Citrus Sinensis ID: 000392

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------1450------1460------1470------1480------1490------1500------1510------1520------1530------1540------1550------1560------1570------1580-
MGNNSNNNVEIPKWLQGLPLAPVFYPTDTEFADPIAYISRIEKEASAFGICKIVPPLPKPSKKYVFGNLNKSLSKCSELGSDVNLPDAGTVATVGCCERGNEGEARAVFTTRHQELGQSVKRIKGVDNKDNLQLGAQKQVWQSGEVYTLEQFESKSKAFARSLLSVIKEVSPLVIEALFWKAASEKPVYVEYANDVPGSGFGEPEGQFRYFHRRRRKVTSWKSYRNRGKADEKNIELESARNCHNDQITHSCDKNDLETPTSSTPSSTLPFDENSRSSRRKSVTGSNDVEGTAGWKLSNSPWNLQVISRSPGSLTRFMPDDIPGVTSPMVYIGMLFSWFAWHVEDHELHSMNFLHTGAPKTWYAIPGDYAFTFEEVIRNEAYGGDIDRLAALSLLGEKTTLISPEVIAASGIPCCRLVQNPGEFVVTFPRAYHAGFSHGFNCGEAANFGTPQWLMVAKEAAVRRAAMNYLPMLSHQQLLYLLTMSFISRVPRSLLPGARSSRLRDRQKEERELLVKKAFVEDILKENNILSVLLGRQSTFNAVLWNADLLPCQSKESQMPSANETVSTTPGETVPNNPYEKHNDHNNLLDEMNVYMEALNDPYMGDDDISRDFHIDSGALACVACGILGFPFMSVVQLSERASIELLADLVKEGPGVSELKNTHHHTNLDGSVKSSVSDDLCLVPDISLLQKDLSVPSITKSSRIWNTSNKYLRPRIFCLEHAAQIEEILQSKGGAEILVICHSDYQKIKAHAAAVAEEIGSPFNYIDVPLDAASEEDLHLIDLAIDDGELDECREDWTSKLGINLRHCVKVRKNSPSMRVQHALSLGDLFSEKSLSSDFSKIKWQFRRSRSKIKLYGRAHSKPCQNIEIKKDEVTGRKLDGATVKKEEKLIQYSRRKFKQKPDLSTGACGDQVHPRELLPEVSAATCDHLDGHNRSDFEINPDGTGNSGSISAGSIHSPIGMSEGLHDIPVREATSNLSLNYSPSRVADSLATATLVVDSIVQNDTESMKELNIEGDIFHMATCKSAEMQQNSGTDVTSEKTEISHHTVASNEGSIIMRSDQITESMTIKNEKCNLASEGHCRKIEDLAPDNSCMISEACDHMISDNEVRQNVQSTNGGNDVEPISCDHKLIDEPPASTGESCEDMREISTAESLQDNLQHERNIGNGSNEELVSSSVTMMIQPTSAPMEISEVPSKECAAADLLNVGTKQKLISSCVSRMEVDQPSPLKVGGCSEVPIEICTKEDSGADMTLDPRTQLQNHTTAEAIMDELVCNSSAQLEENERIPASVAACSEESNGIFAEEKMDFDMTIGTQTKNATSEEPKPTSLIPIDQPIPAVIRKYSRTRRESYSAEKFCNGNEAYSSKDNKERECNESNLEDPSFSAGKGRKRNRELERLTENKFNGSGFIRSPCEGLRSRAGKDAANTSEVDIRKIAEKRATKTMRNRESVPAPCQDKKKILKGHHRCDLDGCRMSFETKRELSLHKRNRCPHEGCGKRFSSHKYAIIHQRVHDDERPLKCPWKGCSMSFKWAWARTEHIRVHTGERPYKCKFEGCGLSFRFVSDISRHRRKTGHYENLSA
cccccccccccccccccccccccccccHHHHccHHHHHHHHHHHHHccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEEcccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccEEEEcccHHHHHHHHHHHHHcccccHHHHHHHHHHccccccccHHHHHHcccccEEcccccccEEEEcccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccEEcccccccccEEEEHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHccccccccccccccccccccEEEEccccccccccccHHHHHccccccccccccccccEEEEEccccEEEEccccccccccccccHHHHHccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccHHccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccHHccccccccccccccccccccHHHHHccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccEEEccccccccccccccccccEEEEcccccccccccccccccc
ccccccccccccHHHccccccccccccHHHHHcHHHHHHHHHHHHHHccEEEEcccccccccHEHHHHccHcHcccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccEEEEEcccccccccHHHHHHHHHHHHHHccccccccccHHHHHccccccccEEEEEccccccccccccccccccEccEccccccccEccccccccHccccccEEEEEEcccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccEEEEcccccccccccEEEEEHHHHHHHHEHcccccEEHHHHccccccEEEEcccHHHHHHHHHHHHHcccccccHHHHHHHHHHccccccHHHHHHccccEEEEEEccccEEEEccccEcccccccccHHHHHccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcHHHccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEHEcccccccEEEEcccHHHHHHHHccHccccccccccccccccccccccccccccccccccccEEccccccccccccccccEEccccccccccEEHHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHHHHHcccccccccccHHHccHHHHHHHHHHccccccccccccHHHHHccccEEEEEEcccccccccccccHccccccccccccccccHHHHHHcccccccccccccccccccEEccccccccccccccEEccccEEEEEcccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccHHHHcccccccccccccccEEEEccccccccccccccccccccccccEccEEEcccccccccccccccccEEcccccccccccccccccccccccccccccccHHHHccccHHHHHcccccccccccccccHHHccccccccHcccccccccccccccccccccccccccccccccccHHHcccccccccccccccHHcccHHcccHHHHHEEcccccccHHHcccHHHHcccccccHHHHccccccccccHccccccccHHHccccccccccccccccccccHccccHHccccccccccccccccccccccccccccccccccccHcHHccccccccccccccccccccccccccccccHHEEEEccccccccccccccccccccccEEEEEccccccccccccccccEEcccccccccccccccccccccccHHHHHHHcccccccccccccccEEcccccEEEEEccccccccccccccccccccccccccccEEccccHHHHHHHHccccccccccccccccccccHHHHHHHcccccHHcccEEccHHHHHHHHHHccccccEEccccccccEEccHHHHHHHHHHHHccccccccccccccccccccccHHHHHHccccccccc
mgnnsnnnveipkwlqglplapvfyptdtefadpiAYISRIEKEASAfgickivpplpkpskkyvfGNLNKSLSKCselgsdvnlpdagtvatvgccergnegeaRAVFTTRHQELGQsvkrikgvdnkdnlqlgaqKQVWQSGEVYTLEQFESKSKAFARSLLSVIKEVSPLVIEALFWKAasekpvyveyandvpgsgfgepegqfrYFHRRRRKVTswksyrnrgkadeknIELESarnchndqithscdkndletptsstpsstlpfdensrssrrksvtgsndvegtagwklsnspwnlqvisrspgsltrfmpddipgvtspmVYIGMLFSWFAWHVedhelhsmnflhtgapktwyaipgdyafTFEEVIrneayggdiDRLAALSLLgekttlispeviaasgipccrlvqnpgefvvtfprayhagfshgfncgeaanfgtpqWLMVAKEAAVRRAAMNYLPMLSHQQLLYLLTMSFIsrvprsllpgarssrlRDRQKEERELLVKKAFVEDILKENNILSVLLGRQSTFNAVLwnadllpcqskesqmpsanetvsttpgetvpnnpyekhndhnnlLDEMNVYMEAlndpymgdddisrdfhidsgALACVACGILGFPFMSVVQLSERASIELLADLVkegpgvselknthhhtnldgsvkssvsddlclvpdisllqkdlsvpsitkssriwntsnkylrpriFCLEHAAQIEEILQSKGGAEILVICHSDYQKIKAHAAAVAEeigspfnyidvpldaaseeDLHLIDLAiddgeldecREDWTSKLGINLRHCvkvrknspsmrvQHALSlgdlfsekslssdfsKIKWQFRRSRSKIklygrahskpcqnieikkdevtgrkldgatvkkEEKLIQYSRRkfkqkpdlstgacgdqvhprellpevsaatcdhldghnrsdfeinpdgtgnsgsisagsihspigmseglhdipvreatsnlslnyspsrvaDSLATATLVVDSIVQNDTESMKELNIEGDIFHMATcksaemqqnsgtdvtsekteishhtvasnegsiimrsdqitESMTiknekcnlaseghcrkiedlapdnscmiSEACDhmisdnevrqnvqstnggndvepiscdhklideppastgescedmREISTAESLQDNLqhernigngsneeLVSSSVTmmiqptsapmeisevpskecaaadllnvgtkQKLISSCVsrmevdqpsplkvggcsevpieictkedsgadmtldprtqlqnhTTAEAIMDELVcnssaqleeneripasvaacseesngifaeekmdfdmtigtqtknatseepkptslipidqpipAVIRKYSRtrresysaekfcngneaysskdnkerecnesnledpsfsagkgrkrnRELERLtenkfngsgfirspceglrsragkdaantsEVDIRKIAEKRATKtmrnresvpapcqdkkkilkghhrcdldgcrmsFETKRELSlhkrnrcphegcgkrfsshkYAIIHQRvhdderplkcpwkgcsmsfKWAWARTEHIRvhtgerpykckfegcglsfrfVSDISrhrrktghyenlsa
mgnnsnnnVEIPKWLQGLPLAPVFYPTDTEFADPIAYISRIEKEASAFGICKIVPPLPKPSKKYVFGNLNKSLSKCSELGSDVNLPDAGTVATVGCCERGNEGEARAVFttrhqelgqsvkrikgvdnkDNLQLGAQKQVWQSGEVYTLEQFESKSKAFARSLLSVIKEVSPLVIEALFWKAASEKPVYVEYANDvpgsgfgepegqfryfhrrrrkvtswksyrnrgkadeknielesarnchndqithscdkndletptsstpsstlpfdensrssrrksvtgsndvegtagwklsnspwnLQVISRSPGSLTRFMPDDIPGVTSPMVYIGMLFSWFAWHVEDHELHSMNFLHTGAPKTWYAIPGDYAFTFEEVIRNEAYGGDIDRLAALSLLGEKTTLISPEVIAASGIPCCRLVQNPGEFVVTFPRAYHAGFSHGFNCGEAANFGTPQWLMVAKEAAVRRAAMNYLPMLSHQQLLYLLTMSFISRVPrsllpgarssrlrdrqkEERELLVkkafvedilkeNNILSVLLGRQSTFNAVLWNADLLPCQSKESQMPSANETVSTTPGETVPNNPYEKHNDHNNLLDEMNVYMEALNDPYMGDDDISRDFHIDSGALACVACGILGFPFMSVVQLSERASIELLADLVKEGPGVSELKNTHHHTNLDGSVKSSVSDDLCLVPDIsllqkdlsvpsitkssriwntsnkYLRPRIFCLEHAAQIEEILQSKGGAEILVICHSDYQKIKAHAAAVAEEIGSPFNYIDVPLDAASEEDLHLIDLAIDDGELDECREDWtsklginlrhcvkvrknspsmRVQHALSlgdlfsekslssdfskikwqfrrsrskiklygrahskpcqnieikkdevtgrkldgatvkkeekliqysrrkfkqkpdlstgacgdqvhPRELLPEVSAATCDHLDGHNRSDFEINPDGTGNSGSISAGSIHSPIGMSEGLHDIPVREATSNLSLNYSPSRVADSLATATLVVDSIVQNDTESMKELNIEGDIFHMATCKSAEMQQNSGTDVTSEKTEIShhtvasnegsiimrSDQITESMTIKNEKCNLASEGHCRKIEDLAPDNSCMISEACDHMISDNEVRQNVQSTNGGNDVEPISCDHKLIDEPPASTGESCEDMREISTAESLQDNLQHERNIGNGSNEELVSSSVTMMIQPTSAPMEISEVPSKECAAADLLNVGTKQKLISSCVSRmevdqpsplkvggcseVPIEICTKEDSGADMTLDPRTQLQNHTTAEAIMDELVCNSSAQLEENERIPASVAACSEESNGIFAEEKMDFDMTIGTQTKnatseepkptslipidqpipAVIRKYSRTRresysaekfcngneaysskdnkerecnesnledpsfsagkgrkrnrelerltenkfngsgfirspceglrsragkdaantsevdirkiaekratktmrnresvpapcqdkkkilkghhrcdldgcrMSFETKRElslhkrnrcphegcgkrfsshKYAIIHQRvhdderplkcPWKGCSMSFKWAWARTEHIRvhtgerpykckfegcGLSFRfvsdisrhrrktghyenlsa
MGNNSNNNVEIPKWLQGLPLAPVFYPTDTEFADPIAYISRIEKEASAFGICKIVPPLPKPSKKYVFGNLNKSLSKCSELGSDVNLPDAGTVATVGCCERGNEGEARAVFTTRHQELGQSVKRIKGVDNKDNLQLGAQKQVWQSGEVYTLEQFESKSKAFARSLLSVIKEVSPLVIEALFWKAASEKPVYVEYANDVPGSGFGEPEGQFRYFHRRRRKVTSWKSYRNRGKADEKNIELESARNCHNDQITHSCDKNDLEtptsstpsstLPFDENSRSSRRKSVTGSNDVEGTAGWKLSNSPWNLQVISRSPGSLTRFMPDDIPGVTSPMVYIGMLFSWFAWHVEDHELHSMNFLHTGAPKTWYAIPGDYAFTFEEVIRNEAYGGDIDRLAALSLLGEKTTLISPEVIAASGIPCCRLVQNPGEFVVTFPRAYHAGFSHGFNCGEAANFGTPQWLMVAKEAAVRRAAMNYLPMLSHQQLLYLLTMSFISRVPRSLLPGARSSRLRDRQKEERELLVKKAFVEDILKENNILSVLLGRQSTFNAVLWNADLLPCQSKESQMPSANETVSTTPGETVPNNPYEKHNDHNNLLDEMNVYMEALNDPYMGDDDISRDFHIDSGALACVACGILGFPFMSVVQLSERASIELLADLVKEGPGVSELKNTHHHTNLDGSVKSSVSDDLCLVPDISLLQKDLSVPSITKSSRIWNTSNKYLRPRIFCLEHAAQIEEILQSKGGAEILVICHSDYQKIKAHAAAVAEEIGSPFNYIDVPLDAASEEDLHLIDLAIDDGELDECREDWTSKLGINLRHCVKVRKNSPSMRVQHALSLGDLFSEKSLSSDFSKIKWQFRRSRSKIKLYGRAHSKPCQNIEIKKDEVTGRKLDGATVKKEEKLIQYSRRKFKQKPDLSTGACGDQVHPRELLPEVSAATCDHLDGHNRSDFEINPDGTGNSGSISAGSIHSPIGMSEGLHDIPVREATSNLSLNYSPSRVADSLATATLVVDSIVQNDTESMKELNIEGDIFHMATCKSAEMQQNSGTDVTSEKTEISHHTVASNEGSIIMRSDQITESMTIKNEKCNLASEGHCRKIEDLAPDNSCMISEACDHMISDNEVRQNVQSTNGGNDVEPISCDHKLIDEPPASTGESCEDMREISTAESLQDNLQHERNIGNGSNEELVSSSVTMMIQPTSAPMEISEVPSKECAAADLLNVGTKQKLISSCVSRMEVDQPSPLKVGGCSEVPIEICTKEDSGADMTLDPRTQLQNHTTAEAIMDELVCNSSAQLEENERIPASVAACSEESNGIFAEEKMDFDMTIGTQTKNATSEEPKPTSLIPIDQPIPAVIRKYSRTRRESYSAEKFCNGNEAYSSKDNKERECNESNLEDPSFSAGKGRKRNRELERLTENKFNGSGFIRSPCEGLRSRAGKDAANTSEVDIRKIAEKRATKTMRNRESVPAPCQDKKKILKGHHRCDLDGCRMSFETKRELSLHKRNRCPHEGCGKRFSSHKYAIIHQRVHDDERPLKCPWKGCSMSFKWAWARTEHIRVHTGERPYKCKFEGCGLSFRFVSDISRHRRKTGHYENLSA
*********EIPKWLQGLPLAPVFYPTDTEFADPIAYISRIEKEASAFGICKIVPPLPKPSKKYVFGNLNKSLSKCSELGSDVNLPDAGTVATVGCCERGNEGEARAVFTTRHQ*L***VKRIKGVDNKDNLQLGAQKQVWQSGEVYTLEQFESKSKAFARSLLSVIKEVSPLVIEALFWKAASEKPVYVEYANDVPGSGFGEPEGQFRYFHRRRRKVTSW*************************************************************************WKLSNSPWNLQVISRS*GSLTRFMPDDIPGVTSPMVYIGMLFSWFAWHVEDHELHSMNFLHTGAPKTWYAIPGDYAFTFEEVIRNEAYGGDIDRLAALSLLGEKTTLISPEVIAASGIPCCRLVQNPGEFVVTFPRAYHAGFSHGFNCGEAANFGTPQWLMVAKEAAVRRAAMNYLPMLSHQQLLYLLTMSFISRVPR********************LLVKKAFVEDILKENNILSVLLGRQSTFNAVLWNADLLPC************************************LDEMNVYMEALNDPYMGDDDISRDFHIDSGALACVACGILGFPFMSVVQLSERASIELLADLVKE***********************VSDDLCLVPDISLLQKDLSVPSITKSSRIWNTSNKYLRPRIFCLEHAAQIEEILQSKGGAEILVICHSDYQKIKAHAAAVAEEIGSPFNYIDVPLDAASEEDLHLIDLAIDDGELDECREDWTSKLGINLRHCVKVRK********HALSLGDLF********FSKIKWQFRRSRSKIKLYGRA********************************************************************************************************************************ADSLATATLVVDSIVQND****KELNIEGDIFHMATC********************************************************HCRKIE*L****SCMISEAC***************************************************************************************************AAADLLNVGTKQKLISSCVS**********KVGGCSEVPIEICT***********************************************************************************************VI************************************************************************************************************************LKGHHRCDLDGCRMSFET*****L***NRCPHEGCGKRFSSHKYAIIHQRVHDDERPLKCPWKGCSMSFKWAWARTEHIRVHTGERPYKCKFEGCGLSFRFVSDI***************
****************GLPLAPVFYPTDTEFADPIAYISRIEKEASAFGICKIVPPLPKPSKKYVFGNLNKSLSKCSELGSDVN**D********************VFTTRHQELGQSVKRIKGVDNKDN*****************LEQFESKSKAFARSLLSVIKEVSPLVIEALFWKAASEKPVYVEYANDVPGSGFGEPEGQFRYFHRRRRKVTSWKSYRNRGKADEKNIELESARNCHNDQITHSCDKNDLETPTSSTPSSTLPFDENSRSSRRKSVTGSNDVEGTAGWKLSNSPWNLQVISRSPGSLTRFMPDDIPGVTSPMVYIGMLFSWFAWHVEDHELHSMNFLHTGAPKTWYAIPGDYAFTFEEVIRNEAYGGDIDRLAALSLLGEKTTLISPEVIAASGIPCCRLVQNPGEFVVTFPRAYHAGFSHGFNCGEAANFGTPQWLMVAKEAAVRRAAMNYLPMLSHQQLLYLLTMSFISRVPRSLLPGARSSRLRDRQK*****************ENN**SVLLGRQSTFNAVLWNADLLPCQ********************************NNLLDE******************SRDFHIDSGALACVACGILGFPFMSVVQLSE**********************************************************************KYLRPRIFCLEHAAQIEEILQSKGGAEILVICHSDYQKIKAHAAAVAEEIGSPFNYIDVPLDAASEEDLHLIDLAIDDGELDECREDWTSKLGINLRHC*****************LGD***************WQFRR*******Y*RAHSKPCQNIE************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************LDGCRMSFETKRELSLHKRNRCPHEGCGKRFSSHKYAIIHQRVHDDERPLKCPWKGCSMSFKWAWARTEHIRVHTGERPYKCKFEGCGLSFRFVSDIS**************
MGNNSNNNVEIPKWLQGLPLAPVFYPTDTEFADPIAYISRIEKEASAFGICKIVPPLPKPSKKYVFGNLNKSLSKCSELGSDVNLPDAGTVATVGCCERGNEGEARAVFTTRHQELGQSVKRIKGVDNKDNLQLGAQKQVWQSGEVYTLEQFESKSKAFARSLLSVIKEVSPLVIEALFWKAASEKPVYVEYANDVPGSGFGEPEGQFRYFHRRRRKVTSWKSYRNRGKADEKNIELESARNCHNDQITHSCDKN*********************************VEGTAGWKLSNSPWNLQVISRSPGSLTRFMPDDIPGVTSPMVYIGMLFSWFAWHVEDHELHSMNFLHTGAPKTWYAIPGDYAFTFEEVIRNEAYGGDIDRLAALSLLGEKTTLISPEVIAASGIPCCRLVQNPGEFVVTFPRAYHAGFSHGFNCGEAANFGTPQWLMVAKEAAVRRAAMNYLPMLSHQQLLYLLTMSFISRVPRSLLPGA***********ERELLVKKAFVEDILKENNILSVLLGRQSTFNAVLWNADLLPCQS*****************ETVPNNPYEKHNDHNNLLDEMNVYMEALNDPYMGDDDISRDFHIDSGALACVACGILGFPFMSVVQLSERASIELLADLVKEGPGVSELKNTHHHTNLDGSVKSSVSDDLCLVPDISLLQKDLSVPSITKSSRIWNTSNKYLRPRIFCLEHAAQIEEILQSKGGAEILVICHSDYQKIKAHAAAVAEEIGSPFNYIDVPLDAASEEDLHLIDLAIDDGELDECREDWTSKLGINLRHCVKVRKNSPSMRVQHALSLGDLFSEKSLSSDFSKIKWQFRRSRSKIKLYGRAHSKPCQNIEIKKDEVTGRKLDGATVKKEEKLIQYSRRK***********CGDQVHPRELLPEVSAATCDHLDGHNRSDFEINPDGTGNSGSISAGSIHSPIGMSEGLHDIPVREATSNLSLNYSPSRVADSLATATLVVDSIVQNDTESMKELNIEGDIFHMATCKSAE********************VASNEGSIIMRSDQITESMTIKNEKCNLASEGHCRKIEDLAPDNSCMISEACDHMISDNEVRQNVQSTNGGNDVEPISCDHKLIDEPP*************STAESLQDNLQHERNIGNGSNEELVSSSVTMMIQPTSAPMEISEVPSKECAAADLLNVGTKQKLISSCVSRMEVDQPSPLKVGGCSEVPIEICTKEDSGADMTLDPRTQLQNHTTAEAIMDELVCNSSAQLEENERIPASVAACSEESNGIFAEEKMDFDMTIGTQ***********TSLIPIDQPIPAVIRKYSRTRRESYSAEKFCNGNEA*****************************NRELERLTENKFNGSGFIRSPCEGL************EVDIRKIAEKRAT************CQDKKKILKGHHRCDLDGCRMSFETKRELSLHKRNRCPHEGCGKRFSSHKYAIIHQRVHDDERPLKCPWKGCSMSFKWAWARTEHIRVHTGERPYKCKFEGCGLSFRFVSDISR*************
********VEIPKWLQGLPLAPVFYPTDTEFADPIAYISRIEKEASAFGICKIVPPLPKPSKKYVFGNLNKSLSKCSELGSDVNLPDAG*VATVGCCERGNEGEARAVFTTRHQELGQSVKR***********LGAQKQVWQSGEVYTLEQFESKSKAFARSLLSVIKEVSPLVIEALFWKAASEKPVYVEYANDVPGSGFGEPEGQFRYFHRRRRKVTSWKSYRNRGKADEKNIELESARNCHNDQITHSCDKNDL*************************************WKLSNSPWNLQVISRSPGSLTRFMPDDIPGVTSPMVYIGMLFSWFAWHVEDHELHSMNFLHTGAPKTWYAIPGDYAFTFEEVIRNEAYGGDIDRLAALSLLGEKTTLISPEVIAASGIPCCRLVQNPGEFVVTFPRAYHAGFSHGFNCGEAANFGTPQWLMVAKEAAVRRAAMNYLPMLSHQQLLYLLTMSFISRVPRSLLPGARSSRLRDRQKEERELLVKKAFVEDILKENNILSVLLGRQSTFNAVLWNADLLPC***********************************************NDPYMGDDDISRDFHIDSGALACVACGILGFPFMSVVQLSERASIELLADLVK*********************************D****QKDLSVPSITKSSRIWNTSNKYLRPRIFCLEHAAQIEEILQSKGGAEILVICHSDYQKIKAHAAAVAEEIGSPFNYIDVPLDAASEEDLHLIDLAIDDGELDECREDWTSKLGINLRHCVKVRKNSPSMRVQHALSLGDLFSEKSLSSDFSKIKWQFRRSRSKIKLYGRAHSKPCQNIEIKKDEVTGRKLDGATVKKEEKLIQYSRRKFKQ********C***V*PRELLPEVSAATCDHLDGHNRSDFEINPDGTGNSGSISAGSIHSPIGMSEGLHDIPVREATSNLSLNYSPSRVADSLATATLVVDSIVQNDTESMKELNIEGDIFHMATCKSAEMQQNSGTDV******ISHHT***NEGSI*MRSDQITESMTIKNEKCNLASEGHCRKIEDLAPDNSCMISEACDH******************************************DMREIST*ESLQDNLQHERNIGNGSN***VSSSVTMMI*PTSA*ME*SEVPSKECAA*DLLNVG*********************************************************************************VAACSEESNGIFAEEKMDFDMTIGTQTKNATSEEPKPTSLIPIDQPIPAVIRKYSRTRRESYSAEKFCNGNEAYSSKDNKERECNESNLEDPSFSAGKGRKRNRELERLTENKFNGSGFIRSPCEGLRSRAGKDAANTSEVDIRKIAEKRATKTMRNRESVPAPCQDKKKILKGHHRCDLDGCRMSFETKRELSLHKRNRCPHEGCGKRFSSHKYAIIHQRVHDDERPLKCPWKGCSMSFKWAWARTEHIRVHTGERPYKCKFEGCGLSFRFVSD****************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNNSNNNVEIPKWLQGLPLAPVFYPTDTEFADPIAYISRIEKEASAFGICKIVPPLPKPSKKYVFGNLNKSLSKCSELGSDVNLPDAGTVATVGCCERGNEGEARAVFTTRHQELGQSVKRIKGVDNKDNLQLGAQKQVWQSGEVYTLEQFESKSKAFARSLLSVIKEVSPLVIEALFWKAASEKPVYVEYANDVPGSGFGEPEGQFRYFHRRRRKVTSWKSYRNRGKADEKNIELESARNCHNDQITHSCDKNDLETPTSSTPSSTLPFDENSRSSRRKSVTGSNDVEGTAGWKLSNSPWNLQVISRSPGSLTRFMPDDIPGVTSPMVYIGMLFSWFAWHVEDHELHSMNFLHTGAPKTWYAIPGDYAFTFEEVIRNEAYGGDIDRLAALSLLGEKTTLISPEVIAASGIPCCRLVQNPGEFVVTFPRAYHAGFSHGFNCGEAANFGTPQWLMVAKEAAVRRAAMNYLPMLSHQQLLYLLTMSFISRVPRSLLPGARSSRLRDRQKEERELLVKKAFVEDILKENNILSVLLGRQSTFNAVLWNADLLPCQSKESQMPSANETVSTTPGETVPNNPYEKHNDHNNLLDEMNVYMEALNDPYMGDDDISRDFHIDSGALACVACGILGFPFMSVVQLSERASIELLADLVKEGPGVSELKNTHHHTNLDGSVKSSVSDDLCLVPDISLLQKDLSVPSITKSSRIWNTSNKYLRPRIFCLEHAAQIEEILQSKGGAEILVICHSDYQKIKAHAAAVAEEIGSPFNYIDVPLDAASEEDLHLIDLAIDDGELDECREDWTSKLGINLRHCVKVRKNSPSMRVQHALSLGDLFSEKSLSSDFSKIKWQFRRSRSKIKLYGRAHSKPCQNIEIKKDEVTGRKLDGATVKKEEKLIQYSRRKFKQKPDLSTGACGDQVHPRELLPEVSAATCDHLDGHNRSDFEINPDGTGNSGSISAGSIHSPIGMSEGLHDIPVREATSNLSLNYSPSRVADSLATATLVVDSIVQNDTESMKELNIEGDIFHMATCKSAEMQQNSGTDVTSEKTEISHHTVASNEGSIIMRSDQITESMTIKNEKCNLASEGHCRKIEDLAPDNSCMISEACDHMISDNEVRQNVQSTNGGNDVEPISCDHKLIDEPPASTGESCEDMREISTAESLQDNLQHERNIGNGSNEELVSSSVTMMIQPTSAPMEISEVPSKECAAADLLNVGTKQKLISSCVSRMEVDQPSPLKVGGCSEVPIEICTKEDSGADMTLDPRTQLQNHTTAEAIMDELVCNSSAQLEENERIPASVAACSEESNGIFAEEKMDFDMTIGTQTKNATSEEPKPTSLIPIDQPIPAVIRKYSRTRRESYSAEKFCNGNEAYSSKDNKERECNESNLEDPSFSAGKGRKRNRELERLTENKFNGSGFIRSPCEGLRSRAGKDAANTSEVDIRKIAEKRATKTMRNRESVPAPCQDKKKILKGHHRCDLDGCRMSFETKRELSLHKRNRCPHEGCGKRFSSHKYAIIHQRVHDDERPLKCPWKGCSMSFKWAWARTEHIRVHTGERPYKCKFEGCGLSFRFVSDISRHRRKTGHYENLSA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1581 2.2.26 [Sep-21-2011]
Q6BDA01340 Probable lysine-specific yes no 0.581 0.686 0.557 0.0
Q9STM31360 Lysine-specific demethyla no no 0.217 0.252 0.471 1e-91
Q8GUI6954 Probable lysine-specific no no 0.114 0.189 0.443 7e-42
P293751690 Lysine-specific demethyla yes no 0.118 0.111 0.372 9e-35
Q9VMJ71838 Lysine-specific demethyla yes no 0.114 0.098 0.368 2e-34
Q3UXZ91690 Lysine-specific demethyla yes no 0.111 0.104 0.388 2e-34
Q9US53715 Jumonji/ARID domain-conta yes no 0.123 0.272 0.38 3e-34
Q30DN61545 Lysine-specific demethyla no no 0.138 0.141 0.349 3e-34
Q622401548 Lysine-specific demethyla no no 0.108 0.111 0.392 4e-34
Q3U2K5510 Lysine-specific demethyla no no 0.086 0.268 0.492 5e-34
>sp|Q6BDA0|ELF6_ARATH Probable lysine-specific demethylase ELF6 OS=Arabidopsis thaliana GN=ELF6 PE=1 SV=1 Back     alignment and function desciption
 Score = 1038 bits (2684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 565/1014 (55%), Positives = 687/1014 (67%), Gaps = 94/1014 (9%)

Query: 8    NVEIPKWLQGLPLAPVFYPTDTEFADPIAYISRIEKEASAFGICKIVPPLPKPSKKYVFG 67
            NVEIP WL+ LPLAPVF PTDTEFADPIAYIS+IEKEASAFGICKI+PPLPKPSKKYVF 
Sbjct: 3    NVEIPNWLKALPLAPVFRPTDTEFADPIAYISKIEKEASAFGICKIIPPLPKPSKKYVFY 62

Query: 68   NLNKSLSKCSELGSDVNLPDAGTVATVGCCERGNEGEARAVFTTRHQELGQSVKRIKGVD 127
            NLNKSL KC EL SDV++           C+     E RAVFTTR QELGQ+VK+ KG  
Sbjct: 63   NLNKSLLKCPELVSDVDISKV--------CK-----EDRAVFTTRQQELGQTVKKNKGEK 109

Query: 128  NKDNLQLGAQKQVWQSGEVYTLEQFESKSKAFARSLLSVIKEVSPLVIEALFWKAASEKP 187
             K N Q    KQVWQSG VYTL+QFE+KSKAF ++ L  +KE++P+VIEALFWKAA EKP
Sbjct: 110  GKSNSQRSGVKQVWQSGGVYTLDQFEAKSKAFYKTQLGTVKELAPVVIEALFWKAALEKP 169

Query: 188  VYVEYANDVPGSGFGEPEGQFRYFHRRRRKVTSWKSYRNRGKADEKNIELESARNCHNDQ 247
            +Y+EYANDVPGS FGEPE  FR+F +R+R        R RG    K          +ND 
Sbjct: 170  IYIEYANDVPGSAFGEPEDHFRHFRQRKR--------RGRGFYQRKTE--------NNDP 213

Query: 248  ITHSCDKNDLETPTSSTPSSTLPFDENSRSSRRKSVTGSNDVEGTAGWKLSNSPWNLQVI 307
               + +K+  E   +   S++     +  SS++K++   +++EGTAGWKLSNS WNLQ+I
Sbjct: 214  SGKNGEKSSPEVEKAPLASTS---LSSQDSSKQKNMDIVDEMEGTAGWKLSNSSWNLQMI 270

Query: 308  SRSPGSLTRFMPDDIPGVTSPMVYIGMLFSWFAWHVEDHELHSMNFLHTGAPKTWYAIPG 367
            +RSPGS+TRFMPDDIPGVTSPMVYIGMLFSWFAWHVEDHELHSMN+LHTG+PKTWYA+P 
Sbjct: 271  ARSPGSVTRFMPDDIPGVTSPMVYIGMLFSWFAWHVEDHELHSMNYLHTGSPKTWYAVPC 330

Query: 368  DYAFTFEEVIRNEAYGGDIDRLAALSLLGEKTTLISPEVIAASGIPCCRLVQNPGEFVVT 427
            DYA  FEEVIR  +YG +ID+LAAL+ LGEKTTL+SPE+I ASGIPCCRLVQNPGEFVVT
Sbjct: 331  DYALDFEEVIRKNSYGRNIDQLAALTQLGEKTTLVSPEMIVASGIPCCRLVQNPGEFVVT 390

Query: 428  FPRAYHAGFSHGFNCGEAANFGTPQWLMVAKEAAVRRAAMNYLPMLSHQQLLYLLTMSFI 487
            FPR+YH GFSHGFNCGEAANFGTPQWL VAKEAAVRRAAMNYLPMLSHQQLLYLLTMSF+
Sbjct: 391  FPRSYHVGFSHGFNCGEAANFGTPQWLNVAKEAAVRRAAMNYLPMLSHQQLLYLLTMSFV 450

Query: 488  SRVPRSLLPGARSSRLRDRQKEERELLVKKAFVEDILKENNILSVLLGRQSTFNAVLWNA 547
            SRVPRSLLPG RSSRLRDRQ+EERE LVK+AFVEDIL EN  LSVLL R+     V+W+ 
Sbjct: 451  SRVPRSLLPGGRSSRLRDRQREEREFLVKRAFVEDILNENKNLSVLL-REPGSRLVMWDP 509

Query: 548  DLLPCQ-SKESQMPSANETVSTTPGETVPNNPYEKHNDHNN-----LLDEMNVYMEALND 601
            DLLP   +            + +P         E H++  N     LL+E++++ME LND
Sbjct: 510  DLLPRHSALALAAAGVAGASAVSPPAVAKKELEEGHSELQNKEKTSLLEELSLFMEKLND 569

Query: 602  PYMGDDD-ISRDFHIDSGALACVACGILGFPFMSVVQLSERASIELLADLVKEGPGVSEL 660
             Y  DDD +  DF +D+G L CVACG+LGFPFMSVVQ SE+A    L DL          
Sbjct: 570  VYYDDDDGLLNDFQVDTGTLPCVACGVLGFPFMSVVQPSEKA----LKDL---------- 615

Query: 661  KNTHHHTNLDGSVKSSVSDDLCLVPDISLLQKDLSVPSITKSSRIWNTSNKYLRPRIFCL 720
                       S +   +D            +++   S  KS   W TS++Y+RPRIFCL
Sbjct: 616  -----------SERQGETD-----------AQEIMTLSSEKSDCEWKTSSRYIRPRIFCL 653

Query: 721  EHAAQIEEILQSKGGAEILVICHSDYQKIKAHAAAVAEEIGSPFNYIDVPLDAASEEDLH 780
            EH  +++ +LQS+GG + LVICH D+QK KAHAA VAEE+  PF+Y DV L++AS+E+L 
Sbjct: 654  EHTIELQRLLQSRGGLKFLVICHKDFQKFKAHAAIVAEEVKVPFSYDDVLLESASQEELS 713

Query: 781  LIDLAIDDGELDECREDWTSKLGINLRHCVKVRKNSPSMRVQHALSLGDLFSEKSLSSDF 840
            LIDLAI+D E  E   DWTS+LGINLR+CVKVRKNSP+ ++QHALSLG LFS+ S   DF
Sbjct: 714  LIDLAIEDEEKYEHSVDWTSELGINLRYCVKVRKNSPTKKIQHALSLGGLFSDTSQMLDF 773

Query: 841  SKIKWQFRRSRSKIKLYGRAHSKPCQNIEIKKDEVTGRKLDGATVKKEEKLIQYSRRKFK 900
            + I+W  R+SRSK K    +   PC+++E+K D      LD  T KKEEK+IQYSR+K  
Sbjct: 774  TTIRWLQRKSRSKAKPSSTSSFTPCEHLEVKADGKLRDNLDSQTGKKEEKIIQYSRKK-- 831

Query: 901  QKPDLSTGACGDQVHPRELLPEVS--AATC------DHLDGHNRSDF--EINPDG--TGN 948
                L+     +QV     L +      TC       HLD   RS+   EI   G   G 
Sbjct: 832  ---KLNPKPSAEQVQELATLAKSKDFDKTCKNFSSRSHLDSAIRSEMNSEIGDSGRVIGV 888

Query: 949  SGSISAGSIHSPIGMSEGLHDIPVREATSNLSLNYSPSRVADSLATATLVVDSI 1002
            S SI+  S    +G  +   +I V+   S+L  N + S    +  +A L + SI
Sbjct: 889  SFSINPCSSSFTVGHGQEHPEITVKFG-SDLDGNVTNSLSMVNGDSADLTLTSI 941
Acts probably as a histone 'Lys-4' (H3K4me) demethylase. Involved in transcriptional gene regulation. Acts as a repressor of the photoperiodic flowering pathway and of FT. Binds around the transcription start site of the FT locus.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 1EC: .EC: -
>sp|Q9STM3|REF6_ARATH Lysine-specific demethylase REF6 OS=Arabidopsis thaliana GN=REF6 PE=1 SV=1 Back     alignment and function description
>sp|Q8GUI6|JMJ14_ARATH Probable lysine-specific demethylase JMJ14 OS=Arabidopsis thaliana GN=JMJ14 PE=1 SV=1 Back     alignment and function description
>sp|P29375|KDM5A_HUMAN Lysine-specific demethylase 5A OS=Homo sapiens GN=KDM5A PE=1 SV=3 Back     alignment and function description
>sp|Q9VMJ7|KDM5_DROME Lysine-specific demethylase lid OS=Drosophila melanogaster GN=lid PE=1 SV=1 Back     alignment and function description
>sp|Q3UXZ9|KDM5A_MOUSE Lysine-specific demethylase 5A OS=Mus musculus GN=Kdm5a PE=1 SV=2 Back     alignment and function description
>sp|Q9US53|JMJ2_SCHPO Jumonji/ARID domain-containing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=jmj2 PE=4 SV=1 Back     alignment and function description
>sp|Q30DN6|KDM5D_CANFA Lysine-specific demethylase 5D OS=Canis familiaris GN=KDM5D PE=2 SV=1 Back     alignment and function description
>sp|Q62240|KDM5D_MOUSE Lysine-specific demethylase 5D OS=Mus musculus GN=Kdm5d PE=2 SV=2 Back     alignment and function description
>sp|Q3U2K5|KDM4D_MOUSE Lysine-specific demethylase 4D OS=Mus musculus GN=Kdm4d PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1581
2555817691554 conserved hypothetical protein [Ricinus 0.944 0.961 0.536 0.0
3565746111481 PREDICTED: probable lysine-specific deme 0.896 0.956 0.487 0.0
2254490121415 PREDICTED: probable lysine-specific deme 0.697 0.778 0.567 0.0
3565339571499 PREDICTED: probable lysine-specific deme 0.901 0.950 0.457 0.0
2960859971550 unnamed protein product [Vitis vinifera] 0.669 0.682 0.537 0.0
4495057211516 PREDICTED: probable lysine-specific deme 0.523 0.546 0.616 0.0
4494643941531 PREDICTED: probable lysine-specific deme 0.523 0.540 0.615 0.0
795071581340 jumonji/Zn finger-class transcription fa 0.581 0.686 0.557 0.0
2978063971336 hypothetical protein ARALYDRAFT_487204 [ 0.578 0.684 0.558 0.0
99555791327 zinc finger protein-like [Arabidopsis th 0.569 0.678 0.511 0.0
>gi|255581769|ref|XP_002531686.1| conserved hypothetical protein [Ricinus communis] gi|223528691|gb|EEF30705.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score = 1553 bits (4022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 875/1630 (53%), Positives = 1091/1630 (66%), Gaps = 136/1630 (8%)

Query: 8    NVEIPKWLQGLPLAPVFYPTDTEFADPIAYISRIEKEASAFGICKIVPPLPKPSKKYVFG 67
            NVEIPKWL+ LPLAP F+PTDTEFADPIAYIS+IEK+A+AFGICKI+PPLPKPSK+YVFG
Sbjct: 5    NVEIPKWLKDLPLAPEFHPTDTEFADPIAYISKIEKKATAFGICKIIPPLPKPSKRYVFG 64

Query: 68   NLNKSLSKCSELGSDVNLPDAGTVATVGCCERGNEGEARAVFTTRHQELGQSVKRIKGVD 127
            NLNKSLSKC ELG  VNL +A ++   G  + GN+GEARAVFTTRHQELGQ +K+ KG  
Sbjct: 65   NLNKSLSKCPELGDSVNLSNASSLKK-GLQDIGNDGEARAVFTTRHQELGQDIKKTKGTI 123

Query: 128  NKDNLQLGAQKQVWQSGEVYTLEQFESKSKAFARSLLSVIKEVSPLVIEALFWKAASEKP 187
             K+N QLG  KQVWQSGE+YTL+QFESKSKAFA+SLL + KE+SPLVIE LFWKAAS+KP
Sbjct: 124  -KENPQLGVHKQVWQSGEIYTLDQFESKSKAFAKSLLGMFKEISPLVIETLFWKAASDKP 182

Query: 188  VYVEYANDVPGSGFGEPEGQFRYFHRRRRKVTSWKSYR-NRGKADEKNIELESARNCHND 246
            ++VEYANDVPGS FGEPE QF+YFH RRRK  S+KSYR + G +D K  E+++  N  ND
Sbjct: 183  IHVEYANDVPGSAFGEPEDQFKYFHIRRRKRASYKSYRRSAGSSDCKEKEIDNVNNLDND 242

Query: 247  QITHSCDKNDLETPTSSTPSSTLPF--------DENSRSSRRKSVTGSNDVEGTAGWKLS 298
            ++  +  KN+   P+ S+ + +           +E  RSS+RKSV  +ND+EGTAGWKLS
Sbjct: 243  EMKGTAMKNE---PSMSSETISRSSITSSVVLSEEILRSSKRKSVNANNDMEGTAGWKLS 299

Query: 299  NSPWNLQVISRSPGSLTRFMPDDIPGVTSPMVYIGMLFSWFAWHVEDHELHSMNFLHTGA 358
            NSPWNLQVI+RSPGSLTRFMPDDIPGVTSPM+YIGMLFSWFAWHVEDHELHSMNFLHTG+
Sbjct: 300  NSPWNLQVIARSPGSLTRFMPDDIPGVTSPMIYIGMLFSWFAWHVEDHELHSMNFLHTGS 359

Query: 359  PKTWYAIPGDYAFTFEEVIRNEAYGGDIDRLAALSLLGEKTTLISPEVIAASGIPCCRLV 418
             KTWYA+PGD+AFTFEEVIR +AYGG IDRLAAL+LLGEKTTL+SPEVI +SGIPCCRL+
Sbjct: 360  AKTWYAVPGDHAFTFEEVIRMQAYGGGIDRLAALTLLGEKTTLLSPEVIVSSGIPCCRLI 419

Query: 419  QNPGEFVVTFPRAYHAGFSHGFNCGEAANFGTPQWLMVAKEAAVRRAAMNYLPMLSHQQL 478
            QNPGEFVVTFPRAYH GFSHGFNCGEAANFGTPQWL VAKEAAVRRAAMNYLPMLSHQQL
Sbjct: 420  QNPGEFVVTFPRAYHVGFSHGFNCGEAANFGTPQWLKVAKEAAVRRAAMNYLPMLSHQQL 479

Query: 479  LYLLTMSFISRVPRSLLPGARSSRLRDRQKEERELLVKKAFVEDILKENNILSVLLGRQS 538
            LYLLTMSF+SRVPRSLLPGARSSRLRDR KEEREL VKKAF+ED+LKENNILS LLG+ S
Sbjct: 480  LYLLTMSFVSRVPRSLLPGARSSRLRDRLKEERELSVKKAFIEDMLKENNILSALLGKDS 539

Query: 539  TFNAVLWNADLLPCQSKESQMPSANETVSTTPGETVPNNPYEKHND---HNNLLDEMNVY 595
              N V+WN DLLPC +K+ Q+PS   TV+ T  E V ++ + K N     N+L  EM++Y
Sbjct: 540  ICNVVIWNPDLLPCANKDFQVPS---TVTATTEEIV-SSFHSKDNSSTTENDLFKEMSLY 595

Query: 596  MEALNDPYM-GDDDISRDFHIDSGALACVACGILGFPFMSVVQLSERASIELLADLVKEG 654
            ME LND Y+  D D+S DF +DSG LACVACGILGFPFMSVVQ S+ A   LL     + 
Sbjct: 596  METLNDLYVDDDGDLSDDFQVDSGTLACVACGILGFPFMSVVQPSDTALAGLL-----DH 650

Query: 655  PGVSELKNTHHHTNLDGSVKSSVSDDLCLVPDISLLQKDLSVPSITKSSRIWNTSNKYLR 714
            P V E           GS++ S +  L                     SR WN S+K+LR
Sbjct: 651  PLVQE-----------GSIEESGNLPL---------------------SRGWNNSSKFLR 678

Query: 715  PRIFCLEHAAQIEEILQSKGGAEILVICHSDYQKIKAHAAAVAEEIGSPFNYIDVPLDAA 774
            PRIFCLEH  QIEE+L+SKGGA +L+ICHSDYQKI+AHAAA+AEEI +PFNY ++PL++A
Sbjct: 679  PRIFCLEHGVQIEELLRSKGGANMLLICHSDYQKIRAHAAAIAEEIDTPFNYNEIPLESA 738

Query: 775  SEEDLHLIDLAIDDGELDECREDWTSKLGINLRHCVKVRKNSPSMRVQHALSLGDLFSEK 834
            S+EDL+LI +AID  + D+C EDWTSKL INLR+CVKVRKNSPS +VQHAL+LG LFS++
Sbjct: 739  SQEDLNLIYIAIDSEDHDDCGEDWTSKLAINLRYCVKVRKNSPSNKVQHALALGGLFSDE 798

Query: 835  SLSSDFSKIKWQFRRSRSKIKLYGRAHSKPCQNIEIKKDEVTGRKLDGATVKKEEKLIQY 894
            + SSDF  IKWQ RRSRS+IKL   AH KP   +E  K+ + G+  D   VK E KLIQY
Sbjct: 799  T-SSDFLNIKWQSRRSRSRIKLNRPAHCKPQNRVETNKENILGKTSDNVIVKTENKLIQY 857

Query: 895  SRRKFKQKPDLSTGACGDQVHPRE-LLPEVSAATCDHLDGHNRSDFEINPDGTGNSGSIS 953
            +RRK+K K D S  A  +Q  PR+  + +VS A C+ L  H R   +I P     S S +
Sbjct: 858  TRRKYKVKIDCS--ARWNQGCPRKHTMEQVSGANCEDLVKHTRKTSKITP-AVEISRSDA 914

Query: 954  AGSIHSPIGMSEGLHDIPVREATSNLSLNYSPSRVADSLATATLVVDSIVQNDTESMKEL 1013
            AGS  SPIGMS  LH++ V EAT  + LN +   V   + TA   ++ +V+     +++ 
Sbjct: 915  AGSCMSPIGMSGVLHEVQVLEATDEMCLNSASLHVTGPVLTANPAIERVVRQVEIPLEKS 974

Query: 1014 NIEGDIFHMATCKSAEMQQNSGT------DVTSEKTEISHHTVASNEGSIIMRSDQITES 1067
            N   ++  ++   S ++Q           D  S  T +    V + E S +      T++
Sbjct: 975  NRFENVSTVSARVSFKIQHEEKVNGVIIEDEDSSGTNLCSQCVTAAERSEMEGEYHTTKN 1034

Query: 1068 MTIKNEKCNLASEGHCRKIED---LAPDNSCMISEACDHMISDNEVRQNVQSTNGGNDVE 1124
            +++ NE   +  EG  + + D   LA +   ++++   +M                    
Sbjct: 1035 ISLTNEAREIFCEGQYKILGDRDVLANELLILLTQLV-YMF------------------- 1074

Query: 1125 PISCDHKLIDEPPASTGESCEDMREISTAESLQDNLQHERNIGNGSNEELVSSSVTMMIQ 1184
             ++    L D+   S  ES E ++E    E   D LQHE  I +G N+EL+  ++ M  Q
Sbjct: 1075 -LTLLDTLKDQHAVSLEESTECLQETCAEE---DKLQHEIEITSGINKELI-PNIVMNDQ 1129

Query: 1185 PTSAPMEISEVPSKECAAADLLNVGTKQKL--------------ISSCVSRMEVDQPSPL 1230
               +  E SE+  + C +A+L NV  K+ +               S  +++M +DQP+ +
Sbjct: 1130 NHVSVAESSEILKQPCISANLFNVTLKRGMQQGIQFTKERKKEHCSCSITQMGIDQPNAV 1189

Query: 1231 KVGGCSEVPIEICTKEDSGADMTLDPRTQLQNHTTAEAIMDELVCNSSAQLEENERIPAS 1290
                 SE  +   + ++      LD    L+  T   + ++ ++ NS+ Q+++   IP  
Sbjct: 1190 SEETISEA-LGGTSAKNLWTGSILDFDMLLKVPTVNRSKVENIIPNSTNQIQD-PVIPVI 1247

Query: 1291 VAACSEE-------SNGIFAEEKM------------DFDMTIGTQTKNATSEEPKPTSLI 1331
            V   SE        S G+  E K+            D ++    QT   T+EE   + + 
Sbjct: 1248 VEEYSEVPRASSVFSVGLNLETKLQKPIHSDDVVYRDDEVHEVCQTPRETNEERLLSHIT 1307

Query: 1332 PIDQPIPAVIRKYSRTRRESYSAEKFCNGNEAYSSKDNKERECNESNLEDPSFSAGKGRK 1391
             I Q  PA I++   T  ESYS      G +  SS    E E  ES + DP  + GKGRK
Sbjct: 1308 QISQQSPAQIKRCFGTEEESYSTGNVFKGQDDCSS---HELESAESAVVDPRSTVGKGRK 1364

Query: 1392 RNRELERLTENKFNGSGFIRSPCEGLRSRAGKDAANTSEVDIRKIAEKRATKTMRNRESV 1451
            R  E+E LTENK N +GFI SPCEGLR RAGKDA   + VDIRK A++        +   
Sbjct: 1365 RKNEVEHLTENKLNNNGFIISPCEGLRPRAGKDATFRNGVDIRKSAQENPMTKKARKPVN 1424

Query: 1452 PAPCQDKKKILKGHHRCDLDGCRMSFETKRELSLHKRNRCPHEGCGKRFSSHKYAIIHQR 1511
              P   KK+I K  ++CDL+GC MSFET+ EL LHKRNRCP+EGC KRF+SH+YAIIHQR
Sbjct: 1425 SVPNAKKKEIAKRSYKCDLEGCPMSFETRAELLLHKRNRCPYEGCRKRFNSHRYAIIHQR 1484

Query: 1512 VHDDERPLKCPWKGCSMSFKWAWARTEHIRVHTGERPYKCKFEGCGLSFRFVSDISRHRR 1571
            VH+D+RPLKCPWK CSMSFKWAWARTEH+RVHTGE+PYKCK EGCG +FRFVSD SRHRR
Sbjct: 1485 VHEDDRPLKCPWKDCSMSFKWAWARTEHMRVHTGEKPYKCKVEGCGRTFRFVSDFSRHRR 1544

Query: 1572 KTGHYENLSA 1581
            KTGH  N  A
Sbjct: 1545 KTGHCVNTPA 1554

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356574611|ref|XP_003555439.1| PREDICTED: probable lysine-specific demethylase ELF6-like [Glycine max] Back     alignment and taxonomy information
>gi|225449012|ref|XP_002273747.1| PREDICTED: probable lysine-specific demethylase ELF6-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356533957|ref|XP_003535524.1| PREDICTED: probable lysine-specific demethylase ELF6-like [Glycine max] Back     alignment and taxonomy information
>gi|296085997|emb|CBI31438.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449505721|ref|XP_004162550.1| PREDICTED: probable lysine-specific demethylase ELF6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449464394|ref|XP_004149914.1| PREDICTED: probable lysine-specific demethylase ELF6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|79507158|ref|NP_196044.2| jumonji/Zn finger-class transcription factor ELF6 [Arabidopsis thaliana] gi|75323150|sp|Q6BDA0.1|ELF6_ARATH RecName: Full=Probable lysine-specific demethylase ELF6; AltName: Full=Early flowering 6; AltName: Full=Jumonji domain-containing protein 11; AltName: Full=Probable lysine-specific histone demethylase ELF6 gi|50513175|gb|AAT77780.1| early flowering 6 [Arabidopsis thaliana] gi|332003334|gb|AED90717.1| jumonji/Zn finger-class transcription factor ELF6 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297806397|ref|XP_002871082.1| hypothetical protein ARALYDRAFT_487204 [Arabidopsis lyrata subsp. lyrata] gi|297316919|gb|EFH47341.1| hypothetical protein ARALYDRAFT_487204 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|9955579|emb|CAC05506.1| zinc finger protein-like [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1581
TAIR|locus:21466531340 ELF6 "EARLY FLOWERING 6" [Arab 0.233 0.275 0.702 2.5e-279
TAIR|locus:5049556441360 REF6 "relative of early flower 0.156 0.181 0.596 4.3e-161
TAIR|locus:2128659954 JMJ14 "JUMONJI 14" [Arabidopsi 0.113 0.187 0.456 1.1e-43
DICTYBASE|DDB_G02687781198 rbbB "putative Retinoblastoma 0.151 0.199 0.377 4.4e-43
POMBASE|SPAC1002.05c715 jmj2 "histone demethylase Jmj2 0.123 0.272 0.38 1.5e-41
TAIR|locus:2044697806 MEE27 "maternal effect embryo 0.120 0.235 0.415 4.6e-41
TAIR|locus:2196979819 JMJ18 "Jumonji domain-containi 0.121 0.234 0.427 2e-40
UNIPROTKB|G4N2P71755 MGG_04878 "Lid2 complex compon 0.192 0.173 0.325 2.9e-39
TAIR|locus:20256351209 PKDM7D [Arabidopsis thaliana ( 0.114 0.149 0.445 7.5e-39
ASPGD|ASPL00000102431717 AN8211 [Emericella nidulans (t 0.134 0.123 0.397 1.1e-37
TAIR|locus:2146653 ELF6 "EARLY FLOWERING 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1369 (487.0 bits), Expect = 2.5e-279, Sum P(3) = 2.5e-279
 Identities = 265/377 (70%), Positives = 307/377 (81%)

Query:   277 SSRRKSVTGSNDVEGTAGWKLSNSPWNLQVISRSPGSLTRFMPDDIPGVTSPMVYIGMLF 336
             SS++K++   +++EGTAGWKLSNS WNLQ+I+RSPGS+TRFMPDDIPGVTSPMVYIGMLF
Sbjct:   240 SSKQKNMDIVDEMEGTAGWKLSNSSWNLQMIARSPGSVTRFMPDDIPGVTSPMVYIGMLF 299

Query:   337 SWFAWHVEDHELHSMNFLHTGAPKTWYAIPGDYAFTFEEVIRNEAYGGDIDRLAALSLLG 396
             SWFAWHVEDHELHSMN+LHTG+PKTWYA+P DYA  FEEVIR  +YG +ID+LAAL+ LG
Sbjct:   300 SWFAWHVEDHELHSMNYLHTGSPKTWYAVPCDYALDFEEVIRKNSYGRNIDQLAALTQLG 359

Query:   397 EKTTLISPEVIAASGIPCCRLVQNPGEFVVTFPRAYHAGFSHGFNCGEAANFGTPQWLMV 456
             EKTTL+SPE+I ASGIPCCRLVQNPGEFVVTFPR+YH GFSHGFNCGEAANFGTPQWL V
Sbjct:   360 EKTTLVSPEMIVASGIPCCRLVQNPGEFVVTFPRSYHVGFSHGFNCGEAANFGTPQWLNV 419

Query:   457 AKEAAVRRAAMNYLPMLSHQQLLYLLTMSFISRVPRSLLPGARSSRLRDRQKEERELLVK 516
             AKEAAVRRAAMNYLPMLSHQQLLYLLTMSF+SRVPRSLLPG RSSRLRDRQ+EERE LVK
Sbjct:   420 AKEAAVRRAAMNYLPMLSHQQLLYLLTMSFVSRVPRSLLPGGRSSRLRDRQREEREFLVK 479

Query:   517 KAFVEDILKENNILSVLLGRQSTFNAVLWNADLLPCQSKESQMPSANETVSTTPGETVPN 576
             +AFVEDIL EN  LSVLL R+     V+W+ DLLP  S  +   +     S      V  
Sbjct:   480 RAFVEDILNENKNLSVLL-REPGSRLVMWDPDLLPRHSALALAAAGVAGASAVSPPAVAK 538

Query:   577 NPYEK-HNDHNN-----LLDEMNVYMEALNDPYMGDDD-ISRDFHIDSGALACVACGILG 629
                E+ H++  N     LL+E++++ME LND Y  DDD +  DF +D+G L CVACG+LG
Sbjct:   539 KELEEGHSELQNKEKTSLLEELSLFMEKLNDVYYDDDDGLLNDFQVDTGTLPCVACGVLG 598

Query:   630 FPFMSVVQLSERASIEL 646
             FPFMSVVQ SE+A  +L
Sbjct:   599 FPFMSVVQPSEKALKDL 615
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA;TAS
GO:0048577 "negative regulation of short-day photoperiodism, flowering" evidence=IMP
GO:0048579 "negative regulation of long-day photoperiodism, flowering" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0009741 "response to brassinosteroid stimulus" evidence=IMP
GO:0009826 "unidimensional cell growth" evidence=IMP
GO:0033169 "histone H3-K9 demethylation" evidence=IMP
GO:0009630 "gravitropism" evidence=RCA
GO:0019344 "cysteine biosynthetic process" evidence=RCA
GO:0043687 "post-translational protein modification" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
TAIR|locus:504955644 REF6 "relative of early flowering 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2128659 JMJ14 "JUMONJI 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0268778 rbbB "putative Retinoblastoma (Rb) binding protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
POMBASE|SPAC1002.05c jmj2 "histone demethylase Jmj2" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
TAIR|locus:2044697 MEE27 "maternal effect embryo arrest 27" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196979 JMJ18 "Jumonji domain-containing protein 18" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G4N2P7 MGG_04878 "Lid2 complex component lid2" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
TAIR|locus:2025635 PKDM7D [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000010243 AN8211 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.14.110.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1581
pfam02373114 pfam02373, JmjC, JmjC domain, hydroxylase 5e-44
smart0054542 smart00545, JmjN, Small domain found in the jumonj 1e-14
pfam0237534 pfam02375, JmjN, jmjN domain 3e-14
smart0055858 smart00558, JmjC, A domain family that is part of 7e-10
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 0.001
>gnl|CDD|202224 pfam02373, JmjC, JmjC domain, hydroxylase Back     alignment and domain information 
 Score =  155 bits (393), Expect = 5e-44
 Identities = 57/120 (47%), Positives = 71/120 (59%), Gaps = 6/120 (5%)

Query: 329 MVYIGMLFSWFAWHVEDHELHSMNFLHTGAPKTWYAIPGDYAFTFEEVIRNEAYGGDIDR 388
            +Y+GM  S   WH+ED  L+S+N+LH G PK WY IP +YA  FE+V+     G   D 
Sbjct: 1   WLYMGMPGSTTPWHIEDQGLYSINYLHFGGPKVWYIIPSEYAEKFEKVLSKHNGGEQPD- 59

Query: 389 LAALSLLGEKTTLISPEVIAASGIPCCRLVQNPGEFVVTFPRAYHAGFSHGFNCGEAANF 448
                LL    T+ISP+ +  +GIP  R VQ PGEFV TFP  YH  F+ GFN  EA NF
Sbjct: 60  -----LLLHLNTIISPKQLLENGIPVYRFVQKPGEFVFTFPGWYHQVFNLGFNIAEAVNF 114

The JmjC domain belongs to the Cupin superfamily. JmjC-domain proteins may be protein hydroxylases that catalyze a novel histone modification. This is confirmed to be a hydroxylase: the human JmjC protein named Tyw5p unexpectedly acts in the biosynthesis of a hypermodified nucleoside, hydroxy-wybutosine, in tRNA-Phe by catalyzing hydroxylation. Length = 114
>gnl|CDD|128818 smart00545, JmjN, Small domain found in the jumonji family of transcription factors Back     alignment and domain information
>gnl|CDD|190295 pfam02375, JmjN, jmjN domain Back     alignment and domain information
>gnl|CDD|214721 smart00558, JmjC, A domain family that is part of the cupin metalloenzyme superfamily Back     alignment and domain information
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1581
KOG0958690 consensus DNA damage-responsive repressor GIS1/RPH 100.0
KOG1246904 consensus DNA-binding protein jumonji/RBP2/SMCY, c 100.0
PF02373114 JmjC: JmjC domain, hydroxylase; InterPro: IPR01312 99.96
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.79
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.75
smart0054542 JmjN Small domain found in the jumonji family of t 99.59
PF0237534 JmjN: jmjN domain; InterPro: IPR003349 Jumonji pro 99.48
KOG1074958 consensus Transcriptional repressor SALM [Transcri 99.28
KOG36231007 consensus Homeobox transcription factor SIP1 [Tran 99.22
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 99.21
KOG3576267 consensus Ovo and related transcription factors [T 99.2
KOG1074 958 consensus Transcriptional repressor SALM [Transcri 99.17
smart0055857 JmjC A domain family that is part of the cupin met 99.17
KOG3576267 consensus Ovo and related transcription factors [T 99.1
KOG3608 467 consensus Zn finger proteins [General function pre 99.05
KOG3608467 consensus Zn finger proteins [General function pre 99.04
KOG1246904 consensus DNA-binding protein jumonji/RBP2/SMCY, c 98.54
PHA00733128 hypothetical protein 98.46
PLN03086567 PRLI-interacting factor K; Provisional 98.38
PLN03086567 PRLI-interacting factor K; Provisional 98.24
PHA0276855 hypothetical protein; Provisional 97.87
PHA0276855 hypothetical protein; Provisional 97.87
KOG3993500 consensus Transcription factor (contains Zn finger 97.74
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 97.59
KOG3993 500 consensus Transcription factor (contains Zn finger 97.29
PHA00733128 hypothetical protein 97.27
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 97.04
KOG2131427 consensus Uncharacterized conserved protein, conta 96.71
PHA0073279 hypothetical protein 96.59
PHA0061644 hypothetical protein 96.53
PHA0061644 hypothetical protein 96.51
PHA0073279 hypothetical protein 96.28
PF13621251 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XU 96.26
COG5189423 SFP1 Putative transcriptional repressor regulating 96.03
COG5189423 SFP1 Putative transcriptional repressor regulating 95.96
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 95.79
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 95.39
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 95.01
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 94.45
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 93.85
KOG2130407 consensus Phosphatidylserine-specific receptor Ptd 93.35
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 92.81
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 92.55
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 91.21
PF04704330 Zfx_Zfy_act: Zfx / Zfy transcription activation re 90.38
KOG1356889 consensus Putative transcription factor 5qNCA, con 90.26
smart0035526 ZnF_C2H2 zinc finger. 89.04
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 88.97
PRK04860160 hypothetical protein; Provisional 88.35
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 87.9
COG5048467 FOG: Zn-finger [General function prediction only] 87.64
PF08007319 Cupin_4: Cupin superfamily protein; InterPro: IPR0 86.66
COG5048467 FOG: Zn-finger [General function prediction only] 84.88
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 84.44
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 83.47
smart0035526 ZnF_C2H2 zinc finger. 83.0
>KOG0958 consensus DNA damage-responsive repressor GIS1/RPH1, jumonji superfamily [Replication, recombination and repair] Back     alignment and domain information 
Probab=100.00  E-value=2.4e-63  Score=593.18  Aligned_cols=295  Identities=35%  Similarity=0.610  Sum_probs=247.2

Q ss_pred             cccCCCCCccccCChhhhcCHHHHHHHHHHhhhh-cceEEEcCCCCCCCccccccccccccccccccCCCCCCCCCCccc
Q 000392           14 WLQGLPLAPVFYPTDTEFADPIAYISRIEKEASA-FGICKIVPPLPKPSKKYVFGNLNKSLSKCSELGSDVNLPDAGTVA   92 (1581)
Q Consensus        14 w~~~~~~~p~~~Pt~~ef~d~~~yi~~i~~~~~~-~Gi~kivpP~~~Ps~k~~~~nl~ksl~~~~~~~~~~~~~~~~~~~   92 (1581)
                      -|......||||||++||+||.+||++|+++|.+ +||+|||||++|.++..                  ++        
T Consensus         8 ~i~ps~~I~tF~PtmeEF~dF~~yi~~IEs~G~h~aGlaKVipPkeWk~r~~------------------~~--------   61 (690)
T KOG0958|consen    8 EINPSDGIPTFYPTMEEFADFSAYIAYIESQGAHRAGLAKVIPPKEWKPRLM------------------YD--------   61 (690)
T ss_pred             ccCCCCCcceeCcCHHHHHhHHHHHHHHHhccchhcCeeeeeCCccCCcccc------------------cC--------
Confidence            4556889999999999999999999999999755 99999999998776531                  00        


Q ss_pred             cccccCCCCCCcccceeeccccccccccccccccCCccccccccccccccCCCccCHHhHHHHHHHHHHhhcCCCC-CCC
Q 000392           93 TVGCCERGNEGEARAVFTTRHQELGQSVKRIKGVDNKDNLQLGAQKQVWQSGEVYTLEQFESKSKAFARSLLSVIK-EVS  171 (1581)
Q Consensus        93 ~~~~~~~~~~~~~~~~F~TR~Q~l~~~~kk~kg~~~~~~~~~~~~~~~~qsG~~YTL~~F~~~A~~F~~~~f~~~~-~~s  171 (1581)
                                ...+.+.++.+||+-.   +..|....+|.         |.-..||+.||+.+|+.   .-|.... ...
T Consensus        62 ----------di~di~I~~PiqQ~v~---g~~G~F~~~Ni---------~~~kam~v~q~r~lAns---~~y~tpr~~~d  116 (690)
T KOG0958|consen   62 ----------DIDDIKIPAPIQQVVT---GQGGLFTQYNI---------QDKKAMTVRQFRDLANS---DKYCTPRGSQD  116 (690)
T ss_pred             ----------chhheecChhHHHHhh---ccCceEEEeeh---------hhccccChhhhhhhhhh---cccCCCccccc
Confidence                      1123446677775543   34454332332         45778999999999984   3333333 666


Q ss_pred             hHHHHHHhhhhccc-CceEEeeCCCCCCCCCCCCCcchhhhhhccccccccccccccCCccchhhhhhhhcccCCccccc
Q 000392          172 PLVIEALFWKAASE-KPVYVEYANDVPGSGFGEPEGQFRYFHRRRRKVTSWKSYRNRGKADEKNIELESARNCHNDQITH  250 (1581)
Q Consensus       172 ~~~iE~efWr~v~~-~~v~VeYGaDi~GSgF~~~~~~f~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~  250 (1581)
                      .+++|+.|||.+.. .||   ||+|+.||-|+..-                                             
T Consensus       117 ~~dle~kYWKnltf~~Pi---YGaD~~gSi~~~~~---------------------------------------------  148 (690)
T KOG0958|consen  117 FEDLEQKYWKNLTFDSPI---YGADINGSIYDEDL---------------------------------------------  148 (690)
T ss_pred             HHHHHHHHHhcccCCCCc---ccccCCCccCcccc---------------------------------------------
Confidence            78999999999997 899   99999999998721                                             


Q ss_pred             cCCCCCCCCCCCCCCCCCCCCCcccccccccccCCCCCccCcccccccCCCCCccccCCCCCCcc--cCCCCCCCCcccc
Q 000392          251 SCDKNDLETPTSSTPSSTLPFDENSRSSRRKSVTGSNDVEGTAGWKLSNSPWNLQVISRSPGSLT--RFMPDDIPGVTSP  328 (1581)
Q Consensus       251 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~pWNL~nLp~~~gSLL--~~l~~dI~GVntP  328 (1581)
                                                                       .-||+++|+.    +|  ...+..|.|||+|
T Consensus       149 -------------------------------------------------~~WNi~~L~t----ild~~~~~~~i~gvNt~  175 (690)
T KOG0958|consen  149 -------------------------------------------------DEWNIARLDT----ILDLEECGIIIEGVNTP  175 (690)
T ss_pred             -------------------------------------------------cccccccccc----hhchhhcceeecccCcc
Confidence                                                             0199998874    44  3667789999999


Q ss_pred             eeeeccccccccceecCCCceeeEEeeeCCCeEEEEecCccHHHHHHHHHhhhcCCChhHHHHHhhhcCcccccChhHHH
Q 000392          329 MVYIGMLFSWFAWHVEDHELHSMNFLHTGAPKTWYAIPGDYAFTFEEVIRNEAYGGDIDRLAALSLLGEKTTLISPEVIA  408 (1581)
Q Consensus       329 ~LYiGm~fStf~WH~ED~~L~SINY~H~GapK~WY~VP~~~a~kFE~lmr~~~~~~~~d~~~~~~~L~h~~tlisPe~L~  408 (1581)
                      |||.|||.++|+||+||.+||||||+|||+||+||+||++|.++||+|+.+. |+..  ...|.+||+|++++++|.+|+
T Consensus       176 yLyfGmwKttFaWHtEdmDLySINyLHFGaPK~WYaIP~eh~~rfekla~~~-fp~~--~~~C~aFLRHK~~LiSP~~Lk  252 (690)
T KOG0958|consen  176 YLYFGMWKTTFAWHTEDMDLYSINYLHFGAPKQWYAIPPEHGDRFEKLASEL-FPDS--SQGCPAFLRHKMTLISPSVLK  252 (690)
T ss_pred             ceeeeeeecccccccCCccceeeeeeecCCCcceeecCHHHHHHHHHHHHhh-CCcc--ccCCHHHHhhcccccCHHHHH
Confidence            9999999999999999999999999999999999999999999999999987 4333  236899999999999999999


Q ss_pred             hCCCceEeeeccCCcEEEEcCCceeeeeccccceeeeeccCChhHHHHHHHHHHH
Q 000392          409 ASGIPCCRLVQNPGEFVVTFPRAYHAGFSHGFNCGEAANFGTPQWLMVAKEAAVR  463 (1581)
Q Consensus       409 ~~GIpv~r~vQ~PGEfVVTfPgAYHsgfn~GfN~aEAVNFA~~~WL~~g~ea~e~  463 (1581)
                      ++|||+++++|++|||+||||++||+|||+||||+|++|||++.|+.||+.|..+
T Consensus       253 qnGIpfn~ivqeagEFmITFPygyHaGFN~GfN~aES~nFat~Rwi~YgK~a~~C  307 (690)
T KOG0958|consen  253 QNGIPFNRIVQEAGEFMITFPYGYHAGFNHGFNCAESTNFATPRWIDYGKQALLC  307 (690)
T ss_pred             HcCCCcceeeecCCcEEEecCcccccccccchhhhhhhcccchhhhhhccccccc
Confidence            9999999999999999999999999999999999999999999999999999543

>KOG1246 consensus DNA-binding protein jumonji/RBP2/SMCY, contains JmjC domain [General function prediction only] Back     alignment and domain information
>PF02373 JmjC: JmjC domain, hydroxylase; InterPro: IPR013129 Jumonji protein is required for neural tube formation in mice [] Back     alignment and domain information
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>smart00545 JmjN Small domain found in the jumonji family of transcription factors Back     alignment and domain information
>PF02375 JmjN: jmjN domain; InterPro: IPR003349 Jumonji protein is required for neural tube formation in mice [] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>smart00558 JmjC A domain family that is part of the cupin metalloenzyme superfamily Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>KOG1246 consensus DNA-binding protein jumonji/RBP2/SMCY, contains JmjC domain [General function prediction only] Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG2131 consensus Uncharacterized conserved protein, contains JmjC domain [Chromatin structure and dynamics; Signal transduction mechanisms] Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF13621 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XUM_A 2Y0I_A 1MZE_A 3KCY_A 1MZF_A 1YCI_A 2ILM_A 1H2L_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>KOG2130 consensus Phosphatidylserine-specific receptor PtdSerR, contains JmjC domain [Chromatin structure and dynamics; Signal transduction mechanisms] Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF04704 Zfx_Zfy_act: Zfx / Zfy transcription activation region; InterPro: IPR006794 Zfx and Zfy are transcription factors implicated in mammalian sex determination Back     alignment and domain information
>KOG1356 consensus Putative transcription factor 5qNCA, contains JmjC domain [Transcription] Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF08007 Cupin_4: Cupin superfamily protein; InterPro: IPR022777 This signature represents primarily the cupin fold found in JmjC transcription factors Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1581
3dxt_A354 Crystal Structure Of The Catalytic Core Domain Of J 6e-34
3dxu_A337 The Crystal Structure Of Core Jmjd2d Complexed With 8e-34
4hon_A330 Crystal Structure Of Human Jmjd2d/kdm4d In Complex 8e-34
4hoo_A330 Crystal Structure Of Human Jmjd2d/kdm4d Apoenzyme L 1e-33
2w2i_A358 Crystal Structure Of The Human 2-Oxoglutarate Oxyge 4e-33
2xml_A348 Crystal Structure Of Human Jmjd2c Catalytic Domain 2e-31
2oq6_A381 Crystal Structure Of Jmjd2a Complexed With Histone 4e-31
2p5b_A352 The Complex Structure Of Jmjd2a And Trimethylated H 6e-31
2gp3_A349 Crystal Structure Of The Catalytic Core Domain Of J 6e-31
2pxj_A347 The Complex Structure Of Jmjd2a And Monomethylated 7e-31
2wwj_A348 Structure Of Jmjd2a Complexed With Inhibitor 10a Le 8e-31
3opt_A373 Crystal Structure Of The Rph1 Catalytic Core With A 9e-28
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 9e-12
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 2e-11
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 9e-11
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 3e-10
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 1e-09
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 1e-09
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 3e-09
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 1e-08
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 4e-08
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 4e-08
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 1e-06
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 1e-06
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 2e-06
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 2e-06
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 2e-06
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 3e-06
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 3e-06
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 4e-06
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 4e-06
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 5e-06
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 2e-05
2j7j_A85 Invariance Of The Zinc Finger Module: A Comparison 3e-05
1un6_B87 The Crystal Structure Of A Zinc Finger - Rna Comple 4e-05
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 2e-04
2dlk_A79 Solution Structure Of The First And The Second Zf-C 2e-04
2epa_A72 Solution Structure Of The First And Second Zf-C2h2 2e-04
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 3e-04
>pdb|3DXT|A Chain A, Crystal Structure Of The Catalytic Core Domain Of Jmjd2d Length = 354 Back     alignment and structure 
Iteration: 1

 Score =  143 bits (361), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 94/160 (58%), Gaps = 3/160 (1%)
Query: 302 WNLQVISRSPGSLTRFMPDDIPGVTSPMVYIGMLFSWFAWHVEDHELHSMNFLHTGAPKT 361
           WNL  +      L +     I GV +P +Y GM  + FAWH ED +L+S+N+LH G PKT
Sbjct: 152 WNLGHLGTIQDLLEKECGVVIEGVNTPYLYFGMWKTTFAWHTEDMDLYSINYLHLGEPKT 211
Query: 362 WYAIPGDYAFTFEEVIRNEAYGGDIDRLAALSLLGEKTTLISPEVIAASGIPCCRLVQNP 421
           WY +P ++    E + R E + G      A   L  K  LISP V+  +GIP  R+ Q  
Sbjct: 212 WYVVPPEHGQRLERLAR-ELFPGSSRGCGAF--LRHKVALISPTVLKENGIPFNRITQEA 268
Query: 422 GEFVVTFPRAYHAGFSHGFNCGEAANFGTPQWLMVAKEAA 461
           GEF+VTFP  YHAGF+HGFNC EA NF TP+W+   K A+
Sbjct: 269 GEFMVTFPYGYHAGFNHGFNCAEAINFATPRWIDYGKMAS 308
>pdb|3DXU|A Chain A, The Crystal Structure Of Core Jmjd2d Complexed With Fe And N- Oxalylglycine Length = 337 Back     alignment and structure
>pdb|4HON|A Chain A, Crystal Structure Of Human Jmjd2d/kdm4d In Complex With An H3k9me3 Peptide And 2-oxoglutarate Length = 330 Back     alignment and structure
>pdb|4HOO|A Chain A, Crystal Structure Of Human Jmjd2d/kdm4d Apoenzyme Length = 330 Back     alignment and structure
>pdb|2W2I|A Chain A, Crystal Structure Of The Human 2-Oxoglutarate Oxygenase Loc390245 Length = 358 Back     alignment and structure
>pdb|2XML|A Chain A, Crystal Structure Of Human Jmjd2c Catalytic Domain Length = 348 Back     alignment and structure
>pdb|2OQ6|A Chain A, Crystal Structure Of Jmjd2a Complexed With Histone H3 Peptide Trimethylated At Lys9 Length = 381 Back     alignment and structure
>pdb|2P5B|A Chain A, The Complex Structure Of Jmjd2a And Trimethylated H3k36 Peptide Length = 352 Back     alignment and structure
>pdb|2GP3|A Chain A, Crystal Structure Of The Catalytic Core Domain Of Jmjd2a Length = 349 Back     alignment and structure
>pdb|2PXJ|A Chain A, The Complex Structure Of Jmjd2a And Monomethylated H3k36 Peptide Length = 347 Back     alignment and structure
>pdb|2WWJ|A Chain A, Structure Of Jmjd2a Complexed With Inhibitor 10a Length = 348 Back     alignment and structure
>pdb|3OPT|A Chain A, Crystal Structure Of The Rph1 Catalytic Core With A-Ketoglutarate Length = 373 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2J7J|A Chain A, Invariance Of The Zinc Finger Module: A Comparison Of The Free Structure With Those In Nucleic-Acid Complexes Length = 85 Back     alignment and structure
>pdb|1UN6|B Chain B, The Crystal Structure Of A Zinc Finger - Rna Complex Reveals Two Modes Of Molecular Recognition Length = 87 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2DLK|A Chain A, Solution Structure Of The First And The Second Zf-C2h2 Domains Of Zinc Finger Protein 692 Length = 79 Back     alignment and structure
>pdb|2EPA|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domains From Human Krueppel-Like Factor 10 Length = 72 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1581
2xxz_A332 Lysine-specific demethylase 6B; oxidoreductase, hi 2e-54
3avr_A531 Lysine-specific demethylase 6A; cupin superfamily, 2e-54
3dxt_A354 JMJC domain-containing histone demethylation PROT; 5e-52
3dxt_A354 JMJC domain-containing histone demethylation PROT; 5e-06
4ask_A510 Lysine-specific demethylase 6B; oxidoreductase, KD 2e-51
2ox0_A381 JMJC domain-containing histone demethylation PROT; 1e-50
2ox0_A381 JMJC domain-containing histone demethylation PROT; 4e-07
3opt_A373 DNA damage-responsive transcriptional repressor R; 2e-46
3opt_A373 DNA damage-responsive transcriptional repressor R; 4e-16
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-26
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-23
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 7e-21
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-24
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-18
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-10
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-24
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-24
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-22
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-12
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-24
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-12
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-04
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-22
1tf6_A190 Protein (transcription factor IIIA); complex (tran 6e-22
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-21
1tf6_A 190 Protein (transcription factor IIIA); complex (tran 2e-17
1tf6_A 190 Protein (transcription factor IIIA); complex (tran 1e-07
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-22
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 6e-16
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-13
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 8e-08
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-21
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 7e-20
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 5e-13
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 4e-04
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-19
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-12
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-11
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-18
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-16
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-04
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-18
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-13
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-13
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-18
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 7e-18
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-16
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-10
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-17
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-08
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-08
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-08
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
2epa_A72 Krueppel-like factor 10; transforming growth facto 1e-16
2epa_A72 Krueppel-like factor 10; transforming growth facto 4e-05
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-16
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-14
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-05
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-15
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 9e-15
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 6e-11
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-07
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-15
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 7e-10
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 5e-08
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-14
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-11
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-13
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 8e-13
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-13
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-12
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-13
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-10
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 5e-13
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-09
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-07
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 6e-13
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 3e-04
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 5e-12
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 5e-06
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-11
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-09
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-11
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 5e-11
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 1e-04
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-11
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-08
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 5e-07
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-11
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-04
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-10
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-10
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-06
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-04
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-10
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-07
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-04
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-10
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-04
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-10
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-04
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-10
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-07
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-10
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-07
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-04
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-10
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-07
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-04
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-07
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-04
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-09
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 9e-07
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-09
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-09
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-06
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-04
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-09
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-06
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 1e-09
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 4e-06
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 7e-04
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-09
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-06
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-04
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-09
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-07
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-04
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-04
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 2e-09
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 5e-07
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 2e-04
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-07
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-09
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-04
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-09
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-09
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-06
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-09
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-09
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-04
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 3e-09
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 4e-06
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 5e-04
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-09
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-06
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-09
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-06
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-04
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-07
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-09
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-09
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-06
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-09
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-09
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-09
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-06
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-09
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-07
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-09
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-07
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-09
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-07
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-09
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-06
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-09
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-09
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-06
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-04
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-09
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 7e-09
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-06
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-04
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-09
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-06
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 8e-09
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-04
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-09
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-04
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-09
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 9e-09
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-07
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-09
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-06
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-08
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-06
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-04
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-06
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-04
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-04
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-05
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-08
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-04
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-06
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-04
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-08
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-06
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-08
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-08
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-07
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-05
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 3e-08
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 6e-06
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 1e-04
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-06
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-08
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-05
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-08
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-06
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-08
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-08
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-04
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 5e-08
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 8e-06
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 6e-04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 5e-08
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 7e-05
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-04
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 8e-08
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 9e-08
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 9e-05
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-04
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-06
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-06
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 8e-07
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-07
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 8e-06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-07
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-06
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 4e-07
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 7e-07
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-07
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 7e-06
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 7e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-05
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-07
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-06
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 2e-06
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-04
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 2e-04
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-06
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-05
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-04
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-05
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-05
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 1e-04
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 8e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 2e-04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-04
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 2e-04
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 7e-04
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 5e-04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 7e-04
>2xxz_A Lysine-specific demethylase 6B; oxidoreductase, histone demethylation, oxygenase, chromatin modification; HET: 8XQ; 1.80A {Homo sapiens} Length = 332 Back     alignment and structure
 Score =  193 bits (490), Expect = 2e-54
 Identities = 45/235 (19%), Positives = 84/235 (35%), Gaps = 17/235 (7%)

Query: 238 ESARNCHNDQITHSCDKNDLETPTSSTPSSTLPFDENSRSSRRKSVTGSNDVEGTAGW-- 295
            S +    ++     ++++    T+ TP S+ P  +N    +  +    +D +       
Sbjct: 113 SSFQESLQEEKESEDEESEEPDSTTGTPPSSAPDPKNHHIIKFGTNIDLSDAKRWKPQLQ 172

Query: 296 KLSNSPWNLQVISRSPGSLTRFMPDDIPGVTSPMVYIGMLFSWFAWHVEDHELHSMNFLH 355
           +L   P  ++V   S G++   +   I G+ +  +Y+ +  S    H E++   S+N   
Sbjct: 173 ELLKLPAFMRV--TSTGNMLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINI 230

Query: 356 TGAPKTWYAIPGDYAFTFEEVIRNEAYGGDIDRLAALSLLGEKTTLISPEVIAASGIPCC 415
                 W+A+   Y  T         +G D             +     + + AS IP  
Sbjct: 231 GPGDCEWFAVHEHYWETISAFCDR--HGVDYL---------TGSWWPILDDLYASNIPVY 279

Query: 416 RLVQNPGEFVVTFPRAYHAGFSHGFNCGEAANFGTPQWLMVAKEAAVRRAAMNYL 470
           R VQ PG+ V       H   + G+    A N G           A+ R   N +
Sbjct: 280 RFVQRPGDLVWINAGTVHWVQATGWCNNIAWNVGPLTAYQYQ--LALERYEWNEV 332
>3avr_A Lysine-specific demethylase 6A; cupin superfamily, TRI/dimethyllysine demethylase, oxidoredu structural protein complex; HET: M3L OGA EDO; 1.80A {Homo sapiens} PDB: 3avs_A* Length = 531 Back     alignment and structure
>3dxt_A JMJC domain-containing histone demethylation PROT; JMJD2D, histone demethylase, H3K9, jumonji domain-CONT protein 2D, oxidoreductase; 1.80A {Homo sapiens} PDB: 3dxu_A* 2w2i_A* Length = 354 Back     alignment and structure
>3dxt_A JMJC domain-containing histone demethylation PROT; JMJD2D, histone demethylase, H3K9, jumonji domain-CONT protein 2D, oxidoreductase; 1.80A {Homo sapiens} PDB: 3dxu_A* 2w2i_A* Length = 354 Back     alignment and structure
>4ask_A Lysine-specific demethylase 6B; oxidoreductase, KDM6B, GSK-J1, inhibitor, lysine specific HI demethylase; HET: K0I; 1.86A {Homo sapiens} PDB: 2xue_A* Length = 510 Back     alignment and structure
>2ox0_A JMJC domain-containing histone demethylation PROT; double-stranded beta helix, demethylase, oxygenase, SGC, STR genomics, structural genomics consortium, oxidoreductase; HET: MLY ALY OGA; 1.95A {Homo sapiens} PDB: 2oq7_A* 2os2_A* 2ot7_A* 2oq6_A* 2vd7_A* 2ybk_A* 2ybp_A* 2ybs_A* 3njy_A* 3pdq_A* 3u4s_A* 2p5b_A* 2q8c_A* 2q8d_A* 2q8e_A* 2gp5_A* 2gp3_A* 2wwj_A* 2pxj_A* 2xml_A* Length = 381 Back     alignment and structure
>2ox0_A JMJC domain-containing histone demethylation PROT; double-stranded beta helix, demethylase, oxygenase, SGC, STR genomics, structural genomics consortium, oxidoreductase; HET: MLY ALY OGA; 1.95A {Homo sapiens} PDB: 2oq7_A* 2os2_A* 2ot7_A* 2oq6_A* 2vd7_A* 2ybk_A* 2ybp_A* 2ybs_A* 3njy_A* 3pdq_A* 3u4s_A* 2p5b_A* 2q8c_A* 2q8d_A* 2q8e_A* 2gp5_A* 2gp3_A* 2wwj_A* 2pxj_A* 2xml_A* Length = 381 Back     alignment and structure
>3opt_A DNA damage-responsive transcriptional repressor R; RPH1, histone demethylase, catalytic core, oxidoreductase; HET: DNA AKG; 2.20A {Saccharomyces cerevisiae} PDB: 3opw_A* Length = 373 Back     alignment and structure
>3opt_A DNA damage-responsive transcriptional repressor R; RPH1, histone demethylase, catalytic core, oxidoreductase; HET: DNA AKG; 2.20A {Saccharomyces cerevisiae} PDB: 3opw_A* Length = 373 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1581
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 4e-11
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 7e-09
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-07
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 1e-07
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 3e-06
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.001
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 3e-07
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 0.001
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-07
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 6e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 8e-07
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 8e-07
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.003
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-06
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-04
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 3e-06
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 7e-05
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 3e-04
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 1e-05
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 9e-05
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 3e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 2e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 5e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 3e-04
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-05
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 4e-05
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 1e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 1e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 2e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 2e-04
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 2e-04
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 4e-04
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 5e-04
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 3e-04
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 0.001
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 0.002
d2glia233 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo 0.002
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 0.002
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 692, ZNF692
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 57.0 bits (138), Expect = 4e-11
 Identities = 12/34 (35%), Positives = 18/34 (52%)

Query: 1520 KCPWKGCSMSFKWAWARTEHIRVHTGERPYKCKF 1553
             CP   C  SF +     EH+++H+  R Y C+F
Sbjct: 3    SCPEPACGKSFNFKKHLKEHMKLHSDTRDYICEF 36
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1581
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 98.86
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 98.53
d1vrba1319 Putative asparaginyl hydroxylase YxbC {Bacillus su 97.94
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.89
d2cota238 Zinc finger and SCAN domain-containing protein 16, 97.88
d2cota238 Zinc finger and SCAN domain-containing protein 16, 97.76
d1h2ka_335 Hypoxia-inducible factor HIF ihhibitor (FIH1) {Hum 97.75
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 97.7
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 97.69
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 97.69
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 97.61
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 97.59
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 97.57
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 97.57
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 97.54
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 97.51
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 97.41
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 97.41
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 97.2
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 97.19
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.11
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.97
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.96
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 96.96
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.95
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 96.93
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 96.88
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.86
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.86
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 96.84
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 96.82
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 96.74
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 96.64
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.58
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 96.56
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.51
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 96.39
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 96.32
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 96.21
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 95.9
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 95.88
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 95.81
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.4
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 93.65
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 93.19
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 92.72
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 92.49
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 91.96
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 91.78
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 91.75
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.46
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.43
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 90.35
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 89.45
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 88.03
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 87.64
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 87.08
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 86.86
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 85.66
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 85.3
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 85.28
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 84.53
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 83.72
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 83.06
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 82.5
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 82.31
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 81.94
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 81.35
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 80.4
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 80.22
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 80.15
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.86  E-value=1e-09  Score=81.14  Aligned_cols=53  Identities=30%  Similarity=0.723  Sum_probs=50.2

Q ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             9863479988666446867899897630799751179888898436823699998781
Q 000392         1516 ERPLKCPWKGCSMSFKWAWARTEHIRVHTGERPYKCKFEGCGLSFRFVSDISRHRRKT 1573 (1581)
Q Consensus      1516 eKpfkC~~~iCGKsFs~kssLk~HlrtHTGEKPf~C~v~~CGKsFs~kSsLkkH~rkH 1573 (1581)
                      +|||.|  . ||+.|..+..|..|+++|+|++||.|.+  ||+.|...+.|..|++.|
T Consensus         1 EK~y~C--~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~--C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPC--Q-CGKSFTHKSQRDRHMSMHLGLRPYGCGV--CGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEEC--T-TSCEESSHHHHHHHHHHHSCCCSEECTT--TSCEESSSHHHHHHHTTT
T ss_pred             CCCCCC--C-CCCEECCHHHHHHHHHCCCCCCCCCCCC--CCCEECCHHHHHHHHHCC
T ss_conf             929779--9-9981797878699863301465870797--598925788999997019
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2ka_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure