96 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.95 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 97.94 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 97.94 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 97.93 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 97.92 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 97.92 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.92 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 97.91 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 97.89 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 97.89 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 97.88 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 97.86 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 97.86 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 97.85 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 97.84 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.84 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 97.84 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 97.82 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 97.81 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 97.79 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 97.78 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 97.77 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 97.74 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 97.73 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 97.73 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 97.72 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 97.71 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 97.71 | |
| PRK14971 | 614 | DNA polymerase III subunits gamma and tau; Provisi | 97.7 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 97.69 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 97.66 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 97.66 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 97.66 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 97.66 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 97.64 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.64 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.6 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 97.6 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 97.59 | |
| PRK06620 | 214 | hypothetical protein; Validated | 97.59 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 97.57 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 97.56 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 97.53 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 97.53 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 97.52 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 97.51 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 97.48 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 97.48 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 97.48 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 97.47 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 97.47 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 97.45 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 97.44 | |
| PRK07399 | 314 | DNA polymerase III subunit delta'; Validated | 97.44 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 97.44 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 97.43 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 97.41 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.38 | |
| PF14516 | 331 | AAA_35: AAA-like domain | 97.37 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 97.37 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 97.32 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 97.27 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 97.26 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.26 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 97.25 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 97.22 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 97.18 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 97.18 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 97.17 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 97.15 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 97.15 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 97.14 | |
| COG1373 | 398 | Predicted ATPase (AAA+ superfamily) [General funct | 97.13 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 97.13 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 97.12 | |
| PRK08769 | 319 | DNA polymerase III subunit delta'; Validated | 97.12 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 97.12 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 97.1 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 97.09 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 97.07 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 97.04 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.01 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 97.0 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 97.0 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 96.99 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 96.98 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 96.96 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 96.93 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 96.93 | |
| PRK06871 | 325 | DNA polymerase III subunit delta'; Validated | 96.91 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 96.9 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 96.86 | |
| PTZ00202 | 550 | tuzin; Provisional | 96.85 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 96.83 | |
| KOG0741 | 744 | consensus AAA+-type ATPase [Posttranslational modi | 96.79 | |
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 96.78 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 96.75 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 96.67 | |
| PRK06090 | 319 | DNA polymerase III subunit delta'; Validated | 96.62 | |
| COG1875 | 436 | NYN ribonuclease and ATPase of PhoH family domains | 96.58 | |
| PRK07993 | 334 | DNA polymerase III subunit delta'; Validated | 96.54 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 96.54 | |
| KOG0743 | 457 | consensus AAA+-type ATPase [Posttranslational modi | 96.44 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 96.39 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 96.39 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 96.37 | |
| PF13177 | 162 | DNA_pol3_delta2: DNA polymerase III, delta subunit | 96.36 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 96.34 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 96.34 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 96.32 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 96.29 | |
| PRK06964 | 342 | DNA polymerase III subunit delta'; Validated | 96.25 | |
| PF10443 | 431 | RNA12: RNA12 protein; InterPro: IPR018850 Mitochon | 96.21 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 96.2 | |
| KOG2227 | 529 | consensus Pre-initiation complex, subunit CDC6, AA | 96.18 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 96.17 | |
| COG2812 | 515 | DnaX DNA polymerase III, gamma/tau subunits [DNA r | 96.15 | |
| KOG2004 | 906 | consensus Mitochondrial ATP-dependent protease PIM | 96.15 | |
| PRK08116 | 268 | hypothetical protein; Validated | 96.12 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 96.1 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 96.05 | |
| PRK08181 | 269 | transposase; Validated | 96.05 | |
| KOG0731 | 774 | consensus AAA+-type ATPase containing the peptidas | 96.05 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 96.02 | |
| KOG0730 | 693 | consensus AAA+-type ATPase [Posttranslational modi | 96.02 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 95.95 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 95.95 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 95.93 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 95.89 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 95.88 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 95.88 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 95.88 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 95.87 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 95.82 | |
| COG3267 | 269 | ExeA Type II secretory pathway, component ExeA (pr | 95.82 | |
| PRK12377 | 248 | putative replication protein; Provisional | 95.82 | |
| cd01133 | 274 | F1-ATPase_beta F1 ATP synthase beta subunit, nucle | 95.79 | |
| PRK06526 | 254 | transposase; Provisional | 95.78 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 95.67 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 95.66 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 95.63 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 95.62 | |
| KOG0727 | 408 | consensus 26S proteasome regulatory complex, ATPas | 95.58 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 95.51 | |
| KOG0734 | 752 | consensus AAA+-type ATPase containing the peptidas | 95.51 | |
| PRK06696 | 223 | uridine kinase; Validated | 95.49 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 95.42 | |
| KOG2035 | 351 | consensus Replication factor C, subunit RFC3 [Cell | 95.34 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 95.34 | |
| KOG0739 | 439 | consensus AAA+-type ATPase [Posttranslational modi | 95.33 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 95.33 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 95.31 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 95.29 | |
| PRK08699 | 325 | DNA polymerase III subunit delta'; Validated | 95.26 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 95.19 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 95.19 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 95.14 | |
| KOG0736 | 953 | consensus Peroxisome assembly factor 2 containing | 95.12 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 95.12 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 95.09 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 95.03 | |
| PRK13695 | 174 | putative NTPase; Provisional | 94.99 | |
| COG0194 | 191 | Gmk Guanylate kinase [Nucleotide transport and met | 94.98 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 94.96 | |
| PRK10733 | 644 | hflB ATP-dependent metalloprotease; Reviewed | 94.92 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 94.86 | |
| cd02117 | 212 | NifH_like This family contains the NifH (iron prot | 94.82 | |
| KOG2543 | 438 | consensus Origin recognition complex, subunit 5 [R | 94.75 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 94.72 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 94.66 | |
| KOG1532 | 366 | consensus GTPase XAB1, interacts with DNA repair p | 94.63 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 94.62 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 94.61 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 94.6 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 94.59 | |
| ) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309 | 127 | Torsin: Torsin; InterPro: IPR010448 This family co | 94.58 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 94.57 | |
| PRK15455 | 644 | PrkA family serine protein kinase; Provisional | 94.47 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 94.45 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 94.41 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 94.4 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 94.39 | |
| PRK07667 | 193 | uridine kinase; Provisional | 94.37 | |
| TIGR01287 | 275 | nifH nitrogenase iron protein. This model describe | 94.35 | |
| PF07693 | 325 | KAP_NTPase: KAP family P-loop domain; InterPro: IP | 94.34 | |
| PRK13230 | 279 | nitrogenase reductase-like protein; Reviewed | 94.34 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 94.32 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 94.21 | |
| PRK13236 | 296 | nitrogenase reductase; Reviewed | 94.2 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 94.16 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 94.11 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 94.07 | |
| PRK13232 | 273 | nifH nitrogenase reductase; Reviewed | 94.02 | |
| PRK13235 | 274 | nifH nitrogenase reductase; Reviewed | 94.0 | |
| PF00006 | 215 | ATP-synt_ab: ATP synthase alpha/beta family, nucle | 93.95 | |
| PRK12597 | 461 | F0F1 ATP synthase subunit beta; Provisional | 93.88 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 93.81 | |
| PRK04132 | 846 | replication factor C small subunit; Provisional | 93.8 | |
| cd01135 | 276 | V_A-ATPase_B V/A-type ATP synthase (non-catalytic) | 93.79 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 93.75 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 93.73 | |
| KOG0729 | 435 | consensus 26S proteasome regulatory complex, ATPas | 93.7 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 93.67 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 93.63 | |
| PF14532 | 138 | Sigma54_activ_2: Sigma-54 interaction domain; PDB: | 93.62 | |
| COG1428 | 216 | Deoxynucleoside kinases [Nucleotide transport and | 93.61 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 93.6 | |
| TIGR01281 | 268 | DPOR_bchL light-independent protochlorophyllide re | 93.56 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 93.55 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 93.48 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 93.45 | |
| COG1066 | 456 | Sms Predicted ATP-dependent serine protease [Postt | 93.44 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 93.41 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 93.4 | |
| PF00625 | 183 | Guanylate_kin: Guanylate kinase; InterPro: IPR0081 | 93.38 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 93.38 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 93.34 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 93.3 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 93.27 | |
| PRK13233 | 275 | nifH nitrogenase reductase; Reviewed | 93.25 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 93.24 | |
| cd03281 | 213 | ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS | 93.24 | |
| KOG0728 | 404 | consensus 26S proteasome regulatory complex, ATPas | 93.23 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 93.21 | |
| PF02374 | 305 | ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ | 93.21 | |
| COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 93.2 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 93.18 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 93.18 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 93.18 | |
| KOG2170 | 344 | consensus ATPase of the AAA+ superfamily [General | 93.15 | |
| TIGR03305 | 449 | alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit | 93.13 | |
| PRK09280 | 463 | F0F1 ATP synthase subunit beta; Validated | 93.11 | |
| COG0465 | 596 | HflB ATP-dependent Zn proteases [Posttranslational | 93.1 | |
| PRK12678 | 672 | transcription termination factor Rho; Provisional | 93.06 | |
| PRK13234 | 295 | nifH nitrogenase reductase; Reviewed | 93.04 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 93.03 | |
| PRK13185 | 270 | chlL protochlorophyllide reductase iron-sulfur ATP | 93.02 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 93.0 | |
| cd00561 | 159 | CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B | 92.99 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 92.97 | |
| cd03283 | 199 | ABC_MutS-like MutS-like homolog in eukaryotes. The | 92.93 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 92.92 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 92.9 | |
| PRK13768 | 253 | GTPase; Provisional | 92.9 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 92.89 | |
| PRK08972 | 444 | fliI flagellum-specific ATP synthase; Validated | 92.87 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 92.86 | |
| COG3640 | 255 | CooC CO dehydrogenase maturation factor [Cell divi | 92.76 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 92.7 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 92.7 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 92.69 | |
| cd02040 | 270 | NifH NifH gene encodes component II (iron protein) | 92.68 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 92.64 | |
| KOG1969 | 877 | consensus DNA replication checkpoint protein CHL12 | 92.62 | |
| TIGR02016 | 296 | BchX chlorophyllide reductase iron protein subunit | 92.62 | |
| PRK07132 | 299 | DNA polymerase III subunit delta'; Validated | 92.61 | |
| PRK08927 | 442 | fliI flagellum-specific ATP synthase; Validated | 92.6 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 92.54 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 92.53 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 92.51 | |
| KOG2228 | 408 | consensus Origin recognition complex, subunit 4 [R | 92.49 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 92.48 | |
| PRK03839 | 180 | putative kinase; Provisional | 92.37 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 92.35 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 92.31 | |
| COG2607 | 287 | Predicted ATPase (AAA+ superfamily) [General funct | 92.31 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 92.25 | |
| PF00142 | 273 | Fer4_NifH: 4Fe-4S iron sulfur cluster binding prot | 92.25 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 92.23 | |
| COG0003 | 322 | ArsA Predicted ATPase involved in chromosome parti | 92.2 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 92.14 | |
| cd02032 | 267 | Bchl_like This family of proteins contains bchL an | 92.13 | |
| KOG0726 | 440 | consensus 26S proteasome regulatory complex, ATPas | 92.1 | |
| PRK14737 | 186 | gmk guanylate kinase; Provisional | 92.1 | |
| TIGR01041 | 458 | ATP_syn_B_arch ATP synthase archaeal, B subunit. A | 92.04 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 92.03 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 92.03 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 91.97 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 91.96 | |
| KOG0652 | 424 | consensus 26S proteasome regulatory complex, ATPas | 91.96 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 91.96 | |
| cd02024 | 187 | NRK1 Nicotinamide riboside kinase (NRK) is an enzy | 91.93 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 91.91 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 91.89 | |
| PF10236 | 309 | DAP3: Mitochondrial ribosomal death-associated pro | 91.88 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 91.78 | |
| cd01134 | 369 | V_A-ATPase_A V/A-type ATP synthase catalytic subun | 91.74 | |
| PRK05917 | 290 | DNA polymerase III subunit delta'; Validated | 91.74 | |
| PRK08149 | 428 | ATP synthase SpaL; Validated | 91.71 | |
| PRK06936 | 439 | type III secretion system ATPase; Provisional | 91.68 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 91.67 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 91.67 | |
| CHL00072 | 290 | chlL photochlorophyllide reductase subunit L | 91.65 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 91.61 | |
| cd03287 | 222 | ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS | 91.6 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 91.59 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 91.55 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 91.53 | |
| TIGR01039 | 461 | atpD ATP synthase, F1 beta subunit. The sequences | 91.47 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 91.47 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 91.42 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 91.41 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 91.39 | |
| KOG1514 | 767 | consensus Origin recognition complex, subunit 1, a | 91.36 | |
| smart00072 | 184 | GuKc Guanylate kinase homologues. Active enzymes c | 91.32 | |
| cd03114 | 148 | ArgK-like The function of this protein family is u | 91.31 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 91.28 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 91.23 | |
| cd02034 | 116 | CooC The accessory protein CooC, which contains a | 91.22 | |
| PRK06217 | 183 | hypothetical protein; Validated | 91.21 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 91.21 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 91.16 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 91.15 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 91.13 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 91.09 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 91.08 | |
| PRK06002 | 450 | fliI flagellum-specific ATP synthase; Validated | 91.07 | |
| COG0396 | 251 | sufC Cysteine desulfurase activator ATPase [Posttr | 91.07 | |
| COG1348 | 278 | NifH Nitrogenase subunit NifH (ATPase) [Inorganic | 91.07 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 91.03 | |
| KOG0737 | 386 | consensus AAA+-type ATPase [Posttranslational modi | 90.94 | |
| PTZ00185 | 574 | ATPase alpha subunit; Provisional | 90.91 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 90.91 | |
| cd03243 | 202 | ABC_MutS_homologs The MutS protein initiates DNA m | 90.86 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 90.81 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 90.76 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 90.75 | |
| PRK00409 | 782 | recombination and DNA strand exchange inhibitor pr | 90.73 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 90.73 | |
| TIGR02030 | 337 | BchI-ChlI magnesium chelatase ATPase subunit I. Th | 90.72 | |
| KOG0738 | 491 | consensus AAA+-type ATPase [Posttranslational modi | 90.71 | |
| COG1763 | 161 | MobB Molybdopterin-guanine dinucleotide biosynthes | 90.7 | |
| smart00534 | 185 | MUTSac ATPase domain of DNA mismatch repair MUTS f | 90.67 | |
| KOG0651 | 388 | consensus 26S proteasome regulatory complex, ATPas | 90.63 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 90.62 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 90.6 | |
| KOG1970 | 634 | consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 | 90.58 | |
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 90.57 | |
| TIGR00708 | 173 | cobA cob(I)alamin adenosyltransferase. Alternate n | 90.52 | |
| cd01136 | 326 | ATPase_flagellum-secretory_path_III Flagellum-spec | 90.49 | |
| PRK07594 | 433 | type III secretion system ATPase SsaN; Validated | 90.47 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 90.46 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 90.44 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 90.4 | |
| cd01132 | 274 | F1_ATPase_alpha F1 ATP synthase alpha, central dom | 90.39 | |
| PRK04196 | 460 | V-type ATP synthase subunit B; Provisional | 90.39 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 90.32 | |
| KOG0742 | 630 | consensus AAA+-type ATPase [Posttranslational modi | 90.31 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 90.29 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 90.28 | |
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 90.27 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 90.26 | |
| PRK05688 | 451 | fliI flagellum-specific ATP synthase; Validated | 90.16 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 90.15 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 90.15 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 90.12 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 90.06 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 90.05 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 90.02 | |
| PRK05922 | 434 | type III secretion system ATPase; Validated | 89.99 | |
| TIGR00073 | 207 | hypB hydrogenase accessory protein HypB. HypB is i | 89.93 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 89.87 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 89.86 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 89.86 | |
| PRK07960 | 455 | fliI flagellum-specific ATP synthase; Validated | 89.86 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 89.75 | |
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 89.74 | |
| TIGR03496 | 411 | FliI_clade1 flagellar protein export ATPase FliI. | 89.72 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 89.71 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 89.71 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 89.67 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 89.66 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 89.65 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 89.65 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 89.65 | |
| PF08298 | 358 | AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi | 89.65 | |
| CHL00081 | 350 | chlI Mg-protoporyphyrin IX chelatase | 89.62 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 89.61 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 89.59 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 89.56 | |
| PRK12339 | 197 | 2-phosphoglycerate kinase; Provisional | 89.55 | |
| TIGR03498 | 418 | FliI_clade3 flagellar protein export ATPase FliI. | 89.53 | |
| KOG0066 | 807 | consensus eIF2-interacting protein ABC50 (ABC supe | 89.52 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 89.49 | |
| COG4136 | 213 | ABC-type uncharacterized transport system, ATPase | 89.46 | |
| PRK06820 | 440 | type III secretion system ATPase; Validated | 89.41 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 89.35 | |
| PRK13975 | 196 | thymidylate kinase; Provisional | 89.35 | |
| KOG4252 | 246 | consensus GTP-binding protein [Signal transduction | 89.34 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 89.34 | |
| PRK05986 | 191 | cob(I)alamin adenolsyltransferase/cobinamide ATP-d | 89.33 | |
| TIGR01040 | 466 | V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit. Th | 89.27 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 89.21 | |
| PRK13705 | 388 | plasmid-partitioning protein SopA; Provisional | 89.2 | |
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 89.17 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 89.1 | |
| PF08423 | 256 | Rad51: Rad51; InterPro: IPR013632 This domain is f | 89.1 | |
| PF06564 | 243 | YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ p | 89.05 | |
| PRK09099 | 441 | type III secretion system ATPase; Provisional | 88.96 | |
| cd03282 | 204 | ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS | 88.96 | |
| PRK13231 | 264 | nitrogenase reductase-like protein; Reviewed | 88.93 | |
| KOG3347 | 176 | consensus Predicted nucleotide kinase/nuclear prot | 88.91 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 88.83 | |
| PF08477 | 119 | Miro: Miro-like protein; InterPro: IPR013684 Mitoc | 88.82 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 88.81 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 88.78 | |
| cd03285 | 222 | ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS | 88.77 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 88.74 | |
| TIGR01026 | 440 | fliI_yscN ATPase FliI/YscN family. This family of | 88.65 | |
| cd01983 | 99 | Fer4_NifH The Fer4_NifH superfamily contains a var | 88.63 | |
| COG1224 | 450 | TIP49 DNA helicase TIP49, TBP-interacting protein | 88.63 | |
| PRK15453 | 290 | phosphoribulokinase; Provisional | 88.63 | |
| PRK13948 | 182 | shikimate kinase; Provisional | 88.62 | |
| PRK13946 | 184 | shikimate kinase; Provisional | 88.6 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 88.56 | |
| COG3854 | 308 | SpoIIIAA ncharacterized protein conserved in bacte | 88.56 |
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.9e-78 Score=774.12 Aligned_cols=602 Identities=30% Similarity=0.480 Sum_probs=463.8
Q ss_pred HHHHHHHHHHHHHHhhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCchhhHHHHHHHHHHHHHHHHHHHh--
Q 000302 12 ASKFAEVILGPIRREISYVFNYQSNVEELRTLDKELAYKREMVEQPVIQARRQGDEIYKRVEDWLNNVDDFTEDVVKS-- 89 (1698)
Q Consensus 12 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~l~~~l~~~~~~~~~a~~~~~~~~~~v~~wl~~v~~~~~d~~~~-- 89 (1698)
++|+.+. +.+++..+.++++.+..+++++..|+. ++++++...+ ....+..|.+.++++.|+..+.
T Consensus 9 ~~~~~~~----l~~~~~~~~~~~~~i~~Lk~~L~~l~~-------~l~d~~a~~~-~~~~~~~~~e~~~~~~~~~e~~~~ 76 (889)
T KOG4658|consen 9 VEKLDQL----LNRESECLDGKDNYILELKENLKALQS-------ALEDLDAKRD-DLERRVNWEEDVGDLVYLAEDIIW 76 (889)
T ss_pred hhhHHHH----HHHHHHHHhchHHHHHHHHHHHHHHHH-------HHHHHHhhcc-hHHHHHHHHHHHHHHHHHHHHHHH
Confidence 4555553 356777777766656655555555555 4455554433 3567788888888887762221
Q ss_pred -Hh-CCcc------------ccccccccCCCC-ChHHHhHHHHHHHHHHHHHHHHhcCCCCCccccCCCC-CcccCCCCC
Q 000302 90 -IT-GGED------------EAKKRCFKGLCP-NLIKRYSLGKKAVKAAKEGADLLGTGNFGTVSFRPTV-ERTTPVSYT 153 (1698)
Q Consensus 90 -~~-~~~~------------~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~ 153 (1698)
+. .... ....-|+.+++. +...-+.+++++.++..+++.+..++.|+.+...+.+ ......+..
T Consensus 77 ~~~v~~~~~~~~~~l~~~~~~~~~~c~~~~~~~~~~~~~~~~~rv~~~l~~ve~l~~~~~~~~~~~~~~~~~~~e~~~~~ 156 (889)
T KOG4658|consen 77 LFLVEEIERKANDLLSTRSVERQRLCLCGFCSKNVSDSYKYGKRVSKVLREVESLGSKGVFEVVGESLDPREKVETRPIQ 156 (889)
T ss_pred HHHHHHHHHHHhHHhhhhHHHHHHHhhhhhHhHhhhhhHhHHHHHHHHHHHHHHhccccceecccccccchhhcccCCCC
Confidence 11 0000 011123333333 4556677888999999999999888777755532211 111111222
Q ss_pred CcccccchHHHHHHHHHHHhcCCceEEEEEcCCCchHHHHHHHHHHHHh-hcccCCEEEEh-------------------
Q 000302 154 AYEQFDSRMKIFQNIMEVLKDTNVGMIGVYGVNGVGKTTLVKQIAMQVI-EDKLFDKVVFV------------------- 213 (1698)
Q Consensus 154 ~~~~~~gr~~~~~~l~~~l~~~~~~vi~I~G~gGiGKTtLa~~v~~~~~-~~~~F~~~~~~------------------- 213 (1698)
.... +|.+..++++++.|.+++..++||+||||+||||||++++++.. ++.+||.++||
T Consensus 157 ~~~~-VG~e~~~~kl~~~L~~d~~~iv~i~GMGGvGKTTL~~qi~N~~~~v~~~Fd~~iWV~VSk~f~~~~iq~~Il~~l 235 (889)
T KOG4658|consen 157 SESD-VGLETMLEKLWNRLMEDDVGIVGIYGMGGVGKTTLARQIFNKFDEVGNHFDGVIWVVVSKEFTTRKIQQTILERL 235 (889)
T ss_pred cccc-ccHHHHHHHHHHHhccCCCCEEEEECCCcccHHHHHHHHhcccchhcccCceEEEEEEcccccHHhHHHHHHHHh
Confidence 2223 99999999999999988779999999999999999999999988 88999999999
Q ss_pred -------------HHHHHHHHHHHccCcEEEEEcCcccccccccccCcccccccccCCCCCCeEEEEEeCchhhhhcccC
Q 000302 214 -------------ERAEKLRQRLKNVKRVLVILDNIWKLLNLDAVGIPFGDVKKERNDDRSRCTVLLTSRNRDVLCNDMN 280 (1698)
Q Consensus 214 -------------~~~~~l~~~l~~~k~~LlvlDdv~~~~~~~~~~~~~~~~~~~~~~~~~g~kilvTtR~~~v~~~~~~ 280 (1698)
..+..+.+.|+ +|||+|||||||+..+|+.++.|+|. ..+||||++|||++.||...|+
T Consensus 236 ~~~~~~~~~~~~~~~~~~i~~~L~-~krfllvLDDIW~~~dw~~I~~~~p~-------~~~g~KvvlTTRs~~V~~~~m~ 307 (889)
T KOG4658|consen 236 GLLDEEWEDKEEDELASKLLNLLE-GKRFLLVLDDIWEEVDWDKIGVPFPS-------RENGSKVVLTTRSEEVCGRAMG 307 (889)
T ss_pred ccCCcccchhhHHHHHHHHHHHhc-cCceEEEEecccccccHHhcCCCCCC-------ccCCeEEEEEeccHhhhhcccc
Confidence 12334555555 79999999999999999999999998 7899999999999999996699
Q ss_pred CcceEEccCCCHHHHHHHHHHHhCCC--CCCCchHHHHHHHHHHhCCChHHHHHHHHHHhcCCchh-HHHHHHHHHcccc
Q 000302 281 SQKFFLIEVLSYEEAWCLFEKIVGDS--AKASDFRVIADEIVRRCGGLPVAIKTIANALKNKRLYV-WNDSLERLRNSTS 357 (1698)
Q Consensus 281 ~~~~~~l~~L~~~e~~~Lf~~~~~~~--~~~~~~~~~~~~i~~~c~GlPlai~~~~~~l~~~~~~~-w~~~~~~l~~~~~ 357 (1698)
+...+++++|+.+|||.||++.||.. ...+.++++|++|+++|+|+|||+.++|++|+.|.... |+++.+.+.+...
T Consensus 308 ~~~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~ 387 (889)
T KOG4658|consen 308 VDYPIEVECLTPEEAWDLFQKKVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLA 387 (889)
T ss_pred CCccccccccCccccHHHHHHhhccccccccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHcccccccc
Confidence 99999999999999999999999853 34456899999999999999999999999999998775 9999999988866
Q ss_pred cccCcchHHHHHHHHHHHhcCCchHHHHHHHHhcccCCCCCCCHHHHHHHHhhcCcccccccHHHHHHHHHHHHHHHHhc
Q 000302 358 RQIHGMEENVYSSIELSYSFLKSEEEKSMFRLCALRKDGSPIPIDDLMRYGIGLGLFSNVRTSEAARNRVYTLVDNLKAS 437 (1698)
Q Consensus 358 ~~~~~~~~~~~~~l~~sy~~L~~~~lk~cfl~~s~fp~~~~i~~~~li~~w~~~g~~~~~~~~~~~~~~~~~~~~~L~~~ 437 (1698)
.+..++.+.+++++++|||.||+ ++|.||+|||+||||+.|+++.|+.+|+||||+.+....+.+++.+++|+++|++|
T Consensus 388 ~~~~~~~~~i~~iLklSyd~L~~-~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~ 466 (889)
T KOG4658|consen 388 ADFSGMEESILPILKLSYDNLPE-ELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRA 466 (889)
T ss_pred CCCCchhhhhHHhhhccHhhhhH-HHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHH
Confidence 66677888999999999999995 49999999999999999999999999999999988666777889999999999999
Q ss_pred cccccCCC----CeEEEchHHHHHHHHHhc-----ccceEeeccCCccccCCc----CCeEEEECCCCCCCCCCcccCCC
Q 000302 438 SLLLDGDK----DEVKLHDIIYAVAVSIAR-----DEFMFNIQSKDELKDKTQ----KDSIAISLPNRDIDELPERLECP 504 (1698)
Q Consensus 438 ~ll~~~~~----~~~~mhdlv~~~a~~~~~-----~~~~~~~~~~~~~~~~~~----~~~~~lsl~~~~~~~l~~~~~~~ 504 (1698)
+|++..+. .+|+|||+|||+|.++|+ +|+.+ +..+......+. ..+|+++++++.+..++....++
T Consensus 467 ~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~~i-v~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~~~~ 545 (889)
T KOG4658|consen 467 SLLIEERDEGRKETVKMHDVVREMALWIASDFGKQEENQI-VSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSSENP 545 (889)
T ss_pred HHHhhcccccceeEEEeeHHHHHHHHHHhccccccccceE-EECCcCccccccccchhheeEEEEeccchhhccCCCCCC
Confidence 99988763 899999999999999999 55533 332211111111 34699999999999999999999
Q ss_pred CeEEEEEecccCCCCccChhhhccCCceeEEEecCCC-cccCCccccCCCcccEEEccCccCCCccccccccccceeecC
Q 000302 505 KLSLFLLFAKYDSSLKIPDLFFEGMNELRVVHFTRTC-FLSLPSSLVCLISLRTLSLEGCQVGDVAIVGQLKKLEILSFR 583 (1698)
Q Consensus 505 ~Lr~L~l~~~~~~~~~i~~~~f~~l~~LrvL~L~~~~-i~~lp~~i~~L~~Lr~L~L~~~~l~~~~~i~~L~~L~~L~Ls 583 (1698)
+|++|.+..+......++..||..|+.||||||++|. +.+||++|+.|.|||||+ ++
T Consensus 546 ~L~tLll~~n~~~l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~----------------------L~ 603 (889)
T KOG4658|consen 546 KLRTLLLQRNSDWLLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLD----------------------LS 603 (889)
T ss_pred ccceEEEeecchhhhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhccc----------------------cc
Confidence 9999999998333778899999999999999999753 456777666655555555 55
Q ss_pred CCCCCccchHhhccccccEecccCcccccccCchhhccCccCceecccCcccccccccCCCccchhhhCCCCCCCEEEEE
Q 000302 584 NSDIQQLPREIGQLVQLRLLDLRNCRRLQAIAPNVISKLSRLEELYMGDSFSQWEKVEGGSNASLVELKGLSKLTTLEIH 663 (1698)
Q Consensus 584 ~~~i~~LP~~i~~L~~L~~L~L~~~~~l~~lp~~~i~~L~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~~L~~L~l~ 663 (1698)
++.+..||.++++|..|++||+..+..+..+ ++++..|++||+|.+..... ..+...+.++.+|.+|+.|.+.
T Consensus 604 ~t~I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~-~~i~~~L~~Lr~L~l~~s~~------~~~~~~l~el~~Le~L~~ls~~ 676 (889)
T KOG4658|consen 604 DTGISHLPSGLGNLKKLIYLNLEVTGRLESI-PGILLELQSLRVLRLPRSAL------SNDKLLLKELENLEHLENLSIT 676 (889)
T ss_pred CCCccccchHHHHHHhhheeccccccccccc-cchhhhcccccEEEeecccc------ccchhhHHhhhcccchhhheee
Confidence 5567788888888888888888877655555 34466688888888766542 2234556777777777777765
Q ss_pred ec
Q 000302 664 IR 665 (1698)
Q Consensus 664 ~~ 665 (1698)
..
T Consensus 677 ~~ 678 (889)
T KOG4658|consen 677 IS 678 (889)
T ss_pred cc
Confidence 43
|
|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >COG2909 MalT ATP-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >COG3899 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG3903 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14971 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PRK07399 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF14516 AAA_35: AAA-like domain | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08769 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >PRK06871 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00202 tuzin; Provisional | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK06090 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07993 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >PRK06964 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK08699 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >PRK10733 hflB ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase | Back alignment and domain information |
|---|
| >KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK15455 PrkA family serine protein kinase; Provisional | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01287 nifH nitrogenase iron protein | Back alignment and domain information |
|---|
| >PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals | Back alignment and domain information |
|---|
| >PRK13230 nitrogenase reductase-like protein; Reviewed | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >PRK13236 nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PRK13232 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK13235 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >PRK12597 F0F1 ATP synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PRK04132 replication factor C small subunit; Provisional | Back alignment and domain information |
|---|
| >cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H | Back alignment and domain information |
|---|
| >COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >PRK13233 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes | Back alignment and domain information |
|---|
| >KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B | Back alignment and domain information |
|---|
| >COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta | Back alignment and domain information |
|---|
| >PRK09280 F0F1 ATP synthase subunit beta; Validated | Back alignment and domain information |
|---|
| >COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK12678 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK13234 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >cd03283 ABC_MutS-like MutS-like homolog in eukaryotes | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PRK08972 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02016 BchX chlorophyllide reductase iron protein subunit X | Back alignment and domain information |
|---|
| >PRK07132 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK08927 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PF00142 Fer4_NifH: 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family; InterPro: IPR000392 This entry represents members of the NifH/BchL/ChlL family | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >cd02032 Bchl_like This family of proteins contains bchL and chlL | Back alignment and domain information |
|---|
| >KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14737 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A | Back alignment and domain information |
|---|
| >PRK05917 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK08149 ATP synthase SpaL; Validated | Back alignment and domain information |
|---|
| >PRK06936 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >CHL00072 chlL photochlorophyllide reductase subunit L | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >TIGR01039 atpD ATP synthase, F1 beta subunit | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >smart00072 GuKc Guanylate kinase homologues | Back alignment and domain information |
|---|
| >cd03114 ArgK-like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK06002 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1348 NifH Nitrogenase subunit NifH (ATPase) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00185 ATPase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I | Back alignment and domain information |
|---|
| >KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family | Back alignment and domain information |
|---|
| >KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >TIGR00708 cobA cob(I)alamin adenosyltransferase | Back alignment and domain information |
|---|
| >cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein | Back alignment and domain information |
|---|
| >PRK07594 type III secretion system ATPase SsaN; Validated | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain | Back alignment and domain information |
|---|
| >PRK04196 V-type ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
| >KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >PRK05688 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PRK05922 type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >TIGR00073 hypB hydrogenase accessory protein HypB | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK07960 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >TIGR03496 FliI_clade1 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length | Back alignment and domain information |
|---|
| >CHL00081 chlI Mg-protoporyphyrin IX chelatase | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12339 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03498 FliI_clade3 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06820 type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >PRK13975 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4252 consensus GTP-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR01040 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK13705 plasmid-partitioning protein SopA; Provisional | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 | Back alignment and domain information |
|---|
| >PF06564 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ protein is encoded immediately upstream of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae, and in several species is clearly part of the bcs operon | Back alignment and domain information |
|---|
| >PRK09099 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK13231 nitrogenase reductase-like protein; Reviewed | Back alignment and domain information |
|---|
| >KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >TIGR01026 fliI_yscN ATPase FliI/YscN family | Back alignment and domain information |
|---|
| >cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >PRK15453 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >PRK13948 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13946 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1698 | ||||
| 3sfz_A | 1249 | Crystal Structure Of Full-Length Murine Apaf-1 Leng | 1e-04 | ||
| 3shf_A | 1256 | Crystal Structure Of The R265s Mutant Of Full-Lengt | 6e-04 | ||
| 1z6t_A | 591 | Structure Of The Apoptotic Protease-activating Fact | 7e-04 |
| >pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 | Back alignment and structure |
|
| >pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 | Back alignment and structure |
| >pdb|1Z6T|A Chain A, Structure Of The Apoptotic Protease-activating Factor 1 Bound To Adp Length = 591 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 | Back alignment and structure |
|---|
Score = 162 bits (410), Expect = 7e-42
Identities = 68/565 (12%), Positives = 159/565 (28%), Gaps = 95/565 (16%)
Query: 40 LRTLDKELAYKREMVEQPVIQARRQGDEIYKRVEDWLNNVDDFTEDVVKSITGGEDEAKK 99
L L+ + + + E + R +R+ ++L ++ I +
Sbjct: 27 LTYLEGKNIFTEDHSELISKMSTRL-----ERIANFLRIYRRQASELGPLIDFFNYNNQS 81
Query: 100 RCFKGLCPNLIKRYSLGKKAVKAAKEGADLLGTGNFGTVSFRPTVERTTPVSYTAYEQF- 158
L + + A DLL R ++R + +
Sbjct: 82 HLADFL-----------EDYIDFAINEPDLLRPVVIAPQFSRQMLDRKLLLGNVPKQMTC 130
Query: 159 ---DSRMKIFQNIMEVLKDTNVGMIGVYGVNGVGKTTLVKQIA--MQVIEDKLFDKVVFV 213
+ + ++ + D + + ++G G GK+ + Q + +D +V++
Sbjct: 131 YIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWL 190
Query: 214 ---------------------------------------ERAEKLRQRLKNVKRVLVILD 234
+ L + L + D
Sbjct: 191 KDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFD 250
Query: 235 NIWKLLNLDAVGIPFGDVKKERNDDRSRCTVLLTSRNRDVLCNDMNSQKFFLIEVLSYEE 294
++ + R R L+T+R+ ++ + +F + L +E
Sbjct: 251 DVV-------------QEETIRWAQELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDE 297
Query: 295 AWCLFEKIVGDSAKASDFRVIADEIVRRCGGLPVAIKTIANALKNKRLYVWNDSLERLRN 354
+ E + ++ + G P + + + K +L +
Sbjct: 298 CYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLES 357
Query: 355 STSRQIHGMEENVYSSI----ELSYSFLKSEEEKSMFRLCALRKDGSPIPIDDLMRYGIG 410
+ + Y S+ + L S+E++S + G IP+
Sbjct: 358 RGLVGVECITPYSYKSLAMALQRCVEVL-SDEDRSALAFAVVMPPGVDIPVKLWSCVIPV 416
Query: 411 LGLFSNVRTSEAARNRVYTLVDNLKASSLLLDGDKDEV---KLHDIIYAVAVSIARDEFM 467
+ + + V + L LL G + V K+ II+ + + +
Sbjct: 417 DICSNEEEQLD---DEVADRLKRLSKRGALLSGKRMPVLTFKIDHIIHMFLKHVVDAQTI 473
Query: 468 FNIQSKDELKDKTQKDSIAISLPNRDIDELPERLECPKLSLFLLFAKYDSSLKIPDLFFE 527
N S E + + N ++ PER F + + K +
Sbjct: 474 ANGISILEQRLL--------EIGNNNVSV-PERHIPSHFQKFRRSSASEMYPKTTEETVI 524
Query: 528 GMNEL-RVVHFTRTCFLSLPSSLVC 551
+ + + + + SL + C
Sbjct: 525 RPEDFPKFMQLHQKFYDSLKNFACC 549
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1698 | ||||
| d2a5yb3 | 277 | c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor | 7e-22 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 4e-07 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 0.001 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 3e-04 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 0.002 | |
| d2i3ba1 | 189 | c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 | 3e-04 | |
| d1n8yc2 | 166 | c.10.2.5 (C:323-488) Protooncoprotein Her2 extrace | 0.002 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 0.004 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Score = 95.3 bits (236), Expect = 7e-22
Identities = 27/273 (9%), Positives = 71/273 (26%), Gaps = 64/273 (23%)
Query: 159 DSRMKIFQNIMEVLKDTNVGMIGVYGVNGVGKTTLVKQIA--MQVIEDKLFDKVVFV--- 213
+ + ++ + D + + ++G G GK+ + Q + +D +V++
Sbjct: 26 EYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDS 85
Query: 214 -------------------------------------ERAEKLRQRLKNVKRVLVILDNI 236
+ + L + D++
Sbjct: 86 GTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALID-RPNTLFVFDDV 144
Query: 237 WKLLNLDAVGIPFGDVKKERNDDRSRCTVLLTSRNRDVLCNDMNSQKFFLIEVLSYEEAW 296
+ R R L+T+R+ ++ + +F + L +E +
Sbjct: 145 V-------------QEETIRWAQELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECY 191
Query: 297 CLFEKIVGDSAKASDFRVIADEIVRRCGGLPVAIKTIANALKNKRLYVWNDSLERLRNST 356
E + ++ + G P + + + K +L +
Sbjct: 192 DFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESR- 250
Query: 357 SRQIHGMEENVYSSIELSYSFLKSEEEKSMFRL 389
V SY L + + +
Sbjct: 251 ------GLVGVECITPYSYKSL-AMALQRCVEV 276
|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1698 | |||
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 100.0 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.88 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.87 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.79 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.73 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.72 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.69 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.69 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.68 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.66 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.61 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.59 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.59 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.58 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.57 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.57 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.56 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.55 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.51 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.5 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.46 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 99.43 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.39 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.29 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.27 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.26 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.24 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.23 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.21 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.14 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 99.07 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 99.04 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 99.02 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.0 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 99.0 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 98.99 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 98.96 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 98.92 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 98.85 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 98.81 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 98.8 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 98.76 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.75 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 98.7 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 98.7 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 98.7 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 98.69 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.65 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 98.64 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 98.6 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 98.6 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 98.58 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 98.52 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 98.36 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 98.34 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 98.33 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 98.27 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 97.77 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 97.56 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.39 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.3 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 97.18 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 97.15 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 97.11 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 97.03 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 96.91 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 96.91 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 96.91 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 96.89 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 96.85 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 96.82 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 96.81 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 96.78 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.75 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 96.67 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 96.66 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 96.6 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 96.56 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 96.43 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 96.38 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 96.37 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 96.35 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 96.35 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 96.28 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 96.25 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 96.25 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 96.23 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 96.15 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 96.13 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 96.12 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 96.11 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 96.06 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 96.05 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 96.02 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 95.94 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 95.93 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 95.81 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.77 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 95.74 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 95.74 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 95.74 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 95.73 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 95.67 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 95.65 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 95.65 | |
| d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 95.61 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 95.59 | |
| d1fx0a3 | 276 | Central domain of alpha subunit of F1 ATP synthase | 95.57 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 95.54 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 95.53 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 95.53 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 95.44 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 95.43 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 95.4 | |
| d2jdia3 | 285 | Central domain of alpha subunit of F1 ATP synthase | 95.38 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 95.35 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 95.34 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 95.3 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 95.28 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 95.24 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 95.14 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 95.14 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 95.13 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 95.07 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 95.0 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 94.99 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 94.93 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 94.93 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 94.93 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 94.85 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 94.81 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 94.74 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 94.71 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 94.7 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 94.7 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 94.7 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 94.57 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 94.54 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 94.51 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 94.45 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 94.35 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 94.28 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 94.21 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 94.19 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 94.18 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 94.17 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 94.05 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 94.03 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 93.96 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 93.88 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 93.84 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 93.64 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 93.6 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 93.53 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 93.27 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 93.25 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 93.14 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 92.77 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 92.67 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 92.59 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 92.5 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 92.42 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 92.28 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 92.22 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 92.17 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 92.11 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 92.1 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 92.09 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 92.02 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 92.0 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 91.98 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 91.98 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 91.96 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 91.92 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 91.79 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 91.48 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 91.47 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 91.41 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 91.36 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 91.33 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 91.26 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 91.24 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 91.04 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 90.91 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 90.86 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 90.73 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 90.71 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 90.52 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 90.44 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 90.39 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 90.37 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 90.35 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 90.01 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 89.9 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 89.84 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 89.83 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 89.7 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 89.66 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 89.65 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 89.64 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 89.62 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 89.59 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 89.58 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 89.53 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 89.44 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 89.4 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 89.39 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 89.34 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 89.3 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 89.28 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 89.26 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 89.23 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 89.22 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 89.22 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 89.21 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 89.2 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 89.18 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 89.07 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 89.05 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 88.95 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 88.91 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 88.9 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 88.79 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 88.69 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 88.66 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 88.64 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 88.56 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 88.54 | |
| d1p6xa_ | 333 | Thymidine kinase {Equine herpesvirus type 4 [TaxId | 88.51 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 88.5 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 88.48 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 88.47 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 88.42 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 88.38 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 88.29 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 88.2 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 87.94 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 87.92 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 87.91 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 87.84 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 87.78 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 87.76 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 87.74 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 87.64 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 87.64 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 87.52 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 86.8 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 86.7 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 86.16 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 85.71 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 85.49 | |
| d1osna_ | 331 | Thymidine kinase {Varicella-zoster virus [TaxId: 1 | 85.45 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 85.37 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 85.3 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 85.03 | |
| d1e2ka_ | 329 | Thymidine kinase {Herpes simplex virus type 1, dif | 84.95 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 84.2 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 84.13 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 84.12 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 83.96 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 83.27 | |
| d1f5na2 | 277 | Interferon-induced guanylate-binding protein 1 (GB | 83.04 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 82.32 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 81.42 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 81.42 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 81.06 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 81.0 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 80.36 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Probab=100.00 E-value=1.5e-44 Score=299.76 Aligned_cols=214 Identities=13% Similarity=0.138 Sum_probs=176.2
Q ss_pred CCCCCCHHHHHHHHHHHHH---CCCCEEEEEECCCCCHHHHHHHHHHHHHH--HCCCCCEEEEH----------------
Q ss_conf 5454433999999999982---39953999995898509999999999986--40169999874----------------
Q 000302 155 YEQFDSRMKIFQNIMEVLK---DTNVGMIGVYGVNGVGKTTLVKQIAMQVI--EDKLFDKVVFV---------------- 213 (1698)
Q Consensus 155 ~~~~~gr~~~~~~l~~~L~---~~~~~vi~i~G~gGiGKTtLa~~v~~~~~--~~~~F~~~~~~---------------- 213 (1698)
...++||+.++++|+++|. +.+..+|+|+||||+||||||+++|++.. ...+|++++|+
T Consensus 19 ~~~~~gR~~~~~~i~~~L~~~~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs~~~~~~~l~~~~~ 98 (277)
T d2a5yb3 19 QMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTD 98 (277)
T ss_dssp CCCSCCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHHHHH
T ss_pred CCCEECCHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCHHHHHHHHH
T ss_conf 88623739999999999873468784089997799788899999999855655401276489999368777778999999
Q ss_pred ------------------------HHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEE
Q ss_conf ------------------------88999999997367199999293310111212576666433468999973999980
Q 000302 214 ------------------------ERAEKLRQRLKNVKRVLVILDNIWKLLNLDAVGIPFGDVKKERNDDRSRCTVLLTS 269 (1698)
Q Consensus 214 ------------------------~~~~~l~~~l~~~k~~LiVlDdv~~~~~~~~~~~~~~~~~~~~~~~~~gs~ilvTt 269 (1698)
.+...+...+. ++|+|+||||+|+..+|+.+ ...|||||+||
T Consensus 99 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~-~kr~LlVLDDv~~~~~~~~~-------------~~~~srilvTT 164 (277)
T d2a5yb3 99 ILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALID-RPNTLFVFDDVVQEETIRWA-------------QELRLRCLVTT 164 (277)
T ss_dssp HHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTT-STTEEEEEEEECCHHHHHHH-------------HHTTCEEEEEE
T ss_pred HHHHHHCCHHHCCCCCCHHHHHHHHHHHHHHHHHC-CCCEEEECCHHHHHHHHHHH-------------CCCCCEEEEEE
T ss_conf 99987220220278632123369999999999844-68816752506677665552-------------04575599996
Q ss_pred CCHHHHHCCCCCCCEEECCCCCHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCHHHHHHH
Q ss_conf 85132210168862398147999999999999838998887349999999999199807999999998217913599999
Q 000302 270 RNRDVLCNDMNSQKFFLIEVLSYEEAWCLFEKIVGDSAKASDFRVIADEIVRRCGGLPVAIKTIANALKNKRLYVWNDSL 349 (1698)
Q Consensus 270 r~~~v~~~~~~~~~~~~l~~L~~~~~~~lf~~~~~~~~~~~~~~~~~~~i~~~c~GlPlai~~~~~~L~~~~~~~w~~~~ 349 (1698)
|++.|+.......+.|+|++|+.+|||+||.+.++.....+..++++++|+++|+|+|||++++|+.|+.++...|.+..
T Consensus 165 R~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~~~~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k~~~~~~~~~ 244 (277)
T d2a5yb3 165 RDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLN 244 (277)
T ss_dssp SBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC--CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSSHHHHHHHH
T ss_pred EHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCHHHHHHHH
T ss_conf 44899986378871687788997999999999847766742567999999999589989999999986559899999999
Q ss_pred HHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHH
Q ss_conf 99970234324764278999999988128916799999885
Q 000302 350 ERLRNSTSRQIHGMEENVYSSIELSYSFLKSEEEKSMFRLC 390 (1698)
Q Consensus 350 ~~l~~~~~~~~~~~~~~i~~~l~~sy~~L~~~~lk~cfl~~ 390 (1698)
+.+.... ...+..++.+||++||++ +|+||.++
T Consensus 245 ~~L~~~~-------~~~v~~il~~sY~~L~~~-lk~c~~~l 277 (277)
T d2a5yb3 245 NKLESRG-------LVGVECITPYSYKSLAMA-LQRCVEVL 277 (277)
T ss_dssp HHHHHHC-------SSTTCCCSSSSSSSHHHH-HHHHHHTS
T ss_pred HHHHCCC-------HHHHHHHHHHHHHCCCHH-HHHHHHHC
T ss_conf 9973486-------788999999988512699-99999739
|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|