Citrus Sinensis ID: 000375

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------1450------1460------1470------1480------1490------1500------1510------1520------1530------1540------1550------1560------1570------1580------1590------1600------161

MGGEDANVNSIIELSYNFLESEEAKSLFRLCGLLNGGSQIPIDALMRCGMGLGLLKGVYTLQEARKRVHMLVNFLKASRLLLDGDAEECLKMHDIIHSIAASVATEELMFNMQNVADLKEELDKKTHKDPTAISIPFRGIYEFPERLECPKLKLFVLFSENLSLRIPDLFFEGMTELRVLSFTGFRFPSLPSSIGCLISLRTLTLESCLLGDVATIGDLKKLEILSLRHSDVEELPGEIGQLTRLKLLDLSNCMKLKVIRPNVISSLSRLEELYMGNSFTEWEIEGQSNASLVELKQLSRLTTLEVHIPDAQVMPQDLLSVELERYRICIGDVWSWSGEHETSRRLKLSALNKCIYLGYGMQMLLKGIEDLYLDELNGFQNALLELEDGEVFPLLKHLHVQNVCEILYIVNLVGWEHCNAFPLLESLFLHNLMRLEMVYRGQLTEHSFSKLRIIKVCQCDNLKHLFSFPMARNLLQLQKLKVSFCESLKLIVGKESSETHNVHEIINFTQLHSLTLQCLPQLTSSGFDLERPLLSPTISATTLAFEEVIAEDDSDESLFNNKVIFPNLEKLKLSSINIEKIWHDQYPLMLNSCSQNLTNLTVETCSRLKFLFSYSMVDSLVRLQQLEIRKCESMEAVIDTTDIEINSVEFPSLHHLRIVDCPNLRSFISVNSSEEKILHTDTQPLFDEKLVLPRLEVLSIDMMDNMRKIWHHQLALNSFSKLKALEVTNCGKLANIFPANIIMRRRLDRLEYLKVDGCASVEEIIGETSSNGNICVEEEEDEEARRRFVFPRLTWLNLSLLPRLKSFCPGVDISEWPLLKSLGVFGCDSVEILFASPEYFSCDSQRPLFVLDPKVAFPGLKELELNKLPNLLHLWKENSQLSKALLNLATLEISECDKLEKLVPSSVSLENLVTLEVSKCNELIHLMTLSTAESLVKLNRMNVIDCKMLQQIILQVGEEVKKDCIVFGQFKYLGLHCLPCLTSFCLGNFTLEFPCLEQVIVRECPKMKIFSQGVLHTPKLQRLHLREKYDEGLWEGSLNSTIQKLFEEMVGYHDKACLSLSKFPHLKEIWHGQALPVSFFINLRWLVVDDCRFMSGAIPANQLQNLINLKTLEVRNCYFLEQVFHLEEQNPIGQFRSLFPKLRNLKLINLPQLIRFCNFTGRIIELPSLVNLWIENCRNMKTFISSSTPVIIAPNKEPQQMTSQENLLADIQPLFDEKVKLPSLEVLGISQMDNLRKIWQDRLSLDSFCKLNCLVIQRCKKLLSIFPWNMLQRLQKLEKLEVVYCESVQRISELRALNYGDARAISVAQLRETLPICVFPLLTSLKLRSLPRLKCFYPGVHISEWPMLKYLDISGCAELEILASKFLSLGETHVDGQHDSQTQQPFFSFDKVAFPSLKELRLSRLPKLFWLCKETSHPRNVFQNECSKLDILVPSSVSFGNLSTLEVSKCGRLMNLMTISTAERLVNLERMNVTDCKMIQQIIQQVGEVEKDCIVFSQLKYLGLHCLPSLKSFCMGNKALEFPCLEQVIVEECPKMKIFSQGVLHTPKLRRLQLTEEDDEGRWEGNLNSTIQKLFVEMVCADLTKFLMQFPCICTVLFHFLCFIFLE

cccccccHHHHHHccccccccccHHHHHcccccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccccccccEEEEccHHHHHHHHHHHcccEEEEEcccccccccccccEEcEEEEEcccccccccccccccccEEEEEEccccccccccHHHHccccccEEEEEcccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccHHHcccccccEEEEcccccccccccccccccccccEEEccccccEEEEcccccccHHHHcccccccEEEEEcccccccHHccHHHHHccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccEEEEccccccccccccccccEEEEEccccccEEccccccccccccccEEEEEcccccccccccccccccccccEEEEEEccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccEEEEccccccccccccccccccccEEEEEccccccccccccccccccccccccEEEEccccccccccccccccccccccEEEEEcccccccccccccccccccccccccEEEEEccccccccccccccHHHHHccccccccccccccccccEEEEcccccccccccccccccccccccEEEEEEcccccccccccHHHHcccccccEEEEcccccccHHccccccccccccccccHHHHHcccccccccEEEcccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccEEEEccccccccccccccHHHHccccccEEEEccccccccccccccccccccEEEEccccccccccccccccccccccEEEEccccHHHHHHHHHcccccccccccccccEEEEEEccccccccccccccccccccEEEEccccccccccccccccccccEEEEccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEccccccEEEcccccccccccccccccccEEEEEccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccEEccccccccccccccEEEEEcccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccEEEEccccccccHHccccccccEEEccccccccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccccccccccccEEEEEcccccccccccHHccccccccEEEEEEcccccHHccccccccccccccccccEEEcccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEccccccccccccHHHHHHHHEEEEEcccccccccccccHHHccccEEEEEEc

cccccccccHHEEEcHcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccccccccccEEEHHHHHHHHHHHHHcccEEEEEEccccccccccccccccEEEEEEEcccccccccHccccccEEEEEccccccccccHHHHHHcccEEEEEEcccccccccccHHccHcccEEEcccccccccccHcHccccEEEEEcccccHHccHHHHHHHcccEEEccccccccccccHHHHcHHHccEEEEEEccccccccccccccHHHHHccccccEEEEEcccccccHHHHHHHHHHHcEEEcccccccccccccccEEEEEEccccccccccccccccccEEEEEcccccccccccccccccccccccEEEEEccccEEEcccccccccccccccccEEEEcccHcHHHccccccccccccccEEEEEccccHHHccccccHHccccccEEEEEcccccHHHccccccccccccccccccccccEEEEcccccccccccccccccccHHHHHcccccHHHHcccccccccccccccccccccEEEccccHHHHccccccccHccccccccEEEEcccccHHcccccccccccccccEEEEccccccccccccccccccccccccccEEEEcccccccEcccccccHHHHHHcccccccccccccccccEEEEcccccccHcccccccccccccccEEEEcccccHHcccccccccccccccccEEEEcccccHHcccHccccHHHHHHHHccccccccccccccccEEEEEcccccccccccccccccccccEEEEcccccHHHccccccccHHcccccccccccccccccccEEEEEccccccEccccccccccccccccEEEccccccHcccccccccccccEEEEEcccHHHcccccccHHHHcHcccEEEEcccccccEccccccccccccccccccccEEEEcccHHHHHccccccccccccccEEEEccccccccccccccccccccEEEEcccccHccccccccccccHcccccccccccccccHHccccHHHccccccccccccccccEEEEcccccHcccccccHHcccccccEEEEcccccHHHcccccccccccccccccccccccEEcccHHHHHcccccccccccccccEEEEccccccccccccccHHHHHHHHcccEEEEccccccccccccccccccccccEEEEcccccHHHHcccccccccccccEEEEEcccccccccccccHccccccccEEEEcccccHHHccccccccHHHHccccccccHccccccccccccEEEEcccccHccccccccccccccccEEEEcccccHHccccccccHHHcccccccccccccccccccccccccccEEEccccccHHHHccccccccEEEEccccccccccccccccccccEEEEcccHHHcccccccHHHHHHHHcEEEEcccccHHHccHcccccccccEEcccccccccccccccccccccccccccccccEEEEEccccccEccccccccccccEEEEEcccccccccccHHHHHHHHHHHHccHHHHHHHHcccccHHHHHHHHHHHHcc

MGGEDANVNSIIELSYNFLESEEAKSLFRLCgllnggsqipidALMRCGMGLGLLKGVYTLQEARKRVHMLVNFLKASRLLLDGDAEECLKMHDIIHSIAASVATEELMFNMQNVADLKEELdkkthkdptaisipfrgiyefperlecpklkLFVLFSEnlslripdlffeGMTELRVLSftgfrfpslpssigclislrtltlescllgdvatigdlkKLEILSLrhsdveelpgeigqltrlklldlsncmklkvirpnVISSLSRLEElymgnsfteweiegqsnASLVELKqlsrlttlevhipdaqvmpqDLLSVELERYRICIgdvwswsgehetSRRLKLSALNKCIYLGYGMQMLLKGIEDLYLDELNGFQNALLeledgevfpllkHLHVQNVCEILYIVNLVgwehcnafpLLESLFLHNLMRLEMVYrgqltehsfSKLRIIKVcqcdnlkhlfsfpmARNLLQLQKLKVSFCESLKLivgkessethnVHEIINFTQLhsltlqclpqltssgfdlerpllsptisatTLAFEEViaeddsdeslfnnkvifpnleklklssiNIEKIwhdqyplmlnscsqnltnltvetcSRLKFLFSYSMVDSLVRLQQLEIRKCESMEAVIDttdieinsvefpslhhlrivdcpnlrsfisvnsseekilhtdtqplfdeklvlprleVLSIDMMDNMRKIWHHQLALNSFSKlkalevtncgklanifpaniIMRRRLDRLeylkvdgcaSVEEIIGetssngnicveeeedeEARRRfvfprltwlnlsllprlksfcpgvdisewpllkslgvfgcdsvEILFaspeyfscdsqrplfvldpkvafpglkelelnklpnLLHLWKENSQLSKALLNLATLEIsecdkleklvpssvslenLVTLEVSKCNELIHLMTLSTAESLVKLNRMNVIDCKMLQQIILQVGEEVKKDcivfgqfkylglhclpcltsfclgnftlefpcleqvivrecpkmkifsqgvlhtpklqrLHLREKYdeglwegsLNSTIQKLFEEMVGYHDkaclslskfphlkeiwhgqalpvsfFINLRWLVvddcrfmsgaipanqlqnlinlktlevrncyFLEQVfhleeqnpigqfrslfpklrnlklinlpqlirfCNFTgriielpslVNLWIENCRNMktfissstpviiapnkepqqmTSQENLLADIQplfdekvklpslevlgiSQMDNLRKIWQDRLSLDSFCKLNCLVIQRCKKLLSIFPWNMLQRLQKLEKLEVVYCESVQRISELRALNYGDARAISVAQLRETlpicvfplltslklrslprlkcfypgvhisewpmlkyldisgcAELEILASKFLslgethvdgqhdsqtqqpffsfdkvafpslkelrlsrlpKLFWLcketshprnvfqnecskldilvpssvsfgnlstlevskcgrlmnlmTISTAERLVNLERMNVTDCKMIQQIIQQVGEVEKDCIVFSQlkylglhclpslksfcmgnkalefpcleqviveecpkmkifsqgvlhtpklrrlqlteeddegrwegnLNSTIQKLFVEMVCADLTKFLmqfpcictVLFHFLCFIFLE

mggedanvnSIIELSYNFLESEEAKSLFRLCGLLNGGSQIPIDALMRCGMGLGLLKGVYTLQEARKRVHMLVNFLKASRLLLDGDAEECLKMHDIIHSIAASVATEELMFNMQNVADLKEELDkkthkdptaisipfrGIYEFPERLECPKLKLFVLFSENLSLRIPDLFFEGMTELRVLSFTGFRFPSLPSSIGCLISLRTLTLESCLLGDVATIGDLKKLEILSLrhsdveelpgeigqltrLKLLDLSNCMKLKVIRPNVISSLSRLEELYMGNSFTEWEIEGQSNASLVELKQLSRLTTLevhipdaqvmPQDLLSVELERYRICIGdvwswsgehetSRRLKLSALNKCIYLGYGMQMLLKGIEDLYLDELNGFQNALLELEDGEVFPLLKHLHVQNVCEILYIVNLVGWEHCNAFPLLESLFLHNLMRLEMVYRGQLTEHSFSKLRIIKVCQCDNLKHLFSFPMARNLLQLQKLKVSFCESLKLIVGKESSETHNVHEIINFTQLHSLTLQCLPQLTSSGFDLERPLLSPTISATTLAFEEVIAeddsdeslfnNKVIFPNLEKLKLSSINIEKIWHDQYPLMLNSCSQNLTNLTVETCSRLKFLFSYSMVDSLVRLQQLEIRKCESMEAVIDTTDIEINSVEFPSLHHLRIVDCPNLRSFISVNSSEEKIlhtdtqplfdeklvLPRLEVLSIDMMDNMRKIWHHQLALNSFSKLKALEVTNCgklanifpaniiMRRRLDRLEYLKVDGCASVEeiigetssngnicVEEEEDEEARRRFVFPRLTWLNLSLLPRLKSFCPGVDISEWPLLKSLGVFGCDSVEILFASPEYFSCDSQRPLFVLDPKVAFPGLKELELNKLPNLLHLWKENSQLSKALLNLATLEISECDKLEKLVPSSVSLENLVTLEVSKCNELIHLMTLSTAESLVKLNRMNVIDCKMLQQIILQVGEEVKKDCIVFGQFKYLGLHCLPCLTSFCLGNFTLEFPCLEQVIVRECPKMKIfsqgvlhtpklqrLHLREKYDEGLWEGSLNSTIQKLFEEMVGYHDKACLSLSKFPHLKEIWHGQALPVSFFINLRWLVVDDCRFMSGAIPANQLQNLINLKTLEVRNCYFLEQVFHLEEQNPIGQFRSLFPKLRNLKLINLPQLIRFCNFTGRIIELPSLVNLWIENCRNMKTFISSSTPVIIAPNKEPQQMTSQENLLADIQPLFDEKVKLPSLEVLGISQMDNLRKIWQDRLSLDSFCKLNCLVIQRCKKLLSIFPWNMLQRLQKLEKLEVVYCESVQRISELRALNYGDARAISVAQLRETLPICVFPLltslklrslprLKCFYPGVHISEWPMLKYLDISGCAELEILASKFLSLGETHVDGQHDSQTQQPFFSFDKVAFPSLKELRLSRLPKLFWLCKETSHPRNVFQNECSKLDILVPSSVSFGNLSTLEVSKCGRLMNLMTISTAERLVNLERMNVTDCKMIQQIIQQVGEVEKDCIVFSQLKYLGLHCLPSLKSFCMGNKALEFPCLEQVIVEECPKMKIfsqgvlhtpklrRLQLteeddegrwegnlNSTIQKLFVEMVCADLTKFLMQFPCICTVLFHFLCFIFLE

MGGEDANVNSIIELSYNFLESEEAKSLFRLCGLLNGGSQIPIDALMRCGMGLGLLKGVYTLQEARKRVHMLVNFLKASRLLLDGDAEECLKMHDIIHSIAASVATEELMFNMQNVADLKEELDKKTHKDPTAISIPFRGIYEFPERLECPKLKLFVLFSENLSLRIPDLFFEGMTELRVLSFTGFRFPSLPSSIGCLISLRTLTLESCLLGDVATIGDLKKLEILSLRHSDVEELPGEIGQLTRLKLLDLSNCMKLKVIRPNVISSLSRLEELYMGNSFTEWEIEGQSNASLVELKQLSRLTTLEVHIPDAQVMPQDLLSVELERYRICIGDVWSWSGEHETSRRLKLSALNKCIYLGYGMQMLLKGIEDLYLDELNGFQNALLELEDGEVFPLLKHLHVQNVCEILYIVNLVGWEHCNAFPLLESLFLHNLMRLEMVYRGQLTEHSFSKLRIIKVCQCDNLKHLFSFPMARNLLQLQKLKVSFCESLKLIVGKESSETHNVHEIINFTQLHSLTLQCLPQLTSSGFDLERPLLSPTISATTLAFEEVIAEDDSDESLFNNKVIFPNLEKLKLSSINIEKIWHDQYPLMLNSCSQNLTNLTVETCSRLKFLFSYSMVDSLVRLQQLEIRKCESMEAVIDTTDIEINSVEFPSLHHLRIVDCPNLRSFISVNSSEEKILHTDTQPLFDEKLVLPRLEVLSIDMMDNMRKIWHHQLALNSFSKLKALEVTNCGKLANIFPANIIMRRRLDRLEYLKVDGCASVEEIIGETSSNGNICVeeeedeeARRRFVFPRLTWLNLSLLPRLKSFCPGVDISEWPLLKSLGVFGCDSVEILFASPEYFSCDSQRPLFVLDPKVAFPGlkelelnklpnllhlWKENSQLSKALLNLATLEISECDKLEKLVPSSVSLENLVTLEVSKCNELIHLMTLSTAESLVKLNRMNVIDCKMLQQIILQVGEEVKKDCIVFGQFKYLGLHCLPCLTSFCLGNFTLEFPCLEQVIVRECPKMKIFSQGVLHTPKLQRLHLREKYDEGLWEGSLNSTIQKLFEEMVGYHDKACLSLSKFPHLKEIWHGQALPVSFFINLRWLVVDDCRFMSGAIPANQLQNLINLKTLEVRNCYFLEQVFHLEEQNPIGQFRSLFPKLRNLKLINLPQLIRFCNFTGRIIELPSLVNLWIENCRNMKTFISSSTPVIIAPNKEPQQMTSQENLLADIQPLFDEKVKLPSLEVLGISQMDNLRKIWQDRLSLDSFCKLNCLVIQRCKKLLSIFPWNMLQRLQKLEKLEVVYCESVQRISELRALNYGDARAISVAQLRETLPICVFPLLTSLKLRSLPRLKCFYPGVHISEWPMLKYLDISGCAELEILASKFLSLGETHVDGQHDSQTQQPFFSFDKVAFPSLKELRLSRLPKLFWLCKETSHPRNVFQNECSKLDILVPSSVSFGNLSTLEVSKCGRLMNLMTISTAERLVNLERMNVTDCKMiqqiiqqVGEVEKDCIVFSQLKYLGLHCLPSLKSFCMGNKALEFPCLEQVIVEECPKMKIFSQGVLHTPKLRRLQLTEEDDEGRWEGNLNSTIQKLFVEMVCADLTKFLMQFPCICTVLFHFLCFIFLE

********NSIIELSYNFLESEEAKSLFRLCGLLNGGSQIPIDALMRCGMGLGLLKGVYTLQEARKRVHMLVNFLKASRLLLDGDAEECLKMHDIIHSIAASVATEELMFNMQNVADL***********PTAISIPFRGIYEFPERLECPKLKLFVLFSENLSLRIPDLFFEGMTELRVLSFTGFRFPSLPSSIGCLISLRTLTLESCLLGDVATIGDLKKLEILSLRHSDVEELPGEIGQLTRLKLLDLSNCMKLKVIRPNVISSLSRLEELYMGNSFTEWEIEGQSNASLVELKQLSRLTTLEVHIPDAQVMPQDLLSVELERYRICIGDVWSWSGEHETSRRLKLSALNKCIYLGYGMQMLLKGIEDLYLDELNGFQNALLELEDGEVFPLLKHLHVQNVCEILYIVNLVGWEHCNAFPLLESLFLHNLMRLEMVYRGQLTEHSFSKLRIIKVCQCDNLKHLFSFPMARNLLQLQKLKVSFCESLKLIVGKESSETHNVHEIINFTQLHSLTLQCLPQLTSSGFDLERPLLSPTISATTLAFEEVIAEDDSDESLFNNKVIFPNLEKLKLSSINIEKIWHDQYPLMLNSCSQNLTNLTVETCSRLKFLFSYSMVDSLVRLQQLEIRKCESMEAVIDTTDIEINSVEFPSLHHLRIVDCPNLRSFISVNSSEEKILHTDTQPLFDEKLVLPRLEVLSIDMMDNMRKIWHHQLALNSFSKLKALEVTNCGKLANIFPANIIMRRRLDRLEYLKVDGCASVEEIIG********************RFVFPRLTWLNLSLLPRLKSFCPGVDISEWPLLKSLGVFGCDSVEILFASPEYFSCDSQRPLFVLDPKVAFPGLKELELNKLPNLLHLWKENSQLSKALLNLATLEISECDKLEKLVPSSVSLENLVTLEVSKCNELIHLMTLSTAESLVKLNRMNVIDCKMLQQIILQVGEEVKKDCIVFGQFKYLGLHCLPCLTSFCLGNFTLEFPCLEQVIVRECPKMKIFSQGVLHTPKLQRLHLREKYDEGLWEGSLNSTIQKLFEEMVGYHDKACLSLSKFPHLKEIWHGQALPVSFFINLRWLVVDDCRFMSGAIPANQLQNLINLKTLEVRNCYFLEQVFHLEEQNPIGQFRSLFPKLRNLKLINLPQLIRFCNFTGRIIELPSLVNLWIENCRNMKTFISSSTPVII**************LLADIQPLFDEKVKLPSLEVLGISQMDNLRKIWQDRLSLDSFCKLNCLVIQRCKKLLSIFPWNMLQRLQKLEKLEVVYCESVQRISELRALNYGDARAISVAQLRETLPICVFPLLTSLKLRSLPRLKCFYPGVHISEWPMLKYLDISGCAELEILASKFLSLGETHVD********QPFFSFDKVAFPSLKELRLSRLPKLFWLCKETSHPRNVFQNECSKLDILVPSSVSFGNLSTLEVSKCGRLMNLMTISTAERLVNLERMNVTDCKMIQQIIQQVGEVEKDCIVFSQLKYLGLHCLPSLKSFCMGNKALEFPCLEQVIVEECPKMKIFSQGVLHTPKLRRLQLTEE*DEGRWEGNLNSTIQKLFVEMVCADLTKFLMQFPCICTVLFHFLCFIFL*

*GGEDANVNSIIELSYNFLESEEAKSLFRLCGLLNGGSQIPIDALMRCGMGLGLLKGVYTLQEARKRVHMLVNFLKASRLLLDGDAEECLKMHDIIHSIAASVATEELMFNMQNVADLKEELDKKTHKDPTAISIPFRGIYEFPERLECPKLKLFVLFSENLSLRIPDLFFEGMTELRVLSFTGFRFPSLPSSIGCLISLRTLTLESCLLGDVATIGDLKKLEILSLRHSDVEELPGEIGQLTRLKLLDLSNCMKLKVI*****SSLSRLEELYMGNSFTEWEIE***********QLSRLTTLEVHIPDAQVMPQDLLSVELERYRICIGDVWSWSGEHETSRRLKLSALNKCIYLGYGMQMLLKGIEDLYLDELNGFQNALLELEDGEVFPLLKHLHVQNVCEILYIVNLVGWEHCNAFPLLESLFLHNLMRLEMVYRGQLTEHSFSKLRIIKVCQCDNLKHLFSFPMARNLLQLQKLKVSFCESLKLIVGK***********INFTQLHSLTLQCLPQLTSSGFDLERPLLSPTISATTLAFEEVIAEDDSDESLFNNKVIFPNLEKLKLSSINIEKIWHDQYPLMLNSCSQNLTNLTVETCSRLKFLFSYSMVDSLVRLQQLEIRKCESMEAVIDTTDIEINSVEFPSLHHLRIVDCPNLRSFISVNSSEEK*L*TDTQPLFDEKLVLPRLEVLSIDMMDNMRKIWHHQLALNSFSKLKALEVTNCGKLANIFPANIIMRRRLDRLEYLKVDGCASVEEIIGETSSNGNICVEEEEDEEARRRFVFPRLTWLNLSLLPRLKSFCPGVDISEWPLLKSLGVFGCDSVEILFASPEYFSCDSQRPLFVLDPKVAFPGLKELELNKLPNLLHLWKENSQLSKALLNLATLEISECDKLEKLVPSSVSLENLVTLEVSKCNELIHLMT*****SLVKLNRMNVIDCKMLQQI************IVFGQFKYLGLHCLPCLTSFCLGNFTLEFPCLEQVIVRECPKMKIFSQGVLHTPKLQRLHLREKYDEGLWEGSLNSTIQKLFEEMVGYHDKACLSLSKFPHLKEIWHGQALPVSFFINLRWLVVDDCRFMSGAIPANQLQNLINLKTLEVRNCYFLEQVFHLE**********LFPKLRNLKLINLPQLIRFCNFTGRIIELPSLVNLWIENCRNMKTFISSSTPVIIAPNKEPQQMTSQENLLADIQPLFDEKVKLPSLEVLGISQMDNLRKIWQDRLSLDSFCKLNCLVIQRCKKLLSIFPWNMLQRLQKLEKLEVVYCESVQRISELRALNYGDARAISVAQLRETLPICVFPLLTSLKLRSLPRLKCFYPGVHISEWPMLKYLDISGCAELEILASKFLSLGETHVDGQHDSQTQQP*FSFDKVAFPSLKELRLSRLPKLFWLCKETSHPRNVFQNECSKLDILVPSSVSFGNLSTLEVSKCGRLMNLMTISTAERLVNLERMNVTDCKMIQ*************IVFSQLKYLGLHCLPSLKSFCMGNKALEFPCLEQVIVEECPKMKIFSQGVLHTPKLRRLQLTEEDDEGRWEGNLNSTIQKLFVEMVCADLTKFLMQFPCICTVLFHFLCFIFLE

MGGEDANVNSIIELSYNFLESEEAKSLFRLCGLLNGGSQIPIDALMRCGMGLGLLKGVYTLQEARKRVHMLVNFLKASRLLLDGDAEECLKMHDIIHSIAASVATEELMFNMQNVADLKEELDKKTHKDPTAISIPFRGIYEFPERLECPKLKLFVLFSENLSLRIPDLFFEGMTELRVLSFTGFRFPSLPSSIGCLISLRTLTLESCLLGDVATIGDLKKLEILSLRHSDVEELPGEIGQLTRLKLLDLSNCMKLKVIRPNVISSLSRLEELYMGNSFTEWEIEGQSNASLVELKQLSRLTTLEVHIPDAQVMPQDLLSVELERYRICIGDVWSWSGEHETSRRLKLSALNKCIYLGYGMQMLLKGIEDLYLDELNGFQNALLELEDGEVFPLLKHLHVQNVCEILYIVNLVGWEHCNAFPLLESLFLHNLMRLEMVYRGQLTEHSFSKLRIIKVCQCDNLKHLFSFPMARNLLQLQKLKVSFCESLKLIVGKESSETHNVHEIINFTQLHSLTLQCLPQLTSSGFDLERPLLSPTISATTLAFEEVIAEDDSDESLFNNKVIFPNLEKLKLSSINIEKIWHDQYPLMLNSCSQNLTNLTVETCSRLKFLFSYSMVDSLVRLQQLEIRKCESMEAVIDTTDIEINSVEFPSLHHLRIVDCPNLRSFISVNSSEEKILHTDTQPLFDEKLVLPRLEVLSIDMMDNMRKIWHHQLALNSFSKLKALEVTNCGKLANIFPANIIMRRRLDRLEYLKVDGCASVEEIIGETSSNGNICV********RRRFVFPRLTWLNLSLLPRLKSFCPGVDISEWPLLKSLGVFGCDSVEILFASPEYFSCDSQRPLFVLDPKVAFPGLKELELNKLPNLLHLWKENSQLSKALLNLATLEISECDKLEKLVPSSVSLENLVTLEVSKCNELIHLMTLSTAESLVKLNRMNVIDCKMLQQIILQVGEEVKKDCIVFGQFKYLGLHCLPCLTSFCLGNFTLEFPCLEQVIVRECPKMKIFSQGVLHTPKLQRLHLREKYDEGLWEGSLNSTIQKLFEEMVGYHDKACLSLSKFPHLKEIWHGQALPVSFFINLRWLVVDDCRFMSGAIPANQLQNLINLKTLEVRNCYFLEQVFHLEEQNPIGQFRSLFPKLRNLKLINLPQLIRFCNFTGRIIELPSLVNLWIENCRNMKTFISSSTPVIIAPNKEPQQMTSQENLLADIQPLFDEKVKLPSLEVLGISQMDNLRKIWQDRLSLDSFCKLNCLVIQRCKKLLSIFPWNMLQRLQKLEKLEVVYCESVQRISELRALNYGDARAISVAQLRETLPICVFPLLTSLKLRSLPRLKCFYPGVHISEWPMLKYLDISGCAELEILASKFLSLGETHVDGQHDSQTQQPFFSFDKVAFPSLKELRLSRLPKLFWLCKETSHPRNVFQNECSKLDILVPSSVSFGNLSTLEVSKCGRLMNLMTISTAERLVNLERMNVTDCKMIQQIIQQVGEVEKDCIVFSQLKYLGLHCLPSLKSFCMGNKALEFPCLEQVIVEECPKMKIFSQGVLHTPKLRRLQLTEEDDEGRWEGNLNSTIQKLFVEMVCADLTKFLMQFPCICTVLFHFLCFIFLE

****DANVNSIIELSYNFLESEEAKSLFRLCGLLNGGSQIPIDALMRCGMGLGLLKGVYTLQEARKRVHMLVNFLKASRLLLDGDAEECLKMHDIIHSIAASVATEELMFNMQNVADLKEELDKKTHKDPTAISIPFRGIYEFPERLECPKLKLFVLFSENLSLRIPDLFFEGMTELRVLSFTGFRFPSLPSSIGCLISLRTLTLESCLLGDVATIGDLKKLEILSLRHSDVEELPGEIGQLTRLKLLDLSNCMKLKVIRPNVISSLSRLEELYMGNSFTEWEIEGQSNASLVELKQLSRLTTLEVHIPDAQVMPQDLLSVELERYRICIGDVWSWSGEHETSRRLKLSALNKCIYLGYGMQMLLKGIEDLYLDELNGFQNALLELEDGEVFPLLKHLHVQNVCEILYIVNLVGWEHCNAFPLLESLFLHNLMRLEMVYRGQLTEHSFSKLRIIKVCQCDNLKHLFSFPMARNLLQLQKLKVSFCESLKLIVGKESSETHNVHEIINFTQLHSLTLQCLPQLTSSGFDLERPLLSPTISATTLAFEEVIAEDDSDESLFNNKVIFPNLEKLKLSSINIEKIWHDQYPLMLNSCSQNLTNLTVETCSRLKFLFSYSMVDSLVRLQQLEIRKCESMEAVIDTTDIEINSVEFPSLHHLRIVDCPNLRSFISVNSSEEKILHTDTQPLFDEKLVLPRLEVLSIDMMDNMRKIWHHQLALNSFSKLKALEVTNCGKLANIFPANIIMRRRLDRLEYLKVDGCASVEEIIGETSSNGNICVEEEEDEEARRRFVFPRLTWLNLSLLPRLKSFCPGVDISEWPLLKSLGVFGCDSVEILFASPEYFSCDSQRPLFVLDPKVAFPGLKELELNKLPNLLHLWKENSQLSKALLNLATLEISECDKLEKLVPSSVSLENLVTLEVSKCNELIHLMTLSTAESLVKLNRMNVIDCKMLQQIILQVGEEVKKDCIVFGQFKYLGLHCLPCLTSFCLGNFTLEFPCLEQVIVRECPKMKIFSQGVLHTPKLQRLHLREKYDEGLWEGSLNSTIQKLFEEMVGYHDKACLSLSKFPHLKEIWHGQALPVSFFINLRWLVVDDCRFMSGAIPANQLQNLINLKTLEVRNCYFLEQVFHLEEQNPIGQFRSLFPKLRNLKLINLPQLIRFCNFTGRIIELPSLVNLWIENCRNMKTFISSSTPVIIAPNKEPQQMTSQENLLADIQPLFDEKVKLPSLEVLGISQMDNLRKIWQDRLSLDSFCKLNCLVIQRCKKLLSIFPWNMLQRLQKLEKLEVVYCESVQRISELRALNYGDARAISVAQLRETLPICVFPLLTSLKLRSLPRLKCFYPGVHISEWPMLKYLDISGCAELEILASKFLSLGETHVDGQHDSQTQQPFFSFDKVAFPSLKELRLSRLPKLFWLCKETSHPRNVFQNECSKLDILVPSSVSFGNLSTLEVSKCGRLMNLMTISTAERLVNLERMNVTDCKMIQQIIQQVGEVEKDCIVFSQLKYLGLHCLPSLKSFCMGNKALEFPCLEQVIVEECPKMKIFSQGVLHTPKLRRLQLTEEDDEGRWEGNLNSTIQKLFVEMVCADLTKFLMQFPCICTVLFHFLCFIFLE

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHi

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		1607	2.2.26 [Sep-21-2011]
Q9T048		985	Disease resistance protei	yes	no	0.301	0.492	0.268	2e-32
O81825		919	Probable disease resistan	no	no	0.310	0.542	0.285	7e-26
Q42484		909	Disease resistance protei	no	no	0.277	0.490	0.247	3e-24
Q9FLB4		874	Putative disease resistan	no	no	0.151	0.279	0.258	8e-09
Q9C8T9		898	Putative disease resistan	no	no	0.177	0.318	0.243	7e-08
Q9LVT4		843	Probable disease resistan	no	no	0.141	0.269	0.253	4e-07
P60839		884	Probable disease resistan	no	no	0.070	0.127	0.346	2e-06
Q9RBS2		1024	Protein PopC OS=Ralstonia	yes	no	0.065	0.103	0.385	2e-06
Q940K0		889	Probable disease resistan	no	no	0.136	0.246	0.264	2e-06
Q96NW7		1537	Leucine-rich repeat-conta	yes	no	0.049	0.052	0.430	3e-06

>sp\|Q9T048\|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1	Back alignment and function desciption

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 148/551 (26%), Positives = 260/551 (47%), Gaps = 66/551 (11%)

Query: 12  IELSYNFLESEEAKSLFRLCGLLNGGSQIPIDALMRCGMGLGLLKGVYTLQEARKRVHML 71
           ++LSY+FLE ++AK  F LC L      I +  ++R  M  G ++ + + +++       
Sbjct: 383 LKLSYDFLE-DKAKFCFLLCALFPEDYSIEVTEVVRYWMAEGFMEELGSQEDSMNEGITT 441

Query: 72  VNFLKASRLLLDGDAEECLKMHDIIHSIAASVAT------EELMFNMQNVADLKEELDKK 125
           V  LK   LL DGD  + +KMHD++   A  + +        L+ +   + D++++   K
Sbjct: 442 VESLKDYCLLEDGDRRDTVKMHDVVRDFAIWIMSSSQDDSHSLVMSGTGLQDIRQD---K 498

Query: 126 THKDPTAISIPFRGIYEFPERLE--CPKLKLFVLFSENLSLRIPDLFFEGMTELRVLSFT 183
                  +S+    +   P+ +E  C K  + +L    L   +P  F +    LR+L+ +
Sbjct: 499 LAPSLRRVSLMNNKLESLPDLVEEFCVKTSVLLLQGNFLLKEVPIGFLQAFPTLRILNLS 558

Query: 184 GFRFPSLPS-SIGCLISLRTLTLESCL-LGDVATIGDLKKLEILSLRHSDVEELPGEIGQ 241
           G R  S PS S+  L SL +L L  C  L  + ++  L KLE+L L  + + E P  + +
Sbjct: 559 GTRIKSFPSCSLLRLFSLHSLFLRDCFKLVKLPSLETLAKLELLDLCGTHILEFPRGLEE 618

Query: 242 LTRLKLLDLSNCMKLKVIRPNVISSLSRLEELYMGNSFTEWEIEGQS---NASLVELKQL 298
           L R + LDLS  + L+ I   V+S LS LE L M +S   W ++G++    A++ E+  L
Sbjct: 619 LKRFRHLDLSRTLHLESIPARVVSRLSSLETLDMTSSHYRWSVQGETQKGQATVEEIGCL 678

Query: 299 SRLTTLEVHIPDAQVM--PQDLLSVELERYRICIGDVWSWSGEHETSRRLKLSALNKC-I 355
            RL  L + +  +  +   ++     L+++++ +G  +     H+  RRL +S LN   +
Sbjct: 679 QRLQVLSIRLHSSPFLLNKRNTWIKRLKKFQLVVGSRYILRTRHD-KRRLTISHLNVSQV 737

Query: 356 YLGYGMQMLLKGIEDLYLDELNGFQNALLEL-EDGEVFPLLKHLHVQNVCEILYIVNLVG 414
            +G+    LL     L L+   G +  + +L  D + F  LK L ++NV     I+N   
Sbjct: 738 SIGW----LLAYTTSLALNHCQGIEAMMKKLVSDNKGFKNLKSLTIENV-----IINTNS 788

Query: 415 W----------EHCNAFPLLESLFLHNLMRLEMVYRGQLTEH---SFSKLRIIKVCQCDN 461
           W          +  +   LL +L   +L R+++    +L  H       L+II++  C  
Sbjct: 789 WVEMVSTNTSKQSSDILDLLPNLEELHLRRVDLETFSELQTHLGLKLETLKIIEITMCRK 848

Query: 462 LKHLFSFPMARNLL---QLQKLKVSFCESLKLIVGKESSETHNVHEIINFTQ-----LHS 513
           L+ L      RN L    L+++++S+C+SL+           N+HE + + Q     L  
Sbjct: 849 LRTLLD---KRNFLTIPNLEEIEISYCDSLQ-----------NLHEALLYHQPFVPNLRV 894

Query: 514 LTLQCLPQLTS 524
           L L+ LP L S
Sbjct: 895 LKLRNLPNLVS 905

Disease resistance protein.
Arabidopsis thaliana (taxid: 3702)

>sp\|O81825\|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1	Back alignment and function description

>sp\|Q42484\|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1	Back alignment and function description

>sp\|Q9FLB4\|DRL31_ARATH Putative disease resistance protein At5g05400 OS=Arabidopsis thaliana GN=At5g05400 PE=2 SV=1	Back alignment and function description

>sp\|Q9C8T9\|DRL19_ARATH Putative disease resistance protein At1g63350 OS=Arabidopsis thaliana GN=At1g63350 PE=2 SV=1	Back alignment and function description

>sp\|Q9LVT4\|DRL37_ARATH Probable disease resistance protein At5g47250 OS=Arabidopsis thaliana GN=At5g47250 PE=2 SV=1	Back alignment and function description

>sp\|P60839\|DRL2_ARATH Probable disease resistance protein At1g12290 OS=Arabidopsis thaliana GN=At1g12290 PE=2 SV=1	Back alignment and function description

>sp\|Q9RBS2\|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2	Back alignment and function description

>sp\|Q940K0\|DRL15_ARATH Probable disease resistance protein At1g61180 OS=Arabidopsis thaliana GN=At1g61180 PE=2 SV=2	Back alignment and function description

>sp\|Q96NW7\|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1607
255542484		2460	phosphoprotein phosphatase, putative [Ri	0.903	0.590	0.323	1e-175
255563252		1603	Disease resistance protein RPS5, putativ	0.466	0.467	0.459	1e-168
359488101		1677	PREDICTED: disease resistance protein At	0.632	0.605	0.365	1e-166
225016141		3055	Rpp4 candidate 1 [Glycine max]	0.940	0.494	0.313	1e-165
328447250		4316	Rpp4 candidate R5 [Glycine max]	0.939	0.349	0.316	1e-165
225016144		3196	Rpp4 candidate 2 [Glycine max]	0.942	0.474	0.314	1e-163
224111296		1315	cc-nbs-lrr resistance protein [Populus t	0.487	0.595	0.444	1e-163
358344903		2248	Cc-nbs-lrr resistance protein [Medicago	0.878	0.627	0.317	1e-161
353685480		2629	Rpp4C4 [Phaseolus vulgaris]	0.922	0.563	0.310	1e-159
224111284		1340	cc-nbs-lrr resistance protein [Populus t	0.464	0.556	0.457	1e-156

>gi\|255542484\|ref\|XP_002512305.1\| phosphoprotein phosphatase, putative [Ricinus communis] gi\|223548266\|gb\|EEF49757.1\| phosphoprotein phosphatase, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  623 bits (1606), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 542/1676 (32%), Positives = 827/1676 (49%), Gaps = 224/1676 (13%)

Query: 10   SIIELSYNFLESEEAKSLFRLCGLLNGGSQIPIDALMRCGMGLGLLKGVYTLQEARKRVH 69
            + ++LSYNFL +EE KSLF LCG L     I +  L++  +GLGL     T++ AR R+ 
Sbjct: 335  TALKLSYNFLGAEE-KSLFVLCGQLKA-HYIVVSDLLKYSLGLGLFNQRTTVKAARNRLL 392

Query: 70   MLVNFLKASRLLLDGDAEECLKMHDIIHSIAASVAT-EELMFNMQNVADLKEELDKKTHK 128
             +VN LK S LLL+GD ++ ++MHD++H+ A  VA+ +  +F +   + L+E  +K   +
Sbjct: 393  KVVNDLKRSCLLLEGDDDDEVRMHDVVHNFATLVASRDHHVFAVACDSGLEEWPEKDILE 452

Query: 129  DPTAISIPFRGIYEFPERLECPKLKLFVLFSENLSLRIPDLFFEGMTELRVLSFTGFRFP 188
              TAIS+P   I + PE  ECP L+ F+L++++ SL+IPD FF  M +L+++  +     
Sbjct: 453  QFTAISLPDCKIPKLPEVFECPDLQSFLLYNKDSSLKIPDNFFSRMKKLKLMDLSNVHLS 512

Query: 189  SLPSSIGCLISLRTLTLESCLLGDVATIGDLKKLEILSLRHSDVEELPGEIGQLTRLKLL 248
             +P S+ CL +L+TL L+ C L D+A IG+LKKL++LS   S + +LP E+G+LTRL+LL
Sbjct: 513  PMPLSLQCLENLQTLCLDRCTLEDIAAIGELKKLQVLSFIGSTMVQLPREVGKLTRLQLL 572

Query: 249  DLSNCMKLKVIRPNVISSLSRLEELYMGNSFTEWEIE----GQSNASLVELKQLSRLTTL 304
            DLS C KL+VI   V+S L++LEELYMGNSF +WE E     ++NASL ELK L  L TL
Sbjct: 573  DLSRCQKLEVIPKGVLSCLTKLEELYMGNSFVQWESEEHDGDRNNASLDELKLLPNLVTL 632

Query: 305  EVHIPDAQVMPQDLLSVELERYRICIGDVWSWSGEHETSRRLKLSALNKCIYLGYGMQML 364
            E+HI +A+++P+D+ S +L+ Y++ IG+ WSW G++E SR LKL  LN  I +   +++L
Sbjct: 633  ELHIINAEILPRDVFSEKLDLYKVFIGEEWSWFGKYEASRTLKLK-LNSSIEIE-KVKVL 690

Query: 365  LKGIEDLYLDELNGFQNALLELEDGEVFPLLKHLHVQNVCEILYIVN-LVGWEHCNAFPL 423
            L   EDLYLDEL G +N L EL DG+ FP LKHLH+QN  EI YIV+ L    H  AFP 
Sbjct: 691  LMTTEDLYLDELEGVRNVLYEL-DGQGFPQLKHLHIQNSSEIQYIVDCLSMGNHYIAFPR 749

Query: 424  LESLFLHNLMRLEMVYRGQLTEHSFSKLRIIKVCQCDNLKHLFSFPMARNLLQLQKLKVS 483
            LESL + NL  L  +  GQL   SFSKLR +KV  C+ LK+LF F M R L+QL+++ VS
Sbjct: 750  LESLLVDNLNNLGQICYGQLMSGSFSKLRKLKVEHCNALKNLFYFSMFRGLVQLEEIDVS 809

Query: 484  FCESLKLIVGKESSETHNVHEIINFTQLHSLTLQCLPQLTSSGFDLERPLLSPTISATTL 543
             C  ++ IV +E  +     EII   +L +LTL+ LP+ TS  F  +R      ++    
Sbjct: 810  SCNIMEEIVVEEIEDDSGRDEIIKPIRLRTLTLEYLPRFTS--FCSQR---MQKLAGLDA 864

Query: 544  AFEEVIAEDDSDESLFNNKVIFPNLEKLKLSSI-NIEKIWHDQYPLMLNSCSQNLTNLTV 602
               ++I+E  S   LF  K+ F NL  LKLSSI N+EKIW +Q     +S  QNLT+L V
Sbjct: 865  GCAQIISETPS--VLFGQKIEFSNLLNLKLSSINNMEKIWRNQVKEPPSSV-QNLTSLIV 921

Query: 603  ETCSRLKFLFSYSMVDSLVRLQQLEIRKCESMEAVIDTTDIEI----------------- 645
            E C +L +LF+ SMV++L +L+ LEI  C  ME +I    +                   
Sbjct: 922  EGCGKLSYLFTSSMVENLSQLEYLEISDCSFMEEIIVAEGLTKHNSKLHFPILHTLKLKS 981

Query: 646  ----------NSVEFPSLHHLRIVDCPNLRSFISVNSS----EEKILHTDTQPLFDEKLV 691
                      N +E PSL+ LRI +CP L  FIS ++S      +        LFDEK+ 
Sbjct: 982  LPNLIRFCFGNLIECPSLNALRIENCPRLLKFISSSASTNMEANRGGRETNSTLFDEKVS 1041

Query: 692  LPRLEVLSIDMMDNMRKIWHHQLALNSFSKLKALEVTNCGKLANIFPANIIMRRRLDRLE 751
             P LE L I  M+N+R IW  +   +SF KLK +++ NC +L  IFP+   M R L +LE
Sbjct: 1042 FPILEKLEIVYMNNLRMIWESEDRGDSFCKLKIVKIQNCKELVTIFPSK--MLRALQKLE 1099

Query: 752  YLKVDGCASVEEIIGETSSNGNICVEEEEDEEARRRFVFP---RLTWLNLSLLPRLKSFC 808
             + V  C  +EE+           ++E    E ++  V P   +L  L +  LP LK   
Sbjct: 1100 DVVVTNCDLLEEVFN---------LQELMATEGKQNRVLPVVAQLRDLTIENLPSLKHVW 1150

Query: 809  PG--VDISEWPLLKSLGVFGCDSVEILFASPEYFSCDSQRPLFVLD-------------- 852
             G    +  +  L+SL    C S++ LF +    S      L +++              
Sbjct: 1151 SGDPQGVFSFDNLRSLSAENCPSLKNLFPASIAKSLSQLEDLSIVNCGLQEIVAKDRVEA 1210

Query: 853  -PKVAFPGLKELELNKLPNLLHLWKENSQLSKALLNLATLEISECDKLEKLVPSSVSL-- 909
             P+  FP LK ++L  L  + + +     L      L  L I +CD LE     S  L  
Sbjct: 1211 TPRFVFPQLKSMKLWILEEVKNFYPGRHILDCP--KLEKLTIHDCDNLELFTLESQCLQV 1268

Query: 910  ---ENLVTLEVSKCNELIHLMTLSTAESLVKLNRMNVIDCKMLQQIILQVGEEVKKDCIV 966
               EN V +E  +      L + +   S +K   ++  +  M++Q  L           +
Sbjct: 1269 GRGENQVDVEFQQ-----PLFSFTQVVSHLKSLSLSNKETMMIRQAQLPAS--------L 1315

Query: 967  FGQFKYLGLHCLPCLTSFCLGNFTLEFPCLEQVIVRECPKMKIF-------SQGVLHTPK 1019
            F + + L L C    +S+   +    F  +E +++       +F          V     
Sbjct: 1316 FHKLERLDLQCFHDRSSYFPFDLLQRFQNVETLLLTCSNVEDLFPYPLVGEDNNVRILSN 1375

Query: 1020 LQRLHLREKYD-EGLW--EGSLNSTIQKLFEEMVGYHDKACLSLSKFPHLKEIWHGQALP 1076
            L+ L L    D   +W  E   N ++Q L    V Y    C  L             A  
Sbjct: 1376 LRHLTLNSLRDIRRIWNQECQPNQSLQNLETLEVMY----CKKLINL----------APS 1421

Query: 1077 VSFFINLRWLVVDDCRFMSGAIPANQLQNLINLKTLEVRNCYFLEQVFHLEEQNPIGQFR 1136
             + F NL  L V +C  +   + +   ++L+ L  ++V NC  L ++   E      +  
Sbjct: 1422 SATFKNLASLEVHECNGLVSLLTSTTAKSLVQLGEMKVSNCKMLREIVANEGDEMESEIT 1481

Query: 1137 SLFPKLRNLKLINLPQLIRFCNFTGRIIELPSLVNLWIENCRNMKTFISSSTPVIIAP-- 1194
              F KL +L+L +L +L   C+   R ++ PSL  L +  C  M+ F   S  +I AP  
Sbjct: 1482 --FSKLESLRLDDLTRLTTVCSVNCR-VKFPSLEELIVTACPRMEFF---SHGIITAPKL 1535

Query: 1195 -----NKEPQQMTSQENLLADIQPLFDEKVKLPSLEVLGISQMDNLRKIWQDRLSLDSFC 1249
                  KE  +  S  +L    Q L+ E V L  ++ L +S+   L + W D+L    F 
Sbjct: 1536 EKVSLTKEGDKWRSVGDLNTTTQQLYREMVGLNGVQHLQLSEFPTLVEKWHDQLPAYFFY 1595

Query: 1250 KLNCLVIQRCKKLLSIFPWNMLQRLQKLEKLEVVYCESVQRISELRALN-YGDARAISVA 1308
             L  LV+  C    S  P N+L  L +LE LEV  C+S+ ++ +    N YG A  +   
Sbjct: 1596 NLKSLVVDNCSFPSSSVPSNLLPFLNELEVLEVRNCDSLAKVFDFEWSNDYGYAGHL--- 1652

Query: 1309 QLRETLPICVFPLLTSLKLRSLPRLKCFYPGV--HISEWPMLKYLDISGCAELEILASKF 1366
                       P L    L  LPRL+  +  +   IS +  L  L+I  C+ L  + +  
Sbjct: 1653 -----------PNLKKFHLIDLPRLRHIWDDISSEISGFKNLTVLNIHNCSSLRYIFNPI 1701

Query: 1367 LSLG-----ETHVDG---------QHDSQTQQPFFSFDKVAFPSLKELRLSRLPKLFWL- 1411
            + +G     E  V           +  ++ + P    +++ FP LK + L  LP L    
Sbjct: 1702 ICMGLVQLQEVEVRNCALVQAIIREGLAKEEAP----NEIIFPLLKSISLESLPSLINFF 1757

Query: 1412 ------------------CKETSHPRNVFQNECSKLDILVPSSVSFG------------- 1440
                              C  T     + ++E +  D ++ + V F              
Sbjct: 1758 SGSGIVRCPSLKEITIVNCPATFTCTLLRESESNATDEIIETKVEFSELKILKLFSINIE 1817

Query: 1441 ---------------NLSTLEVSKCGRLMNLMTISTAERLVNLERMNVTDCKMIQQIIQQ 1485
                           +L++L V  CG L + ++ S  + LV+L+++ V +C+M++++I  
Sbjct: 1818 KIWHAHQLEMYASIQHLASLTVDGCGHLKHALSSSMVQTLVHLKKLEVCNCRMMEEVIAT 1877

Query: 1486 VGEVEKDC--IVFSQLKYLGLHCLPSLKSFCMGNKALEFPCLEQVIVEECPKMKIF 1539
             G  E+    ++  QL++L L  LP L  F   N  +EFP ++++ ++ CPK+  F
Sbjct: 1878 EGFEEESTSRMLLRQLEFLKLKDLPELAQFFTSN-LIEFPVMKELWLQNCPKLVAF 1932

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255563252\|ref\|XP_002522629.1\| Disease resistance protein RPS5, putative [Ricinus communis] gi\|223538105\|gb\|EEF39716.1\| Disease resistance protein RPS5, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|359488101\|ref\|XP_002263761.2\| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225016141\|gb\|ACN78965.1\| Rpp4 candidate 1 [Glycine max]	Back alignment and taxonomy information

>gi\|328447250\|gb\|AEB06128.1\| Rpp4 candidate R5 [Glycine max]	Back alignment and taxonomy information

>gi\|225016144\|gb\|ACN78968.1\| Rpp4 candidate 2 [Glycine max]	Back alignment and taxonomy information

>gi\|224111296\|ref\|XP_002332952.1\| cc-nbs-lrr resistance protein [Populus trichocarpa] gi\|222834264\|gb\|EEE72741.1\| cc-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|358344903\|ref\|XP_003636525.1\| Cc-nbs-lrr resistance protein [Medicago truncatula] gi\|355502460\|gb\|AES83663.1\| Cc-nbs-lrr resistance protein [Medicago truncatula]	Back alignment and taxonomy information

>gi\|353685480\|gb\|AER13157.1\| Rpp4C4 [Phaseolus vulgaris]	Back alignment and taxonomy information

>gi\|224111284\|ref\|XP_002332949.1\| cc-nbs-lrr resistance protein [Populus trichocarpa] gi\|222834261\|gb\|EEE72738.1\| cc-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1607
TAIR\|locus:2136447		985	AT4G27190 [Arabidopsis thalian	0.303	0.495	0.264	1.9e-31
TAIR\|locus:2131689		919	AT4G27220 [Arabidopsis thalian	0.312	0.546	0.284	9.1e-31
TAIR\|locus:2005517		909	RPS2 "RESISTANT TO P. SYRINGAE	0.149	0.265	0.298	2e-24
TAIR\|locus:2034765		884	AT1G12290 [Arabidopsis thalian	0.167	0.304	0.280	6.4e-14
TAIR\|locus:2031366		898	AT1G63350 "AT1G63350" [Arabido	0.152	0.272	0.275	1.1e-13
TAIR\|locus:2132741		892	AT4G10780 [Arabidopsis thalian	0.166	0.300	0.280	4.2e-13
TAIR\|locus:2171579		843	AT5G47250 [Arabidopsis thalian	0.152	0.290	0.274	7.9e-13
TAIR\|locus:2205824		1384	AT1G27170 [Arabidopsis thalian	0.230	0.268	0.268	2.3e-12
TAIR\|locus:2091662		1424	AT3G14460 [Arabidopsis thalian	0.194	0.219	0.25	2.9e-12
TAIR\|locus:2171589		948	AT5G47260 [Arabidopsis thalian	0.183	0.311	0.254	3.7e-12

TAIR\|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 397 (144.8 bits), Expect = 1.9e-31, Sum P(2) = 1.9e-31
 Identities = 145/548 (26%), Positives = 258/548 (47%)

Query:    12 IELSYNFLESEEAKSLFRLCGLLNGGSQIPIDALMRCGMGLGLLKGVYTLQEARKRVHML 71
             ++LSY+FLE ++AK  F LC L      I +  ++R  M  G ++ + + +++       
Sbjct:   383 LKLSYDFLE-DKAKFCFLLCALFPEDYSIEVTEVVRYWMAEGFMEELGSQEDSMNEGITT 441

Query:    72 VNFLKASRLLLDGDAEECLKMHDIIHSIAASVATEE------LMFNMQNVADLKEELDKK 125
             V  LK   LL DGD  + +KMHD++   A  + +        L+ +   + D++++   K
Sbjct:   442 VESLKDYCLLEDGDRRDTVKMHDVVRDFAIWIMSSSQDDSHSLVMSGTGLQDIRQD---K 498

Query:   126 THKDPTAISIPFRGIYEFPERLE--CPKLKLFVLFSENLSLRIPDLFFEGMTELRVLSFT 183
                    +S+    +   P+ +E  C K  + +L    L   +P  F +    LR+L+ +
Sbjct:   499 LAPSLRRVSLMNNKLESLPDLVEEFCVKTSVLLLQGNFLLKEVPIGFLQAFPTLRILNLS 558

Query:   184 GFRFPSLPS-SIGCLISLRTLTLESCL-LGDVATIGDLKKLEILSLRHSDVEELPGEIGQ 241
             G R  S PS S+  L SL +L L  C  L  + ++  L KLE+L L  + + E P  + +
Sbjct:   559 GTRIKSFPSCSLLRLFSLHSLFLRDCFKLVKLPSLETLAKLELLDLCGTHILEFPRGLEE 618

Query:   242 LTRLKLLDLSNCMKLKVIRPNVISSLSRLEELYMGNSFTEWEIEGQSN---ASLVELKQL 298
             L R + LDLS  + L+ I   V+S LS LE L M +S   W ++G++    A++ E+  L
Sbjct:   619 LKRFRHLDLSRTLHLESIPARVVSRLSSLETLDMTSSHYRWSVQGETQKGQATVEEIGCL 678

Query:   299 SRLTTLEVHIPDAQVM--PQDLLSVELERYRICIGDVWSWSGEHETSRRLKLSALNKC-I 355
              RL  L + +  +  +   ++     L+++++ +G  +     H+  RRL +S LN   +
Sbjct:   679 QRLQVLSIRLHSSPFLLNKRNTWIKRLKKFQLVVGSRYILRTRHD-KRRLTISHLNVSQV 737

Query:   356 YLGYGMQMLLKGIEDLYLDELNGFQNALLEL-EDGEVFPLLKHLHVQNVCEILYIVNLVG 414
              +G+    LL     L L+   G +  + +L  D + F  LK L ++NV     I+N   
Sbjct:   738 SIGW----LLAYTTSLALNHCQGIEAMMKKLVSDNKGFKNLKSLTIENV-----IINTNS 788

Query:   415 W----------EHCNAFPLLESLFLHNLMRLEMVYRGQLTEH---SFSKLRIIKVCQCDN 461
             W          +  +   LL +L   +L R+++    +L  H       L+II++  C  
Sbjct:   789 WVEMVSTNTSKQSSDILDLLPNLEELHLRRVDLETFSELQTHLGLKLETLKIIEITMCRK 848

Query:   462 LKHLFSFPMARNLLQLQKLKVSFCESLKLIVGKESSETHNVHEIINFTQ-----LHSLTL 516
             L+ L        +  L+++++S+C+SL+           N+HE + + Q     L  L L
Sbjct:   849 LRTLLDKRNFLTIPNLEEIEISYCDSLQ-----------NLHEALLYHQPFVPNLRVLKL 897

Query:   517 QCLPQLTS 524
             + LP L S
Sbjct:   898 RNLPNLVS 905

GO:0000166 "nucleotide binding" evidence=IEA

GO:0005739 "mitochondrion" evidence=ISM

GO:0006952 "defense response" evidence=IEA;ISS

GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA

GO:0043531 "ADP binding" evidence=IEA

TAIR\|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2031366 AT1G63350 "AT1G63350" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2171579 AT5G47250 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2205824 AT1G27170 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2171589 AT5G47260 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		1607
PLN03210		1153	PLN03210, PLN03210, Resistant to P	6e-08
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	2e-04
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	3e-04
PLN03210		1153	PLN03210, PLN03210, Resistant to P	0.001
PLN03210		1153	PLN03210, PLN03210, Resistant to P	0.002

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

 Score = 57.6 bits (139), Expect = 6e-08
 Identities = 91/333 (27%), Positives = 145/333 (43%), Gaps = 68/333 (20%)

Query: 431 NLMRLEMVYRGQLTE------HSFSKLRIIKVCQCDNLKHLFSFPMARNLLQLQKLKVSF 484
           NL++L+M  +G   E      HS + LR I +    NLK +    MA N   L+ LK+S 
Sbjct: 612 NLVKLQM--QGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPDLSMATN---LETLKLSD 666

Query: 485 CESLKLIVGKESSETHNVHEIINFTQLHSLTLQCLPQLTSSGFDLER------------- 531
           C SL  +     S    ++++ +        L+ LP    +G +L+              
Sbjct: 667 CSSLVEL----PSSIQYLNKLEDLDMSRCENLEILP----TGINLKSLYRLNLSGCSRLK 718

Query: 532 --PLLSPTISATTLAFEEVIAEDDSDESLFNNKVIFPNLEKLKLSSINIEKIWHDQYPL- 588
             P +S  IS   L  +E   E+      F + +   NL++L L  +  EK+W    PL 
Sbjct: 719 SFPDISTNIS--WLDLDETAIEE------FPSNLRLENLDELILCEMKSEKLWERVQPLT 770

Query: 589 -MLNSCSQNLTNLTVETCSRLKFLFSYSMVDSLVRLQQLEIRKCESMEAVIDTTDIEINS 647
            ++   S +LT L +     L  L   S + +L +L+ LEI  C ++E    T    IN 
Sbjct: 771 PLMTMLSPSLTRLFLSDIPSLVEL--PSSIQNLHKLEHLEIENCINLE----TLPTGIN- 823

Query: 648 VEFPSLHHLRIVDCPNLRSF--ISVNSSEEKILHTDTQ--PLFDEKLVLPRLEVLSIDMM 703
               SL  L +  C  LR+F  IS N S+  +  T  +  P + EK     L  L ++  
Sbjct: 824 --LESLESLDLSGCSRLRTFPDISTNISDLNLSRTGIEEVPWWIEKFS--NLSFLDMNGC 879

Query: 704 DNMRKIWHHQLALNSFSKLKALE---VTNCGKL 733
           +N++++  +       SKLK LE    ++CG L
Sbjct: 880 NNLQRVSLN------ISKLKHLETVDFSDCGAL 906

syringae 6; Provisional. Length = 1153

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		1607
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	100.0
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.98
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.96
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.96
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.82
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.79
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.75
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.75
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.74
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.71
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.71
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.67
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.64
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.52
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.46
KOG4341		483	consensus F-box protein containing LRR [General fu	99.45
KOG4341		483	consensus F-box protein containing LRR [General fu	99.39
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.29
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.16
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.15
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.15
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.06
KOG4237		498	consensus Extracellular matrix protein slit, conta	98.99
KOG4237		498	consensus Extracellular matrix protein slit, conta	98.85
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.83
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.77
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.73
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.72
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.68
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	98.59
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.5
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	98.38
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.36
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.34
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.08
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.07
KOG1947		482	consensus Leucine rich repeat proteins, some prote	98.03
PLN03150		623	hypothetical protein; Provisional	97.98
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	97.95
KOG1947		482	consensus Leucine rich repeat proteins, some prote	97.95
PRK15386		426	type III secretion protein GogB; Provisional	97.89
PLN03150		623	hypothetical protein; Provisional	97.88
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	97.88
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	97.86
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.82
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	97.81
PRK15386		426	type III secretion protein GogB; Provisional	97.74
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	97.61
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.52
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.52
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.47
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.37
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	97.31
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.06
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	97.03
PF00931		287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	96.96
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	96.75
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	96.61
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	96.43
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	96.38
KOG2982		418	consensus Uncharacterized conserved protein [Funct	96.3
KOG2982		418	consensus Uncharacterized conserved protein [Funct	96.02
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	95.97
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	95.08
KOG2123		388	consensus Uncharacterized conserved protein [Funct	94.3
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	93.69
KOG2123		388	consensus Uncharacterized conserved protein [Funct	93.51
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	93.34
KOG3864		221	consensus Uncharacterized conserved protein [Funct	91.8
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	91.45
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	90.11
KOG3864		221	consensus Uncharacterized conserved protein [Funct	89.97
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	89.06
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	88.01
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	86.02
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	84.48
smart00367		26	LRR_CC Leucine-rich repeat - CC (cysteine-containi	84.17
KOG0473		326	consensus Leucine-rich repeat protein [Function un	83.7
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	81.06

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

Probab=100.00  E-value=3.3e-39  Score=411.50  Aligned_cols=397  Identities=23%  Similarity=0.314  Sum_probs=275.5

Q ss_pred             CCchhhHHhHHhcccccCCcchhhhHHHhccccCCCCccChhHHHHHHhhcCccccccCHHHHHHHHHHHHHHHHHcccc
Q 000375            2 GGEDANVNSIIELSYNFLESEEAKSLFRLCGLLNGGSQIPIDALMRCGMGLGLLKGVYTLQEARKRVHMLVNFLKASRLL   81 (1607)
Q Consensus         2 ~~~~~~i~~~L~lSY~~Lp~~~lK~CFly~s~Fp~~~~i~~~~Li~~WiaeG~i~~~~~~ee~~~~~~~~i~~L~~~~ll   81 (1607)
                      +|+++.|+++|++|||+||++ +|.||+|||+|||||+|++++||.+||||||+.+....+.|++.|++||.+||.++++
T Consensus       391 ~~~~~~i~~iLklSyd~L~~~-lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll  469 (889)
T KOG4658|consen  391 SGMEESILPILKLSYDNLPEE-LKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLL  469 (889)
T ss_pred             CchhhhhHHhhhccHhhhhHH-HHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHH
Confidence            578999999999999999976 9999999999999999999999999999999988666778999999999999999999


Q ss_pred             ccCC---CCcccchhhHHHHHHHHHHhhhhhcccCcEEeccCCcC----ccCCCCCcEEEeeCCCCCcCCCCCCCCCccE
Q 000375           82 LDGD---AEECLKMHDIIHSIAASVATEELMFNMQNVADLKEELD----KKTHKDPTAISIPFRGIYEFPERLECPKLKL  154 (1607)
Q Consensus        82 ~~~~---~~~~~~mHdlv~dla~~i~~~~~~~~~~~~~~~~~~~~----~~~~~~lr~L~l~~~~~~~~~~~~~~~~Lr~  154 (1607)
                      +.++   ...+|+|||+|||||.++|++.+...-..++....+..    ...+..+|++++.+|.+..++....+++|++
T Consensus       470 ~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~~~~~L~t  549 (889)
T KOG4658|consen  470 IEERDEGRKETVKMHDVVREMALWIASDFGKQEENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSSENPKLRT  549 (889)
T ss_pred             hhcccccceeEEEeeHHHHHHHHHHhccccccccceEEECCcCccccccccchhheeEEEEeccchhhccCCCCCCccce
Confidence            9876   34679999999999999999432211122222221111    1126789999999999998888888889999


Q ss_pred             EEecCCCC-CCCCchhhhhCCCCccEEEEeCC-CCCCCCcccCCCCCCCEEEccCCCCCCccccCCCCCCcEEEcccCCC
Q 000375          155 FVLFSENL-SLRIPDLFFEGMTELRVLSFTGF-RFPSLPSSIGCLISLRTLTLESCLLGDVATIGDLKKLEILSLRHSDV  232 (1607)
Q Consensus       155 L~l~~~~~-~~~~~~~~~~~l~~Lr~L~L~~~-~~~~lp~~i~~L~~Lr~L~L~~~~l~~l~~i~~L~~L~~L~l~~~~l  232 (1607)
                      |.+.+|.. ...++..+|..++.|||||+++| .+.++|++|++|.|||||+++++                      .+
T Consensus       550 Lll~~n~~~l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t----------------------~I  607 (889)
T KOG4658|consen  550 LLLQRNSDWLLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDT----------------------GI  607 (889)
T ss_pred             EEEeecchhhhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCC----------------------Cc
Confidence            99999873 44788888899999999999976 45678877766666666655554                      56


Q ss_pred             cccchhccCCCCCCEEeccCCcCccccCccccCCCCCCcEEEccCccCccccccccccChhhcCCCCCCCEEEeecCCCC
Q 000375          233 EELPGEIGQLTRLKLLDLSNCMKLKVIRPNVISSLSRLEELYMGNSFTEWEIEGQSNASLVELKQLSRLTTLEVHIPDAQ  312 (1607)
Q Consensus       233 ~~lp~~i~~L~~L~~L~l~~~~~~~~lp~~~i~~L~~L~~L~l~~~~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~  312 (1607)
                      +.+|.++++|++|++|++..+..+..+| +++..|++||+|.+......     .......++.++.+|+.+....... 
T Consensus       608 ~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~-~i~~~L~~Lr~L~l~~s~~~-----~~~~~l~el~~Le~L~~ls~~~~s~-  680 (889)
T KOG4658|consen  608 SHLPSGLGNLKKLIYLNLEVTGRLESIP-GILLELQSLRVLRLPRSALS-----NDKLLLKELENLEHLENLSITISSV-  680 (889)
T ss_pred             cccchHHHHHHhhheecccccccccccc-chhhhcccccEEEeeccccc-----cchhhHHhhhcccchhhheeecchh-
Confidence            6777778888888888877766555554 43566888888877654321     1234456666666666665543221 


Q ss_pred             CCCccc-ccccCcEeEEEecCccCCCCCCccccccccccccccccccchhhhhhccccccccccccCccccccccccCCC
Q 000375          313 VMPQDL-LSVELERYRICIGDVWSWSGEHETSRRLKLSALNKCIYLGYGMQMLLKGIEDLYLDELNGFQNALLELEDGEV  391 (1607)
Q Consensus       313 ~~~~~~-~~~~L~~L~i~~~~~~~~~~~~~~l~~l~L~~l~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~l~~l~~~~~  391 (1607)
                      .+-... .+.+|                                         ......+.+.++.. ......+   ..
T Consensus       681 ~~~e~l~~~~~L-----------------------------------------~~~~~~l~~~~~~~-~~~~~~~---~~  715 (889)
T KOG4658|consen  681 LLLEDLLGMTRL-----------------------------------------RSLLQSLSIEGCSK-RTLISSL---GS  715 (889)
T ss_pred             HhHhhhhhhHHH-----------------------------------------HHHhHhhhhccccc-ceeeccc---cc
Confidence            100000 11111                                         11112222222111 1223334   78


Q ss_pred             CCCccEEEeeccccceEEecccCcccCCc-ccccceeeccccccccccccccccccccccccEEEEeeCCCcccCCChhh
Q 000375          392 FPLLKHLHVQNVCEILYIVNLVGWEHCNA-FPLLESLFLHNLMRLEMVYRGQLTEHSFSKLRIIKVCQCDNLKHLFSFPM  470 (1607)
Q Consensus       392 l~~L~~L~L~~~~~l~~i~~~~~~~~~~~-fp~L~~L~l~~~~~l~~~~~~~~~~~~~p~L~~L~l~~c~~l~~lp~~~~  470 (1607)
                      +.+|+.|.+.+|...+............. |+++..+.+.+|...+...    .....|+|+.|.+..|..++.+.+  .
T Consensus       716 l~~L~~L~i~~~~~~e~~~~~~~~~~~~~~f~~l~~~~~~~~~~~r~l~----~~~f~~~L~~l~l~~~~~~e~~i~--~  789 (889)
T KOG4658|consen  716 LGNLEELSILDCGISEIVIEWEESLIVLLCFPNLSKVSILNCHMLRDLT----WLLFAPHLTSLSLVSCRLLEDIIP--K  789 (889)
T ss_pred             ccCcceEEEEcCCCchhhcccccccchhhhHHHHHHHHhhccccccccc----hhhccCcccEEEEecccccccCCC--H
Confidence            89999999999876543322222222222 7788888888887766652    234568999999999988887654  3


Q ss_pred             hhccccCcE
Q 000375          471 ARNLLQLQK  479 (1607)
Q Consensus       471 ~~~L~~L~~  479 (1607)
                      ...+..+++
T Consensus       790 ~k~~~~l~~  798 (889)
T KOG4658|consen  790 LKALLELKE  798 (889)
T ss_pred             HHHhhhccc
Confidence            344444443

>PLN03210 Resistant to P	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		1607
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	5e-16
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-12
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-11
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-15
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-12
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-11
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-10
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	9e-10
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	6e-15
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-13
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	4e-05
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	7e-13
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	4e-10
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-08
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	4e-07
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-06
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	4e-05
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	3e-12
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-10
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-09
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	6e-06
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	7e-06
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	3e-04
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	8e-12
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-11
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-09
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-08
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-07
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-05
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-11
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-06
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	3e-11
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-09
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	3e-09
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-06
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	5e-05
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	3e-11
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	4e-09
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	2e-08
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	7e-11
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	8e-10
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	9e-09
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	1e-10
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	1e-07
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-10
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	3e-10
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	5e-10
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	4e-09
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-08
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	8e-08
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	4e-05
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	2e-10
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	3e-06
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	4e-05
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	4e-10
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-09
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-09
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-08
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-08
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-08
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	5e-08
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-04
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	1e-09
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	2e-07
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-09
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-09
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-09
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-09
1o6v_A		466	Internalin A; bacterial infection, extracellular r	6e-09
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-08
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-07
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-05
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	2e-09
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	5e-09
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	7e-09
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	3e-08
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	4e-09
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	9e-09
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	6e-07
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	6e-06
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	4e-09
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	1e-07
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	2e-04
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	6e-09
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	5e-08
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-07
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	3e-07
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	3e-07
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	7e-07
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	3e-06
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	7e-09
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-08
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	4e-08
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	3e-07
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-06
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	5e-06
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	8e-09
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	8e-07
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-05
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	1e-08
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	1e-08
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	2e-08
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	5e-07
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	7e-05
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	1e-04
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	3e-08
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	2e-05
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	4e-04
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	3e-08
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	2e-05
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	3e-05
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	4e-05
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	4e-08
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	4e-07
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	2e-06
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	2e-06
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	7e-06
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	8e-06
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	4e-08
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	4e-08
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	8e-07
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	7e-06
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-04
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	5e-08
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	1e-07
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	5e-07
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	6e-06
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	5e-08
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	3e-05
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	5e-08
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	9e-08
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	1e-07
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	6e-07
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	7e-08
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	4e-07
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-06
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-05
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-05
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	3e-05
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	1e-07
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	3e-07
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	1e-05
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	2e-05
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	2e-04
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	3e-07
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	3e-07
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	1e-06
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	6e-07
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	6e-07
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	3e-06
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	7e-04
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	8e-07
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	2e-04
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	1e-06
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	2e-04
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	1e-06
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	2e-04
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	2e-04
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	1e-06
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	2e-06
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	1e-04
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	2e-06
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	9e-06
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	3e-04
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	5e-06
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	6e-06
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	7e-06
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	4e-04
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	7e-06
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	1e-05
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	2e-04
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	6e-04
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	6e-05
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	1e-04
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	5e-04
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	2e-04
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	3e-04

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		1607
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	5e-07
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	8e-04

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 51.5 bits (122), Expect = 5e-07
 Identities = 28/166 (16%), Positives = 63/166 (37%), Gaps = 28/166 (16%)

Query: 133 ISIPFRGIYEFPERLECPKLKLFVLFSENLSLRIPDLFFEGMTELRVLSFTGFRFPSLPS 192
           +S+    + +         L    L +  +S   P     G+T+L  L     +  ++  
Sbjct: 224 LSLNGNQLKDIGTLASLTNLTDLDLANNQISNLAP---LSGLTKLTELKLGANQISNISP 280

Query: 193 SIGC---------------------LISLRTLTLESCLLGDVATIGDLKKLEILSLRHSD 231
             G                      L +L  LTL    + D++ +  L KL+ L   ++ 
Sbjct: 281 LAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFANNK 340

Query: 232 VEELPGEIGQLTRLKLLDLSNCMKLKVIRPNVISSLSRLEELYMGN 277
           V ++   +  LT +  L   +  ++  + P  +++L+R+ +L + +
Sbjct: 341 VSDVS-SLANLTNINWLSAGHN-QISDLTP--LANLTRITQLGLND 382

PyMOL of d2omza2

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		1607
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.95
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.93
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.89
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.88
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.87
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.86
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.86
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.85
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.85
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.84
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.84
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.81
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.81
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.81
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.79
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.79
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.78
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.76
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.75
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.74
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.68
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.62
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.62
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.59
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.57
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.56
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.54
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.54
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.36
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.35
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.31
d2ifga3		156	High affinity nerve growth factor receptor, N-term	99.2
d2ifga3		156	High affinity nerve growth factor receptor, N-term	99.14
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.68
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.29
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.92
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.83
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	96.88
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	96.24

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.95  E-value=1.9e-24  Score=148.34  Aligned_cols=81  Identities=19%  Similarity=0.269  Sum_probs=44.5

Q ss_pred             CCCCCCEEECCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCHHCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCEEEC
Q ss_conf             99987799803888889646578788759981138896456001599997999465886864217210499999859994
Q 000375          196 CLISLRTLTLESCLLGDVATIGDLKKLEILSLRHSDVEELPGEIGQLTRLKLLDLSNCMKLKVIRPNVISSLSRLEELYM  275 (1607)
Q Consensus       196 ~L~~Lr~L~L~~~~i~~l~~i~~L~~L~~L~l~~~~i~~lP~~i~~L~~L~~L~l~~~~~l~~lp~~~i~~L~~L~~L~l  275 (1607)
                      .+.+|++|+++++.|+.+++++.+++|++|++++|+++.+|. ++++++|++|++++|. +..+++  ++.+++|+.|++
T Consensus        42 ~l~~l~~L~l~~~~I~~l~gl~~L~nL~~L~Ls~N~l~~l~~-l~~L~~L~~L~L~~n~-i~~i~~--l~~l~~L~~L~~  117 (384)
T d2omza2          42 DLDQVTTLQADRLGIKSIDGVEYLNNLTQINFSNNQLTDITP-LKNLTKLVDILMNNNQ-IADITP--LANLTNLTGLTL  117 (384)
T ss_dssp             HHTTCCEEECCSSCCCCCTTGGGCTTCCEEECCSSCCCCCGG-GTTCTTCCEEECCSSC-CCCCGG--GTTCTTCCEEEC
T ss_pred             HHCCCCEEECCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCC-CCCCCCCCCCCCCCCC-CCCCCC--CCCCCCCCCCCC
T ss_conf             957878998999898776242458999989681881798863-3477110103013433-322221--112334333443


Q ss_pred             CCCCC
Q ss_conf             17647
Q 000375          276 GNSFT  280 (1607)
Q Consensus       276 ~~~~~  280 (1607)
                      .++.+
T Consensus       118 ~~~~~  122 (384)
T d2omza2         118 FNNQI  122 (384)
T ss_dssp             CSSCC
T ss_pred             CCCCC
T ss_conf             32222

PyMOL of d2omza2

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure