Citrus Sinensis ID: 000454


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------1450------1460------1470------1480------1490-
MALRKYIPSADAPSGTMKPLSFSSKVHENAQLAGSDTSQPAELDVDVDLREVYFLIMHFLSTGPCHRTYGQFWNELLEHQLLPRRYHAWYSRSGLPSGDENDDGMSFPLSYNKLVERYPHIEKDHLVKLLKQLIINTSSPSRAMIGGDAPNAADVPTLLGRGSFSLLSYDRDKGQNEIDHPPAHMRWPHMYADQVRGLGLREIGGGFTRHHRAPSIRAACYAIAKPSTMVQKMQNIKRVRGHRNAVYCAIFDRSGRYVITGSDDRLVKIWSMETAYCLASCRGHEGDITDLAVSSNNALVASASNDCIIRVWRLPDGLPISVLRGHTAAVTAIAFSPRPGSVYQLLSSSDDGTCRIWDARYSQFSPRIYIPRPSDAVAGRNMAPSSSAGPQSHQIFCCAFNANGTVFVTGSSDTLARVWNACKPNTDDSDQPNHEIDVLSGHENDVNYVQFSGCAVASRFSLADSSKEDSTPKFKNSWFCHDNIVTCSRDGSAIIWIPRSRRSHPKAARWTQAYHLKVPPPPMPPQPPRGGPRQRILPTPRGVNMIVWSLDNRFVLAAIMDCRICVWNAADGSLVHSLTGHTESTYVLDVHPFNPRIAMSAGYDGKTIVWDIWEGIPIRIYEISRFRLVDGKFSPDGASIILSDDVGQLYILNTGQGESQKDAKYDQFFLGDYRPLVQDTYGNVLDQETQLAPHRRNLQDPLCDSAMIPYPEPYQTMYQQRRLGALGIEWRPSSLKLAVGPDFSLDQGYQLQPLADLDVMIDPLPEFIDVMDWEPENEVQSDDNDSEYNVAEEYSTEEKGSLSSTSSGDSECSAEDSEDGENPMDGLRRSKRKKQKAEVEIMTSSGRRVKRRILDESEGNAAFGNKRTRKSGNRQKSSRRKSSTSKSLRPQRAAARNARSFFSKITGASTDGEDVDGSEGELSESESDLQDSYIESEESGRSLLNEQRKHSKGKGISLDDSEDVTKLDTPESHVNAGIRRLVLKLPVRDSNKHELQERTSDKCNQLVSVIGTSSEAHQEATEGNGNRVSYVGNNCSSVDANCGLMERRGRGQFDKLEDYLNLSNGYKDGKIRWGGVRARSSKRLKIGEMMPLDANNGSGIHLDDDKEKESEVNGHVKPEKDGIDISCGEEITNCGDNTDEVPLKNVKNLSGENNDVYSGDASCKEQQSGFSELNYYDESKCVNTTDEDTTPYPNHLQNGTIQPSELKEILTPVSTKLRIRSKRILRDADVENQNNGCDALHGSSLDIKPNSLPEVLESDGTNRTSSDRGADGSQRLNAQIDSTSEHDPLGSHSHSHDPLGSHSHSHSRKMFNVVYRRSKTNRDRTNSEGDGGGVGESTLNANNNNFHESATDGSRRTRSMGLKTTTCDPDNVSSNLRLEQHNQPEDMYSGHNRSTSRCQLPHEEWGSSSKMTVGLRSTRNRRTSYLFCDSSPIDRRKTHQSLRKGSWLMLSTHEEGSRYIPQLGDEVVYLRQVRWISIINSLFFSLVFVLI
cccccccccccccccccccccccHHHHcccccccccccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHccccccccccccccccccccHHHHHHHccccccccHHHHHHHHHHccccccccEEEEEccccccccEEccccccEEEEEEccccEEEccccccccccccEEcccccccEEEEEcccEEEEEEcccccEEEEEcccccEEEcccEEEEEEccccccEEEEEEcccccEEEEEEccccEEEEEccccccccccccccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEcccccccEEEEEEccccccccEEEEEEccccEEEEEccccccccEEEcccccccccccccccccccccccccEEEEEEcccccEEEEEcccccEEEEEcccccccccccccccEEEcccccccEEEEEEccccccccEEcccccccccccccccccccccEEEEEEccccEEEEEcccccccccccccccEEEEEEcccccccccccccccEEEccccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEcccccccEEEEEEcccccEEEEEEEccccEEEEEccccEEEEEEccccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEcccccEEEEccccccccccccccccccccccccccccccccccccccccccccEEEcccEEEcccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccccccEEEEEEEEHHHHHHHHHHHEEEEEEc
ccHHHcccccccccccccccccccccccccccccccccccccccccHcHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccccccccccccccccHHHHHHHcccccHHHHHHHHHHHHHccccccccEEEccccccccEEEEEccccEEEEEEccccEEEEEcccccEEEcccccccEEEcccccccEEEEEEcccccEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEccccccEEEEEEccccccEEEEEEcccccEEEEEEcccccEEEEccccccccccccccccEEEEEccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEcccccccEEEEEEcccccEEEEEEcccccEEEEccccccEEEEEEEEEEEcccccEEEEcccccEEEEEEcccccEEEEcccccEEEEEcccccEEEEccccccEEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEccEEEEcccccEEEEcccccEEEEccccccccccccccEEEEEcccccccEEEEEccccccEEEEEEcccccEEEEcccccccccEEccccccHHHHHccccHHHHHHcccccccEEEccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccEEEEccccEEEEEcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccHccccccHHHHHHHHHccccccccccEEcHccHcccccccccccccccccEEEEEEEEcccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccEcccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEcccccccccccccccccEEccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccEEEEcccccccccccccccccccccccccccccccEEccEccccccccccccccccccccccccHHHHHHHHHHHcccccccEccccccHEHEHHHHHHHHHHHHHHHHHHHHHc
malrkyipsadapsgtmkplsfsskvhenaqlagsdtsqpaeldvdvDLREVYFLIMHFlstgpchrtyGQFWNELLEhqllprryhawysrsglpsgdenddgmsfplsynklveryphiEKDHLVKLLKQLIIntsspsramiggdapnaadvptllgrgsfsllsydrdkgqneidhppahmrwphmyadqVRGLglreigggftrhhrapsiRAACYAIAKPSTMVQKMQNIKRVRGHRNAVYCAIfdrsgryvitgsddrLVKIWSMETAYCLAScrghegditdLAVSSNNALVASASNDCIIrvwrlpdglpisvlrGHTAAVtaiafsprpgsvyqllsssddgtcriwdarysqfspriyiprpsdavagrnmapsssagpqshqIFCCafnangtvfvtGSSDTLARVWNackpntddsdqpnheidvlsghendvnyvqfsgCAVASrfsladsskedstpkfknswfchdnivtcsrdgsaiiwiprsrrshpkaarwtqayhlkvppppmppqpprggprqrilptprgvNMIVWSLDNRFVLAAIMDCRICvwnaadgslvhsltghtestyvldvhpfnpriamsagydgktiVWDIWEGIPIRIYEisrfrlvdgkfspdgasiilsddvgqlyilntgqgesqkdakydqfflgdyrplvqdtygnvldqetqlaphrrnlqdplcdsamipypepyqTMYQQRRLGAlgiewrpsslklavgpdfsldqgyqlqpladldvmidplpefidvmdwepenevqsddndseynvaeeysteekgslsstssgdsecsaedsedgenpmdglrrskrkKQKAEVEIMTSSGRRVKRRIldesegnaafgnkrtrksgnrqkssrrksstskslrpQRAAARNARSFFSkitgastdgedvdgsegelsesesdlqdsyiesEESGRSLLNEQRkhskgkgislddsedvtkldtpeshvnAGIRRLVLklpvrdsnkhelqertsdkCNQLVSVIGtsseahqeategngnrvsyvgnncssvdancglmerrgrgqfdklEDYLNlsngykdgkirwggvrarsskrlkigemmpldanngsgihldddkekesevnghvkpekdgidiscgeeitncgdntdevplknvknlsgenndvysgdasckeqqsgfselnyydeskcvnttdedttpypnhlqngtiqpselkeiltpvstklrirskrilrdadvenqnngcdalhgssldikpnslpevlesdgtnrtssdrgadgsqrlnaqidstsehdplgshshshdplgshshshsRKMFNVVYRRsktnrdrtnsegdgggvgestlnannnnfhesatdgsrrtrsmglktttcdpdnvssnlrleqhnqpedmysghnrstsrcqlpheewgssskmtvglrstrnrrtsylfcdsspidrrkthqslrkGSWLMLstheegsryipqlgdEVVYLRQVRWISIINSLFFSLVFVLI
malrkyipsadapsgtMKPLSFSSKVHENAqlagsdtsqpaeLDVDVDLREVYFLIMHFLSTGPCHRTYGQFWNELLEHQLLPRRYHAWYSRSGLpsgdenddgMSFPLSYNKLVERYPHIEKDHLVKLLKQLIINTSSPSRAMIGGDAPNAADVPTLLGRGSFSLLSYDRDKGQNEIDHPPAHMRWPHMYADQVRGLGLREIGGGFTRHHRAPSIRAACYAIAKPSTMVQKMQNIKRVRGHRNAVYcaifdrsgryvitgsdDRLVKIWSMETAYCLASCRGHEGDITDLAVSSNNALVASASNDCIIRVWRLPDGLPISVLRGHTAAVTAIAFSPRPGSVYQLLSSSDDGTCRIWDArysqfspriyiPRPSDAVAGRNMAPSSSAGPQSHQIFCCAFNANGTVFVTGSSDTLARVWNACKpntddsdqpNHEIDVLSGHENDVNYVQFSGCAVASRFSLADSSKEdstpkfknswfchDNIVTCSRDGSAIIWIPRSRRSHPKAARWTQAYHLKVPPPPMPPQPPRGGPRQRILPTPRGVNMIVWSLDNRFVLAAIMDCRICVWNAADGSLVHSLTGHTESTYVLDVHPFNPRIAMSAGYDGKTIVWDIWEGIPIRIYEISRFRLVDGKFSPDGASIILSDDVGQLYILNtgqgesqkdAKYDQFFLGDYRPLVQDTYGNVLDQETQLAPHRRNLQDPLCDSAMIPYPEPYQTMYQQRRLGALGIEWRPSSLKLAVGPDFSLDQGYQLQPLADLDVMIDPLPEFIDVMDWEPEnevqsddndseyNVAEEysteekgslsstssgdsecsaedsedgenpmdglrrskrkkqkaeveimtssgrrvkrrildesegnaafgnkrtrksgnrqkssrrksstskslrpqraaarnarsffskitgastdgedvdgsegelsesesdlqdsYIESEESGRSLLneqrkhskgkgislddsedvtkldtpeshvnagirrlvlklpvRDSNKhelqertsdkcnqLVSVIGTSseahqeategngnrvsyVGNNCSSVDANCGLMERRGRGQFDKLEDYLNLsngykdgkirwggvrarsskrlkigemmpldanngsgiHLDDDKEKesevnghvkpekdgidisCGEEITNCGDNTDEVPLKNVKNLSGENNDVYSGDASCKEQQSGFSELNYYDESKCVNTTDEDTTPYPNHlqngtiqpselkeiltpvstklrirskrilrdadvenqnngcdalhgssldikpnSLPEVLEsdgtnrtssdrgadgsqRLNAQIDSTSEHDPLGSHSHSHDPLGSHSHSHSRKMFNVVYRRsktnrdrtnsegdgggvgestlnannnnfhesatdgsrrtrSMGLktttcdpdnvssnLRLEQHNQPEDMYSGHNRSTSRCQlpheewgssskmtvglrstrnrrtsylfcdsspidrrkthqslrkgsWLMLSTHEEGSRYIPQLGDEVVYLRQVRWISIINSLFFSLVFVLI
MALRKYIPSADAPSGTMKPLSFSSKVHENAQLAGSDTSQPAELDVDVDLREVYFLIMHFLSTGPCHRTYGQFWNELLEHQLLPRRYHAWYSRSGLPSGDENDDGMSFPLSYNKLVERYPHIEKDHLVKLLKQLIINTSSPSRAMIGGDAPNAADVPTLLGRGSFSLLSYDRDKGQNEIDHPPAHMRWPHMYADQVRGLGLREIGGGFTRHHRAPSIRAACYAIAKPSTMVQKMQNIKRVRGHRNAVYCAIFDRSGRYVITGSDDRLVKIWSMETAYCLASCRGHEGDITDlavssnnalvasasnDCIIRVWRLPDGLPISVLRGHTAAVTAIAFSPRPGSVYQLLSSSDDGTCRIWDARYSQFSPRIYIPRPSDAVAGRNMAPSSSAGPQSHQIFCCAFNANGTVFVTGSSDTLARVWNACKPNTDDSDQPNHEIDVLSGHENDVNYVQFSGCAVASRFSLADSSKEDSTPKFKNSWFCHDNIVTCSRDGSAIIWIPRSRRSHPKAARWTQAYHLKVppppmppqpprggprqrILPTPRGVNMIVWSLDNRFVLAAIMDCRICVWNAADGSLVHSLTGHTESTYVLDVHPFNPRIAMSAGYDGKTIVWDIWEGIPIRIYEISRFRLVDGKFSPDGASIILSDDVGQLYILNTGQGESQKDAKYDQFFLGDYRPLVQDTYGNVLDQETQLAPHRRNLQDPLCDSAMIPYPEPYQTMYQQRRLGALGIEWRPSSLKLAVGPDFSLDQGYQLQPLADLDVMIDPLPEFIDVMDWEPENEVQSDDNDSEYNVAEEYsteekgslsstssgdsecsaeDSEDGENPMDGLRRSKRKKQKAEVEIMTSSGRRVKRRILDESEGNAAFGNKRTrksgnrqkssrrksstsksLRPQraaarnarSFFSKITGASTdgedvdgsegelsesesdlqdsYIESEESGRSLLNEQRKHSKGKGISLDDSEDVTKLDTPESHVNAGIRRLVLKLPVRDSNKHELQERTSDKCNQLVSVIGTSSEAHQEATEGNGNRVSYVGNNCSSVDANCGLMERRGRGQFDKLEDYLNLSNGYKDGKIRWGGVRARSSKRLKIGEMMPLDANNGSGIHLDDDKEKESEVNGHVKPEKDGIDISCGEEITNCGDNTDEVPLKNVKNLSGENNDVYSGDASCKEQQSGFSELNYYDESKCVNTTDEDTTPYPNHLQNGTIQPSELKEILTPVSTKLRIRSKRILRDADVENQNNGCDALHGSSLDIKPNSLPEVLESDGTNRTSSDRGADGSQRLNAQIDSTSEHDPLGSHSHSHDPLGSHSHSHSRKMFNVVYRRSKTNRDRTNSEGDGGGVGESTLNANNNNFHESATDGSRRTRSMGLKTTTCDPDNVSSNLRLEQHNQPEDMYSGHNRSTSRCQLPHEEWGSSSKMTVGLRSTRNRRTSYLFCDSSPIDRRKTHQSLRKGSWLMLSTHEEGSRYIPQLGDEVVYLRQVRWISIINSLFFSLVFVLI
******************************************LDVDVDLREVYFLIMHFLSTGPCHRTYGQFWNELLEHQLLPRRYHAWYSR**************FPLSYNKLVERYPHIEKDHLVKLLKQLIINT******************PTLLGRGSFSLLSY**************HMRWPHMYADQVRGLGLREIGGGFTRHHRAPSIRAACYAIAKPSTMVQKMQNIKRVRGHRNAVYCAIFDRSGRYVITGSDDRLVKIWSMETAYCLASCRGHEGDITDLAVSSNNALVASASNDCIIRVWRLPDGLPISVLRGHTAAVTAIAFSPRPGSVYQLLSSSDDGTCRIWDARYSQFSPRIYIP**********************QIFCCAFNANGTVFVTGSSDTLARVWNACK*************DVLSGHENDVNYVQFSGCAVASRFS************FKNSWFCHDNIVTCSRDGSAIIWIPR*********RWTQAY*************************PRGVNMIVWSLDNRFVLAAIMDCRICVWNAADGSLVHSLTGHTESTYVLDVHPFNPRIAMSAGYDGKTIVWDIWEGIPIRIYEISRFRLVDGKFSPDGASIILSDDVGQLYILNTGQGESQKDAKYDQFFLGDYRPLVQDTYGNVLDQETQLAPHRRNLQDPLCDSAMIPYPEPYQTMYQQRRLGALGIEWRPSSLKLAVGPDFSLDQGYQLQPLADLDVMIDPLPEFIDVMDW***********************************************************************************************************************************************************************************************************GIRRLVLKL******************************************VSYVGNNCSSVDANCGLMERRGRGQFDKLEDYLNLSNGYKDGKIRWGGVR*************************************************C***I*******************************************YY********************************************************************************************************************************************************************************************************************************************************YLFC****************GSWLMLSTHEEGSRYIPQLGDEVVYLRQVRWISIINSLFFSLVFVL*
**********************************************VDLREVYFLIMHFLSTGPCHRTYGQFWNELLEHQLLPRRYHAWYSRSGLPSGDENDDGMSFPLSYNKLVERYPHIEKDHLVKLLKQLIINTSSPSRAMIGGDAPNAADVPTLLGRGSFSLLSYDRDKGQNEIDHPPAHMRWPHMYADQVRGLGLREIGGGFTRHHRAPSIRAACYAIAKPSTMVQKMQNIKRVRGHRNAVYCAIFDRSGRYVITGSDDRLVKIWSMETAYCLASCRGHEGDITDLAVSSNNALVASASNDCIIRVWRLPDGLPISVLRGHTAAVTAIAFSPRPGSVYQLLSSSDDGTCRIWDARYSQFSPRIYIPRPSDAVAGRNMAPSSSAGPQSHQIFCCAFNANGTVFVTGSSDTLARVWNACKPNTDDSDQPNHEIDVLSGHENDVNYVQFSGCAVASRFSLADSSKEDSTPKFKNSWFCHDNIVTCSRDGSAIIWIPRSRRSHPKAARWTQAYHLKVPPPPMPPQPPRGGPRQRILPTPRGVNMIVWSLDNRFVLAAIMDCRICVWNAADGSLVHSLTGHTESTYVLDVHPFNPRIAMSAGYDGKTIVWDIWEGIPIRIYEISRFRLVDGKFSPDGASIILSDDVGQLYILNTGQGESQKDAKYDQFFLGDYRPLVQDTYGNVLDQETQLAPHRRNLQDPLCDSAMIPYPEPYQTMYQQRRLGALGIEWRPSSLKLAVGPDFSLDQGYQLQPLADLDVMIDPLPEFIDVMDWE***********************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************SWLMLSTHEEGSRYIPQLGDEVVYLRQVRWISIINSLFFSLVFVLI
MALRKYIPSADAPSGTMKPLSFSSKVHENAQLAGSDTSQPAELDVDVDLREVYFLIMHFLSTGPCHRTYGQFWNELLEHQLLPRRYHAWYSRSGLPSGDENDDGMSFPLSYNKLVERYPHIEKDHLVKLLKQLIINTSSPSRAMIGGDAPNAADVPTLLGRGSFSLLSYDRDKGQNEIDHPPAHMRWPHMYADQVRGLGLREIGGGFTRHHRAPSIRAACYAIAKPSTMVQKMQNIKRVRGHRNAVYCAIFDRSGRYVITGSDDRLVKIWSMETAYCLASCRGHEGDITDLAVSSNNALVASASNDCIIRVWRLPDGLPISVLRGHTAAVTAIAFSPRPGSVYQLLSSSDDGTCRIWDARYSQFSPRIYIPRPSDAV**************SHQIFCCAFNANGTVFVTGSSDTLARVWNACKPNTDDSDQPNHEIDVLSGHENDVNYVQFSGCAVASRF************KFKNSWFCHDNIVTCSRDGSAIIWIPRSRRSHPKAARWTQAYHLKVPPPPM*********RQRILPTPRGVNMIVWSLDNRFVLAAIMDCRICVWNAADGSLVHSLTGHTESTYVLDVHPFNPRIAMSAGYDGKTIVWDIWEGIPIRIYEISRFRLVDGKFSPDGASIILSDDVGQLYILNTGQGESQKDAKYDQFFLGDYRPLVQDTYGNVLDQETQLAPHRRNLQDPLCDSAMIPYPEPYQTMYQQRRLGALGIEWRPSSLKLAVGPDFSLDQGYQLQPLADLDVMIDPLPEFIDVMDWEPENEVQSDDNDSEYN********************************************************GRRVKRRILDESEGNAAF**********************************ARSFFSKITGAS********************************SLLN************LDDSEDVTKLDTPESHVNAGIRRLVLKLPVRDSNKHELQERTSDKCNQLVSVIGT***********NGNRVSYVGNNCSSVDANCGLMERRGRGQFDKLEDYLNLSNGYKDGKIRWGGVRARSSKRLKIGEMMPLDANNGSGIHLDD**********HVKPEKDGIDISCGEEITNCGDNTDEVPLKNVKNLSGENNDVYSGDASCKEQQSGFSELNYYDESKCVNTTDEDTTPYPNHLQNGTIQPSELKEILTPVSTKLRIRSKRILRDADVENQNNGCDALHGSSLDIKPNSLPEVLE***************SQRLNAQIDST************************RKMFNVVYRRSKT***********GGVGESTLNANNNNFHES*********SMGLKTTTCDPDNVSSNLRLEQHNQPEDMYSGHNRSTSRCQLPHEEWGSSSKMTVGLRSTRNRRTSYLFCDSSPIDRRKTHQSLRKGSWLMLSTHEEGSRYIPQLGDEVVYLRQVRWISIINSLFFSLVFVLI
***************************************PAELDVDVDLREVYFLIMHFLSTGPCHRTYGQFWNELLEHQLLPRRYHAWYSRSGLPSGDENDDGMSFPLSYNKLVERYPHIEKDHLVKLLKQLIINTSSPSRAMIGGDAPNAADVPTLLGRGSFSLLSYDRDKGQNEIDHPPAHMRWPHMYADQVRGLGLREIGGGFTRHHRAPSIRAACYAIAKPSTMVQKMQNIKRVRGHRNAVYCAIFDRSGRYVITGSDDRLVKIWSMETAYCLASCRGHEGDITDLAVSSNNALVASASNDCIIRVWRLPDGLPISVLRGHTAAVTAIAFSPRPGSVYQLLSSSDDGTCRIWDARYSQFSPRIYIPRPSDAVAGRNMAPSSSAGPQSHQIFCCAFNANGTVFVTGSSDTLARVWNACKPNTDDSDQPNHEIDVLSGHENDVNYVQFSGCAVASRFSLADSSKEDSTPKFKNSWFCHDNIVTCSRDGSAIIWIPRSRRSHPKAARWTQAYHLKVPPPPMPPQPPRGGPRQRILPTPRGVNMIVWSLDNRFVLAAIMDCRICVWNAADGSLVHSLTGHTESTYVLDVHPFNPRIAMSAGYDGKTIVWDIWEGIPIRIYEISRFRLVDGKFSPDGASIILSDDVGQLYILNTGQGESQKDAKYDQFFLGDYRPLVQDTYGNVLDQETQLAPHRRNLQDPLCDSAMIPYPEPYQTMYQQRRLGALGIEWRPSSLKLAVGPDFSLDQGYQLQPLADLDVMIDPLPEFIDVMDWEPENEVQSDDNDSEYN*************************************************VEIMTSSGRRVKRRILD**************************************************************************************************KGIS*DDSEDVTKLDTPESHVNAGIRRLVLKLPVRDSN******************************************************************DYLNLSNGYKDGKIRWGGVRARSSKRLK*************************************IDISCGEEITNCGDNTDEVPLKNVKNLSGENNDVYSG**********************************************LKEILTPVSTKLRIRSKRILR***V*****GCDALHGSSLDIKPNSLPEVLES**************************************************KMFNVVYRRSK***************************************SMGLKTTTCDPDNVSSNLRLEQH*****************************************TSYLFCDSSPIDRRKTHQSLRKGSWLMLSTHEEGSRYIPQLGDEVVYLRQVRWISIINSLFFSLVFVLI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHi
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALRKYIPSADAPSGTMKPLSFSSKVHENAQLAGSDTSQPAELDVDVDLREVYFLIMHFLSTGPCHRTYGQFWNELLEHQLLPRRYHAWYSRSGLPSGDENDDGMSFPLSYNKLVERYPHIEKDHLVKLLKQLIINTSSPSRAMIGGDAPNAADVPTLLGRGSFSLLSYDRDKGQNEIDHPPAHMRWPHMYADQVRGLGLREIGGGFTRHHRAPSIRAACYAIAKPSTMVQKMQNIKRVRGHRNAVYCAIFDRSGRYVITGSDDRLVKIWSMETAYCLASCRGHEGDITDLAVSSNNALVASASNDCIIRVWRLPDGLPISVLRGHTAAVTAIAFSPRPGSVYQLLSSSDDGTCRIWDARYSQFSPRIYIPRPSDAVAGRNMAPSSSAGPQSHQIFCCAFNANGTVFVTGSSDTLARVWNACKPNTDDSDQPNHEIDVLSGHENDVNYVQFSGCAVASRFSLADSSKEDSTPKFKNSWFCHDNIVTCSRDGSAIIWIPRSRRSHPKAARWTQAYHLKVPPPPMPPQPPRGGPRQRILPTPRGVNMIVWSLDNRFVLAAIMDCRICVWNAADGSLVHSLTGHTESTYVLDVHPFNPRIAMSAGYDGKTIVWDIWEGIPIRIYEISRFRLVDGKFSPDGASIILSDDVGQLYILNTGQGESQKDAKYDQFFLGDYRPLVQDTYGNVLDQETQLAPHRRNLQDPLCDSAMIPYPEPYQTMYQQRRLGALGIEWRPSSLKLAVGPDFSLDQGYQLQPLADLDVMIDPLPEFIDVMDWEPENEVQSDDNDSEYNVAEEYSTEEKGSLSSTSSGDSECSAEDSEDGENPMDGLRRSKRKKQKAEVEIMTSSGRRVKRRILDESEGNAAFGNKRTRKSGNRQKSSRRKSSTSKSLRPQRAAARNARSFFSKITGASTDGEDVDGSEGELSESESDLQDSYIESEESGRSLLNEQRKHSKGKGISLDDSEDVTKLDTPESHVNAGIRRLVLKLPVRDSNKHELQERTSDKCNQLVSVIGTSSEAHQEATEGNGNRVSYVGNNCSSVDANCGLMERRGRGQFDKLEDYLNLSNGYKDGKIRWGGVRARSSKRLKIGEMMPLDANNGSGIHLDDDKEKESEVNGHVKPEKDGIDISCGEEITNCGDNTDEVPLKNVKNLSGENNDVYSGDASCKEQQSGFSELNYYDESKCVNTTDEDTTPYPNHLQNGTIQPSELKEILTPVSTKLRIRSKRILRDADVENQNNGCDALHGSSLDIKPNSLPEVLESDGTNRTSSDRGADGSQRLNAQIDSTSEHDPLGSHSHSHDPLGSHSHSHSRKMFNVVYRRSKTNRDRTNSEGDGGGVGESTLNANNNNFHESATDGSRRTRSMGLKTTTCDPDNVSSNLRLEQHNQPEDMYSGHNRSTSRCQLPHEEWGSSSKMTVGLRSTRNRRTSYLFCDSSPIDRRKTHQSLRKGSWLMLSTHEEGSRYIPQLGDEVVYLRQVRWISIINSLFFSLVFVLI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1491 2.2.26 [Sep-21-2011]
Q8WWQ0 1821 PH-interacting protein OS yes no 0.377 0.309 0.323 9e-81
Q8VDD9 1821 PH-interacting protein OS yes no 0.377 0.309 0.322 1e-80
Q9NSI6 2320 Bromodomain and WD repeat no no 0.381 0.245 0.314 7e-80
Q921C3 2304 Bromodomain and WD repeat no no 0.389 0.251 0.314 5e-79
Q6RI45 1802 Bromodomain and WD repeat no no 0.389 0.322 0.309 1e-73
A2AHJ4 1799 Bromodomain and WD repeat no no 0.389 0.322 0.306 1e-72
Q54MP8 2200 Bromodomain and WD repeat yes no 0.186 0.126 0.276 2e-30
P25382515 Ribosome assembly protein yes no 0.210 0.609 0.235 4e-20
Q8YRI11526 Uncharacterized WD repeat no no 0.240 0.234 0.255 5e-20
P38129798 Transcription initiation no no 0.129 0.241 0.285 2e-19
>sp|Q8WWQ0|PHIP_HUMAN PH-interacting protein OS=Homo sapiens GN=PHIP PE=1 SV=2 Back     alignment and function desciption
 Score =  303 bits (775), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 228/704 (32%), Positives = 328/704 (46%), Gaps = 141/704 (20%)

Query: 51  EVYFLIMHFLSTGPCHRTYGQFWNELLEHQLLPRRYHAWYSRSGLPSGDENDDGMSFPLS 110
           E+YFLI  FL  GPC +       E+ E +LLPRR   W              G   P +
Sbjct: 14  ELYFLIARFLEDGPCQQAAQVLIREVAEKELLPRRTD-W-------------TGKEHPRT 59

Query: 111 YNKLVERYPHIEKDHLVKLLKQLIINTSSPSRAMIGGDAPNAA-DVPTLLGRGSFSLLSY 169
           Y  LV+ Y H+  DHL+++  +L          ++  + P +   V TLLG G  SLL  
Sbjct: 60  YQNLVKYYRHLAPDHLLQICHRL--------GPLLEQEIPQSVPGVQTLLGAGRQSLLRT 111

Query: 170 DRDKGQNEIDHPPAHMRWPHMYADQVRGLGLREIGGGF-----TRHHRAPSIRAACYAIA 224
           ++            H+ W        +G  L  +  G        +   PSI    ++  
Sbjct: 112 NKS---------CKHVVW--------KGSALAALHCGRPPESPVNYGSPPSIADTLFSRK 154

Query: 225 ----------KPSTMVQKMQNIKRVRGHRNAVYCAIFDRSGRYVITGSDDRLVKIWSMET 274
                      P+ + Q M+  KR+ GH ++VYC  FDR+GR + TGSDD LVKIW+ + 
Sbjct: 155 LNGKYRLERLVPTAVYQHMKMHKRILGHLSSVYCVTFDRTGRRIFTGSDDCLVKIWATDD 214

Query: 275 AYCLASCRGHEGDITDLAVSSNNALVASASNDCIIRVWRLPDGLPISVLRGHTAAVTAIA 334
              LA+ RGH  +I+D+AV+  N ++A+ S D +IRVW L    P++VL+GH+A++T++ 
Sbjct: 215 GRLLATLRGHAAEISDMAVNYENTMIAAGSCDKMIRVWCLRTCAPLAVLQGHSASITSLQ 274

Query: 335 FSPR-PGSVYQLLSSSDDGTC--RIWDARYSQFSPR--IYIPRPSDAVAGRNMAPSSSAG 389
           FSP   GS   L S+  DGT    +WDA   + +PR   +  RP   V            
Sbjct: 275 FSPLCSGSKRYLSSTGADGTICFWLWDAGTLKINPRPAKFTERPRPGV------------ 322

Query: 390 PQSHQIFCCAFNANGTVFVTGSSDTLARVWNACKPNTDDSDQPNHEIDVLSGHENDVNYV 449
               Q+ C +F+A G    TGS+D + RV+         S QP  +I  L  H + V+ +
Sbjct: 323 ----QMICSSFSAGGMFLATGSTDHIIRVYFF------GSGQP-EKISELEFHTDKVDSI 371

Query: 450 QFSGCAVASRFSLADSSKEDSTPKFKNSWFCHDNIVTCSRDGSAIIWIPRSRRSHPKAAR 509
           QFS    ++RF                        V+ SRDG+A IW  + +R   K+  
Sbjct: 372 QFSN--TSNRF------------------------VSGSRDGTARIW--QFKRREWKSIL 403

Query: 510 WTQAYHLKVPPPPMPPQPPRGGPRQRILPTPRGVNMIVWSLDNRFVLAAIMDCRICVWNA 569
              A          P      G   +I  T   V M+ W   +  V+ A+ +  + VWN+
Sbjct: 404 LDMATR--------PAGQNLQGIEDKI--TKMKVTMVAWDRHDNTVITAVNNMTLKVWNS 453

Query: 570 ADGSLVHSLTGHTESTYVLDVHPFNPRIAMSAGYDGKTIVWDIWEGIPIRIYEISRFRLV 629
             G L+H L GH +  +VL+ HPF+PR+  SAG+DG  IVWD+  G+ IR Y    F ++
Sbjct: 454 YTGQLIHVLMGHEDEVFVLEPHPFDPRVLFSAGHDGNVIVWDLARGVKIRSY----FNMI 509

Query: 630 DG---------KFSPDGASIILSDDVGQLYILNTGQGESQKDAKYDQ-FFLGDYRPLVQD 679
           +G         K SPDG     +D  G L I   G   S+ D   DQ FF  DYRPL++D
Sbjct: 510 EGQGHGAVFDCKCSPDGQHFACTDSHGHLLIFGFGSS-SKYDKIADQMFFHSDYRPLIRD 568

Query: 680 TYGNVLDQETQLAPHRRNLQDP--LCDSAMIPYPEPYQTMYQQR 721
               VLD++TQ APH   L  P  L D    P+P  YQ +   R
Sbjct: 569 ANNFVLDEQTQQAPH---LMPPPFLVDVDGNPHPSRYQRLVPGR 609




Probable regulator of the insulin and insulin-like growth factor signaling pathways. Stimulates cell proliferation through regulation of cyclin transcription and has an anti-apoptotic activity through AKT1 phosphorylation and activation. Plays a role in the regulation of cell morphology and cytoskeletal organization.
Homo sapiens (taxid: 9606)
>sp|Q8VDD9|PHIP_MOUSE PH-interacting protein OS=Mus musculus GN=Phip PE=1 SV=2 Back     alignment and function description
>sp|Q9NSI6|BRWD1_HUMAN Bromodomain and WD repeat-containing protein 1 OS=Homo sapiens GN=BRWD1 PE=1 SV=4 Back     alignment and function description
>sp|Q921C3|BRWD1_MOUSE Bromodomain and WD repeat-containing protein 1 OS=Mus musculus GN=Brwd1 PE=1 SV=2 Back     alignment and function description
>sp|Q6RI45|BRWD3_HUMAN Bromodomain and WD repeat-containing protein 3 OS=Homo sapiens GN=BRWD3 PE=1 SV=2 Back     alignment and function description
>sp|A2AHJ4|BRWD3_MOUSE Bromodomain and WD repeat-containing protein 3 OS=Mus musculus GN=Brwd3 PE=2 SV=1 Back     alignment and function description
>sp|Q54MP8|Y5837_DICDI Bromodomain and WD repeat-containing DDB_G0285837 OS=Dictyostelium discoideum GN=DDB_G0285837 PE=4 SV=1 Back     alignment and function description
>sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 Back     alignment and function description
>sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=4 SV=1 Back     alignment and function description
>sp|P38129|TAF5_YEAST Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1491
225431924 1756 PREDICTED: uncharacterized protein LOC10 0.971 0.824 0.708 0.0
356558137 1773 PREDICTED: uncharacterized protein LOC10 0.958 0.805 0.619 0.0
2960832621569 unnamed protein product [Vitis vinifera] 0.790 0.750 0.732 0.0
356532519 1777 PREDICTED: uncharacterized protein LOC10 0.963 0.808 0.626 0.0
225437555 1766 PREDICTED: uncharacterized protein LOC10 0.959 0.810 0.606 0.0
449433431 1729 PREDICTED: uncharacterized protein LOC10 0.954 0.823 0.606 0.0
2555563441519 WD-repeat protein, putative [Ricinus com 0.647 0.635 0.786 0.0
2977439761549 unnamed protein product [Vitis vinifera] 0.718 0.691 0.692 0.0
42568419 1677 WD40/YVTN repeat and Bromo-WDR9-I-like d 0.919 0.817 0.575 0.0
297795697 1662 transducin family protein [Arabidopsis l 0.908 0.814 0.575 0.0
>gi|225431924|ref|XP_002277060.1| PREDICTED: uncharacterized protein LOC100248159 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1931 bits (5002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1067/1505 (70%), Positives = 1196/1505 (79%), Gaps = 57/1505 (3%)

Query: 1    MALRKYIPSADAPSGTMKPLSFSSKVHENAQLAGSDTSQPAELDVDVDLREVYFLIMHFL 60
            MAL+KYIPS DAPS +MKPLSFSSKV E  QLA  + S   + DVD+DLREVYFLIMHFL
Sbjct: 1    MALQKYIPSGDAPSVSMKPLSFSSKVQEKVQLADPEGSPTMDADVDIDLREVYFLIMHFL 60

Query: 61   STGPCHRTYGQFWNELLEHQLLPRRYHAWYSRSGLPSGDENDDGMSFPLSYNKLVERYPH 120
            S GPCHRTYGQFWNELLEHQLLPRRYHAWYSRSGL SGDENDDG SFPLSYNKLVERYPH
Sbjct: 61   SAGPCHRTYGQFWNELLEHQLLPRRYHAWYSRSGLRSGDENDDGSSFPLSYNKLVERYPH 120

Query: 121  IEKDHLVKLLKQLIINTSSPSRAMIGGDAPNAADVPTLLGRGSFSLLSYDRDKGQNEIDH 180
            I KDHLVKLLKQLI++T+ PS+ MI G+ PNAADVPTLLG GSFSLL  D DKG NE++ 
Sbjct: 121  IGKDHLVKLLKQLILSTTHPSQGMIRGNVPNAADVPTLLGTGSFSLLGNDMDKGHNEVNP 180

Query: 181  PPAHMRWPHMYADQVRGLGLREIGGGFTRHHRAPSIRAACYAIAKPSTMVQKMQNIKRVR 240
            PP HMRWPHM ADQVRGL LREIGGGFTRH+RAPSIRAACYA+AKPSTMVQKMQNIK++R
Sbjct: 181  PPIHMRWPHMQADQVRGLSLREIGGGFTRHNRAPSIRAACYAVAKPSTMVQKMQNIKKLR 240

Query: 241  GHRNAVYCAIFDRSGRYVITGSDDRLVKIWSMETAYCLASCRGHEGDITDLAVSSNNALV 300
            GHRNAVYCAIFDR+GRYVITGSDDRLVKIWSMETAYCLASCRGHEGDITDLAVSSNNALV
Sbjct: 241  GHRNAVYCAIFDRTGRYVITGSDDRLVKIWSMETAYCLASCRGHEGDITDLAVSSNNALV 300

Query: 301  ASASNDCIIRVWRLPDGLPISVLRGHTAAVTAIAFSPRPGSVYQLLSSSDDGTCRIWDAR 360
            AS+SNDCIIRVWRLPDGLPISVLRGHT AVTAIAFSPRP SVYQLLSSSDDGTCRIWDAR
Sbjct: 301  ASSSNDCIIRVWRLPDGLPISVLRGHTGAVTAIAFSPRPSSVYQLLSSSDDGTCRIWDAR 360

Query: 361  YSQFSPRIYIPRPSDAVAGRNMAPSSSAGPQSHQIFCCAFNANGTVFVTGSSDTLAR--- 417
            YSQFSPRIY+PRP D++AG+N  PSSS GPQSHQIFCCAFNANGTVFVTGSSDTLAR   
Sbjct: 361  YSQFSPRIYVPRPPDSIAGKNNVPSSSNGPQSHQIFCCAFNANGTVFVTGSSDTLARVHL 420

Query: 418  ---VWNACKPNTDDSDQPNHEIDVLSGHENDVNYVQFSGCAVASRFSLADSSKEDSTPKF 474
               VWNACK N D+SDQPNHE+D+LSGHENDVNYVQFSGCAV+SRFS+A+SSKE++ PKF
Sbjct: 421  MISVWNACKSNPDESDQPNHEMDILSGHENDVNYVQFSGCAVSSRFSVAESSKEENVPKF 480

Query: 475  KNSWFCHDNIVTCSRDGSAIIWIPRSRRSHPKAARWTQAYHLKVPPPPMPPQPPRGGPRQ 534
            KNSWF HDNIVTCSRDGSAIIWIPRSRRSH K  RWT+AYHLKVPPPPMPPQPPRGGPRQ
Sbjct: 481  KNSWFTHDNIVTCSRDGSAIIWIPRSRRSHGKVGRWTRAYHLKVPPPPMPPQPPRGGPRQ 540

Query: 535  RILPTPRGVNMIVWSLDNRFVLAAIMDCRICVWNAADGSLVHSLTGHTESTYVLDVHPFN 594
            RILPTPRGVNMIVWSLDNRFVLAAIMDCRICVWNA DGSLVHSLTGHTESTYVLDVHPFN
Sbjct: 541  RILPTPRGVNMIVWSLDNRFVLAAIMDCRICVWNAVDGSLVHSLTGHTESTYVLDVHPFN 600

Query: 595  PRIAMSAGYDGKTIVWDIWEGIPIRIYEISRFRLVDGKFSPDGASIILSDDVGQLYILNT 654
            PRIAMSAGYDGKTIVWDIWEG PIRIY+ +RF+LVDGKFSPDG SIILSDDVGQLYIL+T
Sbjct: 601  PRIAMSAGYDGKTIVWDIWEGTPIRIYDTARFKLVDGKFSPDGTSIILSDDVGQLYILST 660

Query: 655  GQGESQKDAKYDQFFLGDYRPLVQDTYGNVLDQETQLAPHRRNLQDPLCDSAMIPYPEPY 714
            GQGESQKDA YDQFFLGDYRPL+QDTYGNVLDQETQLAP+RRN+QD LCD+ MIPYPEPY
Sbjct: 661  GQGESQKDAMYDQFFLGDYRPLIQDTYGNVLDQETQLAPYRRNMQDLLCDATMIPYPEPY 720

Query: 715  QTMYQQRRLGALGIEWRPSSLKLAVGPDFSLDQGYQLQPLADLDVMIDPLPEFIDVMDWE 774
            Q+MYQQRRLGALGIEWRPSSL+LAVGPDF+LDQ YQ+ PL DLDV+IDPLPEFIDVMDWE
Sbjct: 721  QSMYQQRRLGALGIEWRPSSLRLAVGPDFNLDQDYQMLPLPDLDVLIDPLPEFIDVMDWE 780

Query: 775  PENEVQSDDNDSEYNVAEEYST-EEKGSLSSTSSGDSECSAEDSEDGENPMDGLRRSKRK 833
            PENEVQ+DD DSEYNV EEYST  E+GSLSS SSGD ECSAEDS+   +  DGLRRSKRK
Sbjct: 781  PENEVQTDDTDSEYNVTEEYSTGGEQGSLSSNSSGDPECSAEDSDVENSHKDGLRRSKRK 840

Query: 834  KQKAEVEIMTSSGRRVKRRILDESEGNAAFGNKRTRKSGNRQKSSRRKSSTSKSLRPQRA 893
            KQKAE EIMT SGRRVKRR LDE +GN+   N RTRKS + +K S + SS SKSLRPQRA
Sbjct: 841  KQKAETEIMTFSGRRVKRRNLDEFDGNSLRSN-RTRKSRSGRKVSHKNSSKSKSLRPQRA 899

Query: 894  AARNARSFFSKITGASTDGEDVDGSEGELSESESDLQDSYIESEESGRSLLNEQRKHSKG 953
            AARNA + FS++ G STDGED DGSEG+LSESES L+DS IES+ES  SL NEQ KHSKG
Sbjct: 900  AARNALTLFSRMKGTSTDGEDEDGSEGDLSESESSLEDSNIESDESDGSLQNEQCKHSKG 959

Query: 954  KGISLDDSEDVTKL-DTPESHVNAG-IRRLVLKLPVRDSNKHELQERTSDKCNQLVSVIG 1011
            K +SLD+ ED+ K  + PES +NAG  RRLVLK P+RDSN+  L        NQ   ++G
Sbjct: 960  KEVSLDEFEDMDKQHEHPESCMNAGNRRRLVLKFPIRDSNRLLLAPE-----NQ-ADLVG 1013

Query: 1012 TSSEAHQEATEGNGNRVSYVGNNCSSVDANCGLMERRGRGQFDKLEDYLNLSNGYKDGKI 1071
            +SS+A QEA+E N N +S      SS DANC  +ERR RGQ +K+ED+L+L  GYKDGKI
Sbjct: 1014 SSSKAPQEASEVNRNHLSSQDLGYSSSDANCNRIERRERGQPEKIEDHLDLFEGYKDGKI 1073

Query: 1072 RWGGVRARSSKRLKIGEMMPLDANNGSGIHLDDDKEKESEVNGHVKPEKDGIDISCGEEI 1131
            RWGGV+AR+SKRL++ E MP D +  S   +D     E+ +NG  +PEK+   IS   EI
Sbjct: 1074 RWGGVKARTSKRLRVVEPMPSDTDARSRQCIDGHDATENTINGFQEPEKNYDRISPHSEI 1133

Query: 1132 TNCGDNTDEVPLKNVKNLSGENNDVYSGDASCK-EQQSGFSELNYYDE-SKCVNTTDEDT 1189
                + T ++   N ++    N  V   DA+   ++ S F+E   YDE  K VN    DT
Sbjct: 1134 KYHVEETGKMAHMNGQHFG--NGAVEGLDATSNGKKHSSFNECMNYDEPPKQVNMVAGDT 1191

Query: 1190 TPYPNHLQNGTIQPSELKEILTPVSTKLRIRSKRILRDAD----------VENQNNG-CD 1238
                    NGT  P  LKE  T  STKLRIRSK+IL D +          VE+ +NG CD
Sbjct: 1192 AASSVQHSNGTDHPPHLKESSTS-STKLRIRSKKILEDPEIPSDPKIKSSVEDWSNGRCD 1250

Query: 1239 ALHGSSLDIKPNSLPEVLESDGTNRTSSDRG-ADGSQRLNAQIDSTSEHDPLGSHSHSHD 1297
             L  S L+I      EV + D T+R  SD G  +G  +  A I+  S        S   D
Sbjct: 1251 TLSESQLEIA-----EVPDCDDTDRPHSDHGDWNGLLKSEAAIEQNSR-------SVLQD 1298

Query: 1298 PLGSHSHSHSRKMFNVVYRRSKTNRDRTNSEGDGGGVGESTLNANNNN------FHESAT 1351
              G +SH ++ KM+N VYRRS++ R RTNSEG+GGG+ EST NA+N+N      FHE+ T
Sbjct: 1299 SQGLYSHVNN-KMYNAVYRRSRSYRTRTNSEGEGGGMEESTSNASNHNLDSGMDFHEATT 1357

Query: 1352 DGSRRTRSMGLKTTTCDPDNVSSNLRLEQHNQPEDMYSGHNR-STSRC-QLPHEEWGSSS 1409
            DG+RRTRSMGLK TT DPD   SNL+L   +  ED     ++ S +R  +LP EEW SSS
Sbjct: 1358 DGARRTRSMGLKATTRDPDVTCSNLKLRLGHGSEDTLKSVDKFSVNRSDELPCEEWMSSS 1417

Query: 1410 KMTVGLRSTRNRRTSYLFCDS--SPIDRRKTHQSLRKGSWLMLSTHEEGSRYIPQLGDEV 1467
            +MTVGLRS RNRR SY   D+  SP++RRK HQS +K SWLMLS H E  RYIPQLGDEV
Sbjct: 1418 RMTVGLRSARNRRASYHVRDTSPSPMERRKPHQSSKKVSWLMLSMHVE-PRYIPQLGDEV 1476

Query: 1468 VYLRQ 1472
            VYLRQ
Sbjct: 1477 VYLRQ 1481




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356558137|ref|XP_003547364.1| PREDICTED: uncharacterized protein LOC100818665 [Glycine max] Back     alignment and taxonomy information
>gi|296083262|emb|CBI22898.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356532519|ref|XP_003534819.1| PREDICTED: uncharacterized protein LOC100819598 [Glycine max] Back     alignment and taxonomy information
>gi|225437555|ref|XP_002270469.1| PREDICTED: uncharacterized protein LOC100248563 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449433431|ref|XP_004134501.1| PREDICTED: uncharacterized protein LOC101214610 [Cucumis sativus] Back     alignment and taxonomy information
>gi|255556344|ref|XP_002519206.1| WD-repeat protein, putative [Ricinus communis] gi|223541521|gb|EEF43070.1| WD-repeat protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297743976|emb|CBI36946.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|42568419|ref|NP_199754.2| WD40/YVTN repeat and Bromo-WDR9-I-like domain-containing protein [Arabidopsis thaliana] gi|332008427|gb|AED95810.1| WD40/YVTN repeat and Bromo-WDR9-I-like domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297795697|ref|XP_002865733.1| transducin family protein [Arabidopsis lyrata subsp. lyrata] gi|297311568|gb|EFH41992.1| transducin family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1491
TAIR|locus:2158044 1677 AT5G49430 "AT5G49430" [Arabido 0.788 0.700 0.579 0.0
TAIR|locus:20619971520 AT2G47410 "AT2G47410" [Arabido 0.592 0.581 0.672 0.0
UNIPROTKB|Q9NSI6 2320 BRWD1 "Bromodomain and WD repe 0.191 0.122 0.316 5.5e-61
UNIPROTKB|E1BSG1 2293 BRWD1 "Uncharacterized protein 0.176 0.114 0.305 4.7e-60
UNIPROTKB|F1MTQ0 2322 BRWD1 "Uncharacterized protein 0.191 0.122 0.313 3.4e-59
ZFIN|ZDB-GENE-050208-261 1805 phip "pleckstrin homology doma 0.119 0.098 0.376 6e-58
RGD|1559445 1799 Brwd3 "bromodomain and WD repe 0.195 0.161 0.312 4.3e-56
FB|FBgn0011785 2232 BRWD3 "BRWD3" [Drosophila mela 0.244 0.163 0.259 8.3e-53
ZFIN|ZDB-GENE-041111-120 2008 brwd1 "bromodomain and WD repe 0.174 0.129 0.315 6.9e-48
DICTYBASE|DDB_G0285837 2200 DDB_G0285837 "BRWD group prote 0.148 0.100 0.319 5.8e-45
TAIR|locus:2158044 AT5G49430 "AT5G49430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3415 (1207.2 bits), Expect = 0., Sum P(2) = 0.
 Identities = 705/1216 (57%), Positives = 837/1216 (68%)

Query:     1 MALRKYIPSADAPSGTMKPLSFSSKVHENAQLAGSDTSQPAELDVDVDLREVYFLIMHFL 60
             MALRK  P  D+ S  MKPL+FS K+  N Q+   D  Q    ++D+DLREVYFL++H L
Sbjct:     1 MALRKNTPKGDSVSLPMKPLNFSRKLPGNVQIPDPDIVQSVAPNIDLDLREVYFLMLHLL 60

Query:    61 STGPCHRTYGQFWNELLEHQLLPRRYHAWYSRSGLPSGDENDDGMSFPLSYNKLVERYPH 120
             S+GPC +TY    +ELLEH+LLPRRYHAWYSRSGLPSGDENDDG SFPL+Y +L +RY H
Sbjct:    61 SSGPCQKTYALLRHELLEHELLPRRYHAWYSRSGLPSGDENDDGNSFPLNYTELAKRYSH 120

Query:   121 IEKDHLVKLLKQLII--NTSSPSRAMIGGDAPNAADVPTLLGRGSFSLLSYDRDKGQNEI 178
             ++KDHLV+LLKQL+   N  +PSR +  G+    A VPTLLG GSFSLLS D++   +++
Sbjct:   121 VKKDHLVELLKQLVFVSNRPNPSRGIGDGNKMIGAGVPTLLGTGSFSLLSSDKEIVGSDL 180

Query:   179 DHPPAHMRWPHMYADQVRGLGLREIGGGFTRHHRAPSIRAACYAIAKPSTMVQKMQNIKR 238
               PP  MRWPHM+ADQVRG+ LREIGGGF RHHRAPSIRAACY IAKPS+MVQKMQNIKR
Sbjct:   181 KPPPIGMRWPHMHADQVRGISLREIGGGFARHHRAPSIRAACYVIAKPSSMVQKMQNIKR 240

Query:   239 VRGHRNAVYCAIFDRSGRYVITGSDDRLVKIWSMETAYCLASCRGHEGDITDXXXXXXXX 298
             +RGHRNAVYCAI DRSGRYVITGSDDRLVK+WSM+TAYCLASCRGHEGDITD        
Sbjct:   241 LRGHRNAVYCAILDRSGRYVITGSDDRLVKVWSMDTAYCLASCRGHEGDITDLAVSSNNI 300

Query:   299 XXXXXXXDCIIRVWRLPDGLPISVLRGHTAAVTAIAFSPRPGSVYQLLSSSDDGTCRIWD 358
                    DC+IRVWRLPDGLP+SVLRGHT AVTAIAFSPRPGS YQLLSSSDDGTCRIWD
Sbjct:   301 FIASASNDCVIRVWRLPDGLPVSVLRGHTGAVTAIAFSPRPGSPYQLLSSSDDGTCRIWD 360

Query:   359 ARYSQFSPRIYIPRPSDAVAGRNMAPSSSAGPQSHQIFCCAFNANGTVFVTGSSDTLARV 418
             AR +QF+PRIY+PRP     G+N  PSSS   QSHQIFCCAFNA+G+VFVTGSSDTLARV
Sbjct:   361 ARGAQFAPRIYVPRPPSP-DGKNSGPSSSNAQQSHQIFCCAFNASGSVFVTGSSDTLARV 419

Query:   419 ---WNACKPNTDDSDQPNHEIDVLSGHENDVNYVQFSGCAVASRFSLADSSKEDSTPKFK 475
                W+A K NTDD +QPNHE+DVL+GHENDVNYVQFSGCA  S+FS+ D SK+++ PKFK
Sbjct:   420 YSVWSANKTNTDDPEQPNHEMDVLAGHENDVNYVQFSGCAAGSKFSVTDYSKDENVPKFK 479

Query:   476 NSWFCHDNIVTCSRDGSAIIWIPRSRRSHPKAARWTQAYHLKVXXXXXXXXXXXXXXXXX 535
             NSWFCHDNIVTCSRDGSAIIWIPR RRSH K+ RWT+AYHLKV                 
Sbjct:   480 NSWFCHDNIVTCSRDGSAIIWIPRLRRSHGKSCRWTRAYHLKVPPPPMPPQPPRGGPRQR 539

Query:   536 ILPTPRGVNMIVWSLDNRFVLAAIMDCRICVWNAADGSLVHSLTGHTESTYVLDVHPFNP 595
             ILPTPRGVNMI WSLDNRFVLAAIMDCRICVWNA+DGSLVHSLTGHT STYV+DVHPFNP
Sbjct:   540 ILPTPRGVNMIAWSLDNRFVLAAIMDCRICVWNASDGSLVHSLTGHTASTYVMDVHPFNP 599

Query:   596 RIAMSAGYDGKTIVWDIWEGIPIRIYEISRFRLVDGKFSPDGASIILSDDVGQLYILNTG 655
             RIAMSAGYDGKTIVWDIWEGIPI+IY+IS ++LVDGKFSPDG SIILSDDVGQLYIL+TG
Sbjct:   600 RIAMSAGYDGKTIVWDIWEGIPIQIYDISHYKLVDGKFSPDGTSIILSDDVGQLYILSTG 659

Query:   656 QGESQKDAKYDQFFLGDYRPLVQDTYGNVLDQETQLAPHRRNLQDPLCDSAMIPYPEPYQ 715
             QG+SQKDAKYDQFFLGDYRPL+QDTYGNVLDQE+QL P+RRN++DPLCDS MIPY EPYQ
Sbjct:   660 QGDSQKDAKYDQFFLGDYRPLIQDTYGNVLDQESQLQPYRRNMEDPLCDSGMIPYEEPYQ 719

Query:   716 TMYQQRRLGALGIEWRPSSLKLAVGPDFSLDQGYQLQPLADLDVMIDPLPEFIDVMDWEP 775
             T +Q+RRLGALG EWRPSSLKLAVGPD +LD+ YQ+ PLADLD + +PLPEFIDVM+WEP
Sbjct:   720 TTFQKRRLGALGKEWRPSSLKLAVGPDITLDRDYQMPPLADLD-LAEPLPEFIDVMEWEP 778

Query:   776 ENEVQSDDNDSEYNVAEEYXXXXXXX-XXXXXXXXXXXXXXDSEDGENPMDGLRRSKRKK 834
             E ++ SD+NDSEYNV EEY                      +S + ++  + LRRSKRKK
Sbjct:   779 EVDILSDENDSEYNVPEEYSSGKEQECLNSSTSGESGSSSGESYEDDDHQNSLRRSKRKK 838

Query:   835 QKAEVEIMTSSGRRVKRRILDESEGNAAFGNKRTXXXXXXXXXXXXXXXXXXXLRPQXXX 894
              K E  IMTSSGRRVK+R  DE EG A    KRT                    RP+   
Sbjct:   839 HKKEAGIMTSSGRRVKKRNFDELEG-APSNKKRTRKSRSGRKESKRKSSKSKSSRPRRAA 897

Query:   895 XXXXXSFFSKITGASTXXXXXXXXXXXXXXXXXXXXXXYIESE-ESGRSLLNEQRKHSKG 953
                  S+FSKITG S                           + E   +LLN   K SKG
Sbjct:   898 ARNALSWFSKITGTSKDAEEEEVSELSDSSESESTTQDSGTGDSELEVALLNGHGKQSKG 957

Query:   954 KGISLDDSED-VTKLDTPESHVNAGIRRLVLKLPVRDSNKHELQERT-SDKCNQLVSVIG 1011
             K I + DS+D   + D  E+H  A  RRLVL+ PVR+S+K  L E      C+     +G
Sbjct:   958 KTILVCDSDDGAQQCDIRETHT-AERRRLVLRFPVRNSDKLTLLENLPGSSCDVPSPTLG 1016

Query:  1012 TSSEAHQEATEGNGNRVSYVGNNCSSVDANCGLME----RRGRGQFDKLEDYLNLS---- 1063
                    E +   GN+  + G + S V    G+++    +R RG+     + +       
Sbjct:  1017 NGCT---EDSRIPGNQ--FEGLDVSKV--KWGMVKARTTKRIRGEAISSHELMGSDPEGK 1069

Query:  1064 -NGYK-DGKIRWGGVRARSSKRLKIG-EMMPLDANNGSGIHLDDDKEKESEVNGHVKPEK 1120
              N  K D   R  GV A S   LK   + M +D +      L +  ++  E++G      
Sbjct:  1070 ENNVKEDSNHRGNGVTAPSCLELKTDIDDMAVDTDTVISNGLPNGGKRYPELDGSPSRVA 1129

Query:  1121 DGIDISCGEEITNCGDNTDEVP-----LK-NVKNLSG--ENNDVYSGDASCKEQQSGFSE 1172
             D    +  + +T+  D  D +P     LK   K +S   + +    G +   +Q++G S+
Sbjct:  1130 DDKASNSSQNVTHRHDLIDSLPPISTTLKIRSKRVSRAPDTSLRQEGKSLSIDQETGGSD 1189

Query:  1173 -LNY-YDESKCVNTTD 1186
              LN  ++++KC  T D
Sbjct:  1190 ALNDGFEDAKCDLTLD 1205


GO:0000166 "nucleotide binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0080008 "Cul4-RING ubiquitin ligase complex" evidence=ISS
TAIR|locus:2061997 AT2G47410 "AT2G47410" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NSI6 BRWD1 "Bromodomain and WD repeat-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BSG1 BRWD1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MTQ0 BRWD1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050208-261 phip "pleckstrin homology domain interacting protein" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1559445 Brwd3 "bromodomain and WD repeat domain containing 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0011785 BRWD3 "BRWD3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041111-120 brwd1 "bromodomain and WD repeat domain containing 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0285837 DDB_G0285837 "BRWD group protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1491
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 4e-51
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 6e-40
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-38
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-35
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-35
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 7e-25
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-22
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 5e-21
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 6e-20
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-16
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-11
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 3e-10
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 5e-08
smart0032040 smart00320, WD40, WD40 repeats 1e-07
smart0032040 smart00320, WD40, WD40 repeats 8e-07
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 1e-06
smart0032040 smart00320, WD40, WD40 repeats 2e-06
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 3e-06
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-05
smart0032040 smart00320, WD40, WD40 repeats 5e-04
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 8e-04
pfam05764238 pfam05764, YL1, YL1 nuclear protein 0.001
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 0.002
PTZ00420568 PTZ00420, PTZ00420, coronin; Provisional 0.002
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
 Score =  182 bits (463), Expect = 4e-51
 Identities = 97/379 (25%), Positives = 152/379 (40%), Gaps = 92/379 (24%)

Query: 235 NIKRVRGHRNAVYCAIFDRSGRYVITGSDDRLVKIWSMETAYCLASCRGHEGDITDLAVS 294
             + ++GH   V C  F   G+ + TGS D  +K+W +ET   L + +GH G + D+A S
Sbjct: 1   LRRTLKGHTGGVTCVAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDVAAS 60

Query: 295 SNNALVASASNDCIIRVWRLPDGLPISVLRGHTAAVTAIAFSPRPGSVYQLLSSSDDGTC 354
           ++   +AS S+D  IR+W L  G  +  L GHT+ V+++AFSP  G +  L SSS D T 
Sbjct: 61  ADGTYLASGSSDKTIRLWDLETGECVRTLTGHTSYVSSVAFSPD-GRI--LSSSSRDKTI 117

Query: 355 RIWDARYSQFSPRIYIPRPSDAVAGRNMAPSSSAGPQSHQ--IFCCAFNANGTVFVTGSS 412
           ++WD    +    +                      + H   +   AF+ +GT   + S 
Sbjct: 118 KVWDVETGKCLTTL----------------------RGHTDWVNSVAFSPDGTFVASSSQ 155

Query: 413 DTLARVWNACKPNTDDSDQPNHEIDVLSGHENDVNYVQFSGCAVASRFSLADSSKEDSTP 472
           D   ++W+          +    +  L+GH  +VN V FS           D  K     
Sbjct: 156 DGTIKLWDL---------RTGKCVATLTGHTGEVNSVAFSP----------DGEK----- 191

Query: 473 KFKNSWFCHDNIVTCSRDGSAIIWIPRSRRSHPKAARWTQAYHLKVPPPPMPPQPPRGGP 532
                      +++ S DG+  +W   + +        T   H                 
Sbjct: 192 -----------LLSSSSDGTIKLWDLSTGKCLG-----TLRGHEN--------------- 220

Query: 533 RQRILPTPRGVNMIVWSLDNRFVLAAIMDCRICVWNAADGSLVHSLTGHTESTYVLDVHP 592
                    GVN + +S D   + +   D  I VW+   G  V +L+GHT S   L   P
Sbjct: 221 ---------GVNSVAFSPDGYLLASGSEDGTIRVWDLRTGECVQTLSGHTNSVTSLAWSP 271

Query: 593 FNPRIAMSAGYDGKTIVWD 611
              R+A S   DG   +WD
Sbjct: 272 DGKRLA-SGSADGTIRIWD 289


Length = 289

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|240412 PTZ00420, PTZ00420, coronin; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1491
KOG06441113 consensus Uncharacterized conserved protein, conta 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0319775 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0318603 consensus WD40 repeat stress protein/actin interac 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 100.0
KOG0291893 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0319775 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0291893 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0318603 consensus WD40 repeat stress protein/actin interac 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 100.0
KOG0306888 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0295406 consensus WD40 repeat-containing protein [Function 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0315311 consensus G-protein beta subunit-like protein (con 100.0
KOG0296399 consensus Angio-associated migratory cell protein 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0265338 consensus U5 snRNP-specific protein-like factor an 100.0
KOG0293519 consensus WD40 repeat-containing protein [Function 100.0
KOG14081080 consensus WD40 repeat protein [Function unknown] 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 100.0
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 99.98
KOG02921202 consensus Vesicle coat complex COPI, alpha subunit 99.98
KOG0263707 consensus Transcription initiation factor TFIID, s 99.97
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.97
KOG0306888 consensus WD40-repeat-containing subunit of the 18 99.97
KOG0266456 consensus WD40 repeat-containing protein [General 99.97
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.97
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.97
KOG0315311 consensus G-protein beta subunit-like protein (con 99.97
KOG0645312 consensus WD40 repeat protein [General function pr 99.97
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.97
KOG0296399 consensus Angio-associated migratory cell protein 99.97
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.97
KOG0263707 consensus Transcription initiation factor TFIID, s 99.97
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.97
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.97
PLN00181793 protein SPA1-RELATED; Provisional 99.97
PLN00181793 protein SPA1-RELATED; Provisional 99.97
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 99.97
KOG02921202 consensus Vesicle coat complex COPI, alpha subunit 99.97
KOG0293519 consensus WD40 repeat-containing protein [Function 99.97
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.96
KOG0266456 consensus WD40 repeat-containing protein [General 99.96
KOG0295406 consensus WD40 repeat-containing protein [Function 99.96
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.96
KOG0645312 consensus WD40 repeat protein [General function pr 99.96
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.96
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.96
KOG2106626 consensus Uncharacterized conserved protein, conta 99.96
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.95
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.95
KOG1539910 consensus WD repeat protein [General function pred 99.95
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.95
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.95
KOG0643327 consensus Translation initiation factor 3, subunit 99.95
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.95
KOG0283712 consensus WD40 repeat-containing protein [Function 99.95
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.94
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.94
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.94
KOG0772641 consensus Uncharacterized conserved protein, conta 99.94
KOG0973942 consensus Histone transcription regulator HIRA, WD 99.94
KOG0643327 consensus Translation initiation factor 3, subunit 99.94
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.93
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.93
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.93
KOG1539910 consensus WD repeat protein [General function pred 99.93
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.93
KOG2048691 consensus WD40 repeat protein [General function pr 99.93
KOG0300481 consensus WD40 repeat-containing protein [Function 99.93
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.93
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.93
PTZ00421493 coronin; Provisional 99.93
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.93
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.93
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.92
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.92
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.92
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.92
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.92
KOG14081080 consensus WD40 repeat protein [Function unknown] 99.92
KOG0289506 consensus mRNA splicing factor [General function p 99.92
KOG0973942 consensus Histone transcription regulator HIRA, WD 99.92
KOG2106626 consensus Uncharacterized conserved protein, conta 99.92
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.92
PTZ00420568 coronin; Provisional 99.92
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.91
KOG0301745 consensus Phospholipase A2-activating protein (con 99.91
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.91
KOG0641350 consensus WD40 repeat protein [General function pr 99.91
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.91
KOG0294362 consensus WD40 repeat-containing protein [Function 99.91
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.91
KOG2096420 consensus WD40 repeat protein [General function pr 99.9
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.9
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.9
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.9
KOG0301745 consensus Phospholipase A2-activating protein (con 99.9
KOG0772641 consensus Uncharacterized conserved protein, conta 99.9
KOG0300481 consensus WD40 repeat-containing protein [Function 99.9
KOG0641350 consensus WD40 repeat protein [General function pr 99.9
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.9
KOG2048691 consensus WD40 repeat protein [General function pr 99.9
PTZ00421493 coronin; Provisional 99.89
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.89
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.89
KOG0646476 consensus WD40 repeat protein [General function pr 99.89
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.89
PTZ00420568 coronin; Provisional 99.88
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.88
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.87
KOG0289506 consensus mRNA splicing factor [General function p 99.87
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.87
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.87
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.86
COG2319466 FOG: WD40 repeat [General function prediction only 99.86
KOG15381081 consensus Uncharacterized conserved protein WDR10, 99.86
KOG1273405 consensus WD40 repeat protein [General function pr 99.86
KOG4283397 consensus Transcription-coupled repair protein CSA 99.86
KOG0646476 consensus WD40 repeat protein [General function pr 99.86
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.86
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.86
KOG2096420 consensus WD40 repeat protein [General function pr 99.86
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.85
KOG0269839 consensus WD40 repeat-containing protein [Function 99.85
KOG0294362 consensus WD40 repeat-containing protein [Function 99.85
KOG0639705 consensus Transducin-like enhancer of split protei 99.85
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.85
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.85
KOG0283712 consensus WD40 repeat-containing protein [Function 99.85
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.84
KOG1274933 consensus WD40 repeat protein [General function pr 99.84
COG2319466 FOG: WD40 repeat [General function prediction only 99.84
KOG2055514 consensus WD40 repeat protein [General function pr 99.84
KOG4328498 consensus WD40 protein [Function unknown] 99.84
KOG0639705 consensus Transducin-like enhancer of split protei 99.84
KOG0267825 consensus Microtubule severing protein katanin p80 99.83
KOG1274933 consensus WD40 repeat protein [General function pr 99.83
KOG0267825 consensus Microtubule severing protein katanin p80 99.82
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.82
KOG06441113 consensus Uncharacterized conserved protein, conta 99.81
KOG4328498 consensus WD40 protein [Function unknown] 99.81
KOG0269839 consensus WD40 repeat-containing protein [Function 99.81
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.8
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.8
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.8
KOG1963792 consensus WD40 repeat protein [General function pr 99.8
KOG1273405 consensus WD40 repeat protein [General function pr 99.8
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.79
KOG0302440 consensus Ribosome Assembly protein [General funct 99.79
KOG2055514 consensus WD40 repeat protein [General function pr 99.77
KOG03071049 consensus Vesicle coat complex COPII, subunit SEC3 99.77
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.77
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.77
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.77
KOG0270463 consensus WD40 repeat-containing protein [Function 99.76
KOG0302440 consensus Ribosome Assembly protein [General funct 99.76
KOG4227609 consensus WD40 repeat protein [General function pr 99.76
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.75
KOG1963792 consensus WD40 repeat protein [General function pr 99.75
KOG4283397 consensus Transcription-coupled repair protein CSA 99.75
KOG03071049 consensus Vesicle coat complex COPII, subunit SEC3 99.75
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.74
KOG0270463 consensus WD40 repeat-containing protein [Function 99.73
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.73
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.73
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.72
KOG1334559 consensus WD40 repeat protein [General function pr 99.7
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.7
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.7
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.7
KOG15381081 consensus Uncharacterized conserved protein WDR10, 99.7
KOG1188376 consensus WD40 repeat protein [General function pr 99.69
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.69
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.68
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.68
KOG4227609 consensus WD40 repeat protein [General function pr 99.66
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.66
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.66
KOG1188376 consensus WD40 repeat protein [General function pr 99.65
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.64
KOG1310758 consensus WD40 repeat protein [General function pr 99.63
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.62
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.61
KOG1334559 consensus WD40 repeat protein [General function pr 99.61
KOG0303472 consensus Actin-binding protein Coronin, contains 99.6
PRK11028330 6-phosphogluconolactonase; Provisional 99.6
KOG0649325 consensus WD40 repeat protein [General function pr 99.6
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.58
PRK11028330 6-phosphogluconolactonase; Provisional 99.58
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.57
KOG0303472 consensus Actin-binding protein Coronin, contains 99.57
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.56
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.54
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.53
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.52
KOG0649325 consensus WD40 repeat protein [General function pr 99.52
PRK01742429 tolB translocation protein TolB; Provisional 99.51
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.51
KOG2315566 consensus Predicted translation initiation factor 99.5
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.5
KOG0771398 consensus Prolactin regulatory element-binding pro 99.49
PRK01742429 tolB translocation protein TolB; Provisional 99.48
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.48
KOG0771398 consensus Prolactin regulatory element-binding pro 99.45
KOG2110391 consensus Uncharacterized conserved protein, conta 99.44
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.44
KOG1272545 consensus WD40-repeat-containing subunit of the 18 99.43
KOG1310758 consensus WD40 repeat protein [General function pr 99.42
KOG2321703 consensus WD40 repeat protein [General function pr 99.41
KOG2110391 consensus Uncharacterized conserved protein, conta 99.41
PRK03629429 tolB translocation protein TolB; Provisional 99.39
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.39
PRK03629429 tolB translocation protein TolB; Provisional 99.38
KOG2314698 consensus Translation initiation factor 3, subunit 99.38
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.37
PRK04922433 tolB translocation protein TolB; Provisional 99.35
KOG2139445 consensus WD40 repeat protein [General function pr 99.34
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.34
PRK05137435 tolB translocation protein TolB; Provisional 99.33
PRK04922433 tolB translocation protein TolB; Provisional 99.33
PRK02889427 tolB translocation protein TolB; Provisional 99.31
PRK02889427 tolB translocation protein TolB; Provisional 99.28
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.28
KOG2111346 consensus Uncharacterized conserved protein, conta 99.27
KOG19121062 consensus WD40 repeat protein [General function pr 99.27
KOG2139445 consensus WD40 repeat protein [General function pr 99.26
KOG1409404 consensus Uncharacterized conserved protein, conta 99.26
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.25
KOG19121062 consensus WD40 repeat protein [General function pr 99.24
PRK05137435 tolB translocation protein TolB; Provisional 99.23
KOG2315566 consensus Predicted translation initiation factor 99.23
KOG1272545 consensus WD40-repeat-containing subunit of the 18 99.22
KOG2111346 consensus Uncharacterized conserved protein, conta 99.19
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 99.19
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.18
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.17
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.16
KOG0974967 consensus WD-repeat protein WDR6, WD repeat superf 99.16
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.16
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.14
KOG2314698 consensus Translation initiation factor 3, subunit 99.14
KOG0974967 consensus WD-repeat protein WDR6, WD repeat superf 99.13
KOG20411189 consensus WD40 repeat protein [General function pr 99.13
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.11
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.11
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.07
PRK04792448 tolB translocation protein TolB; Provisional 99.07
PRK00178430 tolB translocation protein TolB; Provisional 99.07
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.06
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.04
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 99.03
PRK01029428 tolB translocation protein TolB; Provisional 99.01
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.01
PRK04792448 tolB translocation protein TolB; Provisional 98.99
PRK00178430 tolB translocation protein TolB; Provisional 98.98
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.97
KOG2321703 consensus WD40 repeat protein [General function pr 98.96
COG4946668 Uncharacterized protein related to the periplasmic 98.94
PRK01029428 tolB translocation protein TolB; Provisional 98.94
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.94
KOG20411189 consensus WD40 repeat protein [General function pr 98.92
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.91
KOG1409404 consensus Uncharacterized conserved protein, conta 98.9
KOG4547541 consensus WD40 repeat-containing protein [General 98.88
KOG4547541 consensus WD40 repeat-containing protein [General 98.87
KOG03091081 consensus Conserved WD40 repeat-containing protein 98.86
COG4946668 Uncharacterized protein related to the periplasmic 98.84
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.82
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.8
KOG0280339 consensus Uncharacterized conserved protein [Amino 98.78
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.76
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.75
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.75
KOG03091081 consensus Conserved WD40 repeat-containing protein 98.73
KOG0280339 consensus Uncharacterized conserved protein [Amino 98.68
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 98.65
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.64
PRK04043419 tolB translocation protein TolB; Provisional 98.57
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.55
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.53
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.52
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.47
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 98.42
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.38
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 98.36
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.36
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.35
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.34
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.33
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.33
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.32
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.31
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.28
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.28
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.26
PRK04043419 tolB translocation protein TolB; Provisional 98.25
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.22
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.21
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 98.2
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.16
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.16
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 98.15
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.11
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 98.09
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 98.06
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 98.05
KOG2695425 consensus WD40 repeat protein [General function pr 98.04
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.99
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 97.98
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 97.96
KOG12751118 consensus PAB-dependent poly(A) ribonuclease, subu 97.94
KOG2695425 consensus WD40 repeat protein [General function pr 97.89
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 97.86
PRK02888635 nitrous-oxide reductase; Validated 97.84
KOG12751118 consensus PAB-dependent poly(A) ribonuclease, subu 97.84
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 97.83
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 97.79
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.79
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 97.79
KOG3621726 consensus WD40 repeat-containing protein [General 97.76
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.72
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 97.7
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 97.67
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 97.66
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 97.58
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.58
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.56
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 97.55
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.54
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 97.54
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 97.46
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 97.45
KOG1008783 consensus Uncharacterized conserved protein, conta 97.43
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.36
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.3
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.3
KOG18971096 consensus Damage-specific DNA binding complex, sub 97.28
COG3391381 Uncharacterized conserved protein [Function unknow 97.17
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.1
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.06
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 97.05
KOG3621726 consensus WD40 repeat-containing protein [General 97.03
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 96.95
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 96.88
COG0823425 TolB Periplasmic component of the Tol biopolymer t 96.86
KOG1008783 consensus Uncharacterized conserved protein, conta 96.83
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.82
COG0823425 TolB Periplasmic component of the Tol biopolymer t 96.77
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 96.76
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 96.69
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 96.67
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 96.6
PRK02888635 nitrous-oxide reductase; Validated 96.54
COG3391381 Uncharacterized conserved protein [Function unknow 96.53
TIGR03074764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 96.42
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 96.4
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 96.39
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.38
KOG4640665 consensus Anaphase-promoting complex (APC), subuni 96.34
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.19
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 96.17
COG3386307 Gluconolactonase [Carbohydrate transport and metab 96.05
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.86
PRK13616591 lipoprotein LpqB; Provisional 95.78
KOG4640665 consensus Anaphase-promoting complex (APC), subuni 95.62
KOG2395644 consensus Protein involved in vacuole import and d 95.5
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 95.4
COG3386307 Gluconolactonase [Carbohydrate transport and metab 95.35
PRK10115686 protease 2; Provisional 95.33
COG3490366 Uncharacterized protein conserved in bacteria [Fun 95.29
PRK13616591 lipoprotein LpqB; Provisional 95.26
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 95.25
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 95.23
KOG20791206 consensus Vacuolar assembly/sorting protein VPS8 [ 95.2
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 95.2
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 95.07
KOG20791206 consensus Vacuolar assembly/sorting protein VPS8 [ 94.65
KOG18981205 consensus Splicing factor 3b, subunit 3 [RNA proce 94.46
KOG18971096 consensus Damage-specific DNA binding complex, sub 94.38
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 94.35
PHA02713557 hypothetical protein; Provisional 93.91
COG3490366 Uncharacterized protein conserved in bacteria [Fun 93.86
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 93.81
COG3204316 Uncharacterized protein conserved in bacteria [Fun 93.71
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 93.66
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 93.55
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 93.52
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 93.49
PHA02713557 hypothetical protein; Provisional 93.4
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 93.37
KOG2395644 consensus Protein involved in vacuole import and d 93.25
KOG2444238 consensus WD40 repeat protein [General function pr 93.13
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 93.05
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 92.89
COG3204316 Uncharacterized protein conserved in bacteria [Fun 92.88
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 92.86
KOG2444238 consensus WD40 repeat protein [General function pr 92.63
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 92.46
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 92.4
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 92.29
TIGR03074764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 91.74
PRK13684334 Ycf48-like protein; Provisional 91.5
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 90.35
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 90.26
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 89.9
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 89.39
PF14727418 PHTB1_N: PTHB1 N-terminus 89.34
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 89.33
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 89.04
PLN00033398 photosystem II stability/assembly factor; Provisio 89.01
PF15390671 DUF4613: Domain of unknown function (DUF4613) 88.09
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 88.01
PF08728717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 87.84
KOG19161283 consensus Nuclear protein, contains WD40 repeats [ 87.63
PRK13684334 Ycf48-like protein; Provisional 87.61
KOG19161283 consensus Nuclear protein, contains WD40 repeats [ 87.14
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 87.12
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 87.1
PRK10115686 protease 2; Provisional 86.57
PHA03098534 kelch-like protein; Provisional 86.47
PHA03098534 kelch-like protein; Provisional 86.3
PF15390671 DUF4613: Domain of unknown function (DUF4613) 86.11
COG5167776 VID27 Protein involved in vacuole import and degra 85.42
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 84.69
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 84.65
KOG18981205 consensus Splicing factor 3b, subunit 3 [RNA proce 83.9
COG5276370 Uncharacterized conserved protein [Function unknow 83.53
KOG2377657 consensus Uncharacterized conserved protein [Funct 83.32
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 81.95
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 81.19
PHA02790480 Kelch-like protein; Provisional 80.49
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 80.24
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=6.5e-96  Score=867.80  Aligned_cols=618  Identities=63%  Similarity=0.972  Sum_probs=521.9

Q ss_pred             cchhHHHHHHHHHhccCcchhHHHHHHHHHHhhcCChhhHHHHHhhcCCCCCCCCCCCccchhcHHHHHHHCCCCChHHH
Q 000454           47 VDLREVYFLIMHFLSTGPCHRTYGQFWNELLEHQLLPRRYHAWYSRSGLPSGDENDDGMSFPLSYNKLVERYPHIEKDHL  126 (1491)
Q Consensus        47 ~~~~e~~flI~hfL~~gp~~~aa~~L~~el~~~~~Lp~r~~~Wle~l~l~~~~~~~~G~~~~~~~~~L~~~~~~i~~~~L  126 (1491)
                      +|++|+||||.|||+.|||.+++++|+.|++++++||.|+++|.             +..+...++.|+..|+||.++||
T Consensus        13 l~lsevyflil~~lS~gPcert~~vl~~elee~~ll~pr~~~W~-------------sn~~~dd~eslvls~~hI~kdhl   79 (1113)
T KOG0644|consen   13 LDLSEVYFLILHYLSAGPCERTAQVLRQELEEYSLLPPRYHDWE-------------SNSGNDDGESLVLSYKHIAKDHL   79 (1113)
T ss_pred             cchhhHHHHHHhhcccCchhhcchhhhhhhhhhhccCccccccc-------------cCCCCcccceeeccccccchHHH
Confidence            68999999999999999999999999999999999999999994             44555566777777999999999


Q ss_pred             HHHHHHHHHccCCCcccccCCCCCC---CCcccccccCCcccccccccccCCCccCCCCCCCCCCCCCcccccccccccc
Q 000454          127 VKLLKQLIINTSSPSRAMIGGDAPN---AADVPTLLGRGSFSLLSYDRDKGQNEIDHPPAHMRWPHMYADQVRGLGLREI  203 (1491)
Q Consensus       127 l~~l~r~i~~~~~~i~~~~~~~~P~---~~~vsaLlg~g~~SLl~~~~~~~~~~~~~p~~~~r~p~~h~d~V~~l~~r~~  203 (1491)
                      |++|+||+.-.       ..+++|.   ++.|++|||+|+|||++....+...  +.++..++||+||++||+++.++..
T Consensus        80 l~i~kqlv~~~-------d~~~pp~~~~~a~vpTlLgtg~qsLl~r~k~~~~~--~~~~s~~~~~h~~~~~~~~~sl~s~  150 (1113)
T KOG0644|consen   80 LQILKQLVPML-------DKPIPPRYCTIARVPTLLGTGRQSLLRRAKDIRHT--VWKGSAFRWPHMHADQVRGVSLRSI  150 (1113)
T ss_pred             HHHHHHhccCc-------CCCCCcceeeeecccchhcchhHHHHhhhhhcccc--cccccccccccccCcccccceeccC
Confidence            99999996322       2345776   8899999999999999998877644  5566899999999999999999999


Q ss_pred             cCccccccCCCcceeeeccccCCCcccccceeEEEEccCCCCEEEEEEcCCCCEEEEEeCCCeEEEEECCCCeEEEEEec
Q 000454          204 GGGFTRHHRAPSIRAACYAIAKPSTMVQKMQNIKRVRGHRNAVYCAIFDRSGRYVITGSDDRLVKIWSMETAYCLASCRG  283 (1491)
Q Consensus       204 Gg~~~~~~~~~sl~s~~~~~a~~~~~v~t~k~v~tL~GH~~~Vt~VaFSpDG~~LATGS~DGtIrIWDl~Tg~~l~tL~g  283 (1491)
                      |++|..|++++++.++|+.+++|..++++++.++.|.||.++|+|++|+..|.+|+||++|..|+||.++++.++..++|
T Consensus       151 ~~~~~~h~~a~~i~~at~~~akPgtmvqkmk~ikrLlgH~naVyca~fDrtg~~Iitgsdd~lvKiwS~et~~~lAs~rG  230 (1113)
T KOG0644|consen  151 GGGFEIHHRAPSIGCATFSIAKPGTMVQKMKNIKRLLGHRNAVYCAIFDRTGRYIITGSDDRLVKIWSMETARCLASCRG  230 (1113)
T ss_pred             CcchhhhhcCcccccceeeecCcHHHHHHHHHHHHHHhhhhheeeeeeccccceEeecCccceeeeeeccchhhhccCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCeEEEEEcCCCCEEEEEECCCeEEEEECCCCCceeeeccCCCceEEEEecCCCCceEEEEEEeCCCcEEEEccCCCC
Q 000454          284 HEGDITDLAVSSNNALVASASNDCIIRVWRLPDGLPISVLRGHTAAVTAIAFSPRPGSVYQLLSSSDDGTCRIWDARYSQ  363 (1491)
Q Consensus       284 H~~~VtsLafSPDG~lLASGS~DGtIrVWDl~tgk~i~~L~gHs~~VtsLaFSPdg~s~~~LaSgS~DGtVrIWDl~tg~  363 (1491)
                      |.+.|+.++.+.++.++|+++.|..|+||.+.++.++.++.+|++.|++|+|+|-       .+.+.||++++||.+   
T Consensus       231 hs~ditdlavs~~n~~iaaaS~D~vIrvWrl~~~~pvsvLrghtgavtaiafsP~-------~sss~dgt~~~wd~r---  300 (1113)
T KOG0644|consen  231 HSGDITDLAVSSNNTMIAAASNDKVIRVWRLPDGAPVSVLRGHTGAVTAIAFSPR-------ASSSDDGTCRIWDAR---  300 (1113)
T ss_pred             CccccchhccchhhhhhhhcccCceEEEEecCCCchHHHHhccccceeeeccCcc-------ccCCCCCceEecccc---
Confidence            9999999999999999999999999999999999999999999999999999995       378899999999998   


Q ss_pred             ccceeecCCCCCcccCCCCCCCCCCCCCCcceEEEEECCCCCEEEEecCCceEEEEeCCCCCCCCCCCCCceeeeecCCC
Q 000454          364 FSPRIYIPRPSDAVAGRNMAPSSSAGPQSHQIFCCAFNANGTVFVTGSSDTLARVWNACKPNTDDSDQPNHEIDVLSGHE  443 (1491)
Q Consensus       364 ~~~~i~~~~~~~~~~g~~~~~~~s~~~h~~~V~slafSPDG~~LasGs~DG~IrVWDl~t~~~~~s~~~~~~i~~l~gH~  443 (1491)
                      +...++.|.+....             ....+.++.|-..+.-+++|+.|+....|.+..               +..+.
T Consensus       301 ~~~~~y~prp~~~~-------------~~~~~~s~~~~~~~~~f~Tgs~d~ea~n~e~~~---------------l~~~~  352 (1113)
T KOG0644|consen  301 LEPRIYVPRPLKFT-------------EKDLVDSILFENNGDRFLTGSRDGEARNHEFEQ---------------LAWRS  352 (1113)
T ss_pred             ccccccCCCCCCcc-------------cccceeeeeccccccccccccCCcccccchhhH---------------hhhhc
Confidence            34444444433222             223455556666666666776666665554421               01111


Q ss_pred             CCceEEEEccCccccccccccCCCCCCCccccccccCCCeEEEEeCCCeEEEEecCCCCCCccccccccccccCCCCCCC
Q 000454          444 NDVNYVQFSGCAVASRFSLADSSKEDSTPKFKNSWFCHDNIVTCSRDGSAIIWIPRSRRSHPKAARWTQAYHLKVPPPPM  523 (1491)
Q Consensus       444 ~~V~sVafSpdg~as~~s~~~~~~~~~~~~~~~~~~~~~~LaSgS~DGtIrIWDl~s~k~~~~~~~~~~~~~l~~~~~~~  523 (1491)
                      ..+                                    .+++.+.|                                 
T Consensus       353 ~~l------------------------------------if~t~ssd---------------------------------  363 (1113)
T KOG0644|consen  353 NLL------------------------------------IFVTRSSD---------------------------------  363 (1113)
T ss_pred             cce------------------------------------EEEecccc---------------------------------
Confidence            000                                    11111110                                 


Q ss_pred             CCCCCCCCCceeccCCCCCeeEEEEcCCCCEEEEEeccceEEEEECCCCceEEEEeCCCCCeEEEEEecCCCcEEEEEeC
Q 000454          524 PPQPPRGGPRQRILPTPRGVNMIVWSLDNRFVLAAIMDCRICVWNAADGSLVHSLTGHTESTYVLDVHPFNPRIAMSAGY  603 (1491)
Q Consensus       524 ~~~~~~~~~~~~l~~h~~~VtsVafSPDG~~LaSGs~DG~IrIWDl~tgkll~tL~gHs~~VtsLafSPdd~~lLaSgS~  603 (1491)
                                                 -..+.+++-.+..+++|++.+|.+++.+.+|...++.+.+||+++++..++++
T Consensus       364 ---------------------------~~~~~~~ar~~~~~~vwnl~~g~l~H~l~ghsd~~yvLd~Hpfn~ri~msag~  416 (1113)
T KOG0644|consen  364 ---------------------------LSSIVVTARNDHRLCVWNLYTGQLLHNLMGHSDEVYVLDVHPFNPRIAMSAGY  416 (1113)
T ss_pred             ---------------------------ccccceeeeeeeEeeeeecccchhhhhhcccccceeeeeecCCCcHhhhhccC
Confidence                                       01355666678889999999999999999999999999999999999999999


Q ss_pred             CCcEEEEeCCCCceEEEEeeCCcceEEEEEcCCCCEEEEEeCCCcEEEEECCCCcccccccceeeecCCCcceEEccCCC
Q 000454          604 DGKTIVWDIWEGIPIRIYEISRFRLVDGKFSPDGASIILSDDVGQLYILNTGQGESQKDAKYDQFFLGDYRPLVQDTYGN  683 (1491)
Q Consensus       604 DGtIrIWDl~tGk~l~~l~~h~~~VtslafSPDG~~LAsgs~DG~I~IWdl~tG~~~~~~~~~~~fs~D~r~La~d~~G~  683 (1491)
                      ||.+.|||+..|.+++.+..+++.+.+.+||+||+.++..+..|+++|+.++.++.+...++.+||..||++|+.+.+|+
T Consensus       417 dgst~iwdi~eg~pik~y~~gh~kl~d~kFSqdgts~~lsd~hgql~i~g~gqs~s~k~ak~dqffl~dyrplirdTn~~  496 (1113)
T KOG0644|consen  417 DGSTIIWDIWEGIPIKHYFIGHGKLVDGKFSQDGTSIALSDDHGQLYILGTGQSKSQKKAKYDQFFLGDYRPLIRDTNGY  496 (1113)
T ss_pred             CCceEeeecccCCcceeeecccceeeccccCCCCceEecCCCCCceEEeccCCCccccccccceEeecCcccccccccch
Confidence            99999999999999999998899999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEccccccCccccCCCccccccCCCCCCcchhhhhhcccccccEEEcCCCCeEEEeeCCCCCCcEEeccCCCccccccC
Q 000454          684 VLDQETQLAPHRRNLQDPLCDSAMIPYPEPYQTMYQQRRLGALGIEWRPSSLKLAVGPDFSLDQGYQLQPLADLDVMIDP  763 (1491)
Q Consensus       684 vLde~tq~~p~Lw~l~~~l~d~s~~p~p~~~q~l~q~~~~~vl~lafSPDG~~LAvg~d~s~d~~v~lw~~~~~~~liep  763 (1491)
                      |+|++||+.|| .++++++|+..++|||++||+++|+++++++                               ++++.|
T Consensus       497 vldqeTq~~ph-~~~p~~l~ds~~iphpe~yqtl~q~rr~sa~-------------------------------dh~mp~  544 (1113)
T KOG0644|consen  497 VLDQETQLAPH-RNPPDFLCDSDMIPHPEPYQTLFQGRRLSAL-------------------------------DHLMPP  544 (1113)
T ss_pred             hhhhHhhhccc-cCCCCceeccCCCcCCchhhhcccccccchh-------------------------------hhcCCc
Confidence            99999999999 5669999999999999999999988775554                               334444


Q ss_pred             CcccccccccccCCcCCCCCCCccccccccccccccCCCCCCCCCCCCCCcCCcCCCCCCCCcchhhHhhhhhhhhheec
Q 000454          764 LPEFIDVMDWEPENEVQSDDNDSEYNVAEEYSTEEKGSLSSTSSGDSECSAEDSEDGENPMDGLRRSKRKKQKAEVEIMT  843 (1491)
Q Consensus       764 lp~~i~~~~W~P~~ev~s~d~~~~~~~~e~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  843 (1491)
                      + ++++.|+|+|+.+|++++++++|+-+.+++                                                
T Consensus       545 l-~fia~~~~E~e~~Vls~~nds~~~~~~es~------------------------------------------------  575 (1113)
T KOG0644|consen  545 L-EFIATMDWEPEEQVLSDQNDSEYNRSPESL------------------------------------------------  575 (1113)
T ss_pred             c-cchhhhccccchhhhhhcccccccCCcccc------------------------------------------------
Confidence            4 889999999999999999998887644410                                                


Q ss_pred             cccccccccccccccCCcccCCCcccccCccccccccccccccccchHHHHHHHHhhhhhhhcCcCCCCC
Q 000454          844 SSGRRVKRRILDESEGNAAFGNKRTRKSGNRQKSSRRKSSTSKSLRPQRAAARNARSFFSKITGASTDGE  913 (1491)
Q Consensus       844 ~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~  913 (1491)
                                 ++.++- ..+..|.++.|-+.|.+|+++.++|+++|+|+++|||+..|+++++++-+.+
T Consensus       576 -----------seldg~-isq~krt~n~r~g~k~s~~~hg~s~ss~~~R~~~Rn~~~~isk~sg~~~~~~  633 (1113)
T KOG0644|consen  576 -----------SELDGM-ISQLKRTQNQRMGAKQSKRKHGLSKSSRPPRAAARNASSDISKISGISLDRK  633 (1113)
T ss_pred             -----------hhhhhh-hhhhhhhhccccccchhhccCCCCccccCCcccccccchhhccCCCcccccc
Confidence                       222222 2333444556777888888999999999999888888888877777766543



>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1898 consensus Splicing factor 3b, subunit 3 [RNA processing and modification] Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>KOG1898 consensus Splicing factor 3b, subunit 3 [RNA processing and modification] Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2377 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1491
2ymu_A577 Structure Of A Highly Repetitive Propeller Structur 1e-13
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 1e-11
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 2e-05
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 1e-11
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 2e-05
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 2e-11
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 5e-05
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 2e-11
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 5e-05
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 2e-11
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 2e-06
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 5e-05
2g99_A308 Structural Basis For The Specific Recognition Of Me 2e-11
2g99_A308 Structural Basis For The Specific Recognition Of Me 5e-05
2g9a_A311 Structural Basis For The Specific Recognition Of Me 2e-11
2g9a_A311 Structural Basis For The Specific Recognition Of Me 5e-05
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 2e-11
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 5e-05
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 2e-11
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 5e-05
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 3e-11
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 6e-05
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 3e-11
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 6e-05
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 3e-11
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 6e-05
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 3e-11
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 6e-05
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 3e-11
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 6e-05
2h9l_A329 Wdr5delta23 Length = 329 3e-11
2h9l_A329 Wdr5delta23 Length = 329 6e-05
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 3e-11
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 7e-05
2gnq_A336 Structure Of Wdr5 Length = 336 4e-11
2gnq_A336 Structure Of Wdr5 Length = 336 7e-05
2ovp_B445 Structure Of The Skp1-Fbw7 Complex Length = 445 1e-10
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 5e-10
3dm0_A694 Maltose Binding Protein Fusion With Rack1 From A. T 2e-09
3shf_A1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 7e-08
3shf_A1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 1e-06
3sfz_A1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 7e-08
3sfz_A1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 1e-06
3mks_B464 Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH 2e-07
3mks_B464 Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH 5e-05
3fm0_A345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 2e-07
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 3e-07
3sn6_B351 Crystal Structure Of The Beta2 Adrenergic Receptor- 3e-07
1a0r_B340 Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA- 3e-07
1got_B340 Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimer 3e-07
2bcj_B340 Crystal Structure Of G Protein-coupled Receptor Kin 3e-07
1gg2_B340 G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet 3e-07
1nex_B464 Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Comp 5e-07
1nex_B464 Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Comp 2e-04
2hes_X330 Cytosolic Iron-sulphur Assembly Protein- 1 Length = 8e-07
2pbi_B354 The Multifunctional Nature Of Gbeta5RGS9 REVEALED F 1e-06
1p22_A435 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 1e-06
1p22_A435 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 7e-05
3jro_A753 Nup84-Nup145c-Sec13 Edge Element Of The Npc Lattice 2e-06
3jrp_A379 Sec13 With Nup145c (Aa109-179) Insertion Blade Leng 4e-06
2pm9_B297 Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT O 6e-06
2pm6_B297 Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF 7e-06
3mkq_A814 Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subco 7e-06
3rfh_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 7e-06
4gqb_B344 Crystal Structure Of The Human Prmt5:mep50 Complex 8e-06
2ynp_A604 Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 1e-05
2yno_A310 Yeast Betaprime Cop 1-304h6 Length = 310 1e-05
2ynn_A304 Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 1e-05
3zey_7318 High-resolution Cryo-electron Microscopy Structure 2e-05
3iz6_a380 Localization Of The Small Subunit Ribosomal Protein 3e-05
3rfg_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 3e-05
3jyv_R313 Structure Of The 40s Rrna And Proteins And PE TRNA 3e-05
3izb_a319 Localization Of The Small Subunit Ribosomal Protein 3e-05
2pm7_B297 Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF 7e-05
1trj_A314 Homology Model Of Yeast Rack1 Protein Fitted Into 1 1e-04
2aq5_A402 Crystal Structure Of Murine Coronin-1 Length = 402 1e-04
2b4e_A402 Crystal Structure Of Murine Coronin-1: Monoclinic F 1e-04
3frx_A319 Crystal Structure Of The Yeast Orthologue Of Rack1, 3e-04
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure

Iteration: 1

Score = 76.3 bits (186), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 106/476 (22%), Positives = 184/476 (38%), Gaps = 84/476 (17%) Query: 234 QNIKRVRGHRNAVYCAIFDRSGRYVITGSDDRLVKIWSMETAYCLASCRGHEGDITDXXX 293 Q ++ + GH ++V+ F G+ + + SDD+ VK+W+ L + GH + Sbjct: 48 QLLQTLTGHSSSVWGVAFSPDGQTIASASDDKTVKLWN-RNGQLLQTLTGHSSSVRGVAF 106 Query: 294 XXXXXXXXXXXXDCIIRVWRLPDGLPISVLRGHTAAVTAIAFSPRPGSVYQLLSSSDDGT 353 D +++W +G + L GH+++V +AFSP ++ S+SDD T Sbjct: 107 SPDGQTIASASDDKTVKLWN-RNGQLLQTLTGHSSSVWGVAFSPDGQTIA---SASDDKT 162 Query: 354 CRIWDARYSQ----------------FSP-RIYIPRPSD----AVAGRNMAPSSSAGPQS 392 ++W+ R Q FSP I SD + RN + S Sbjct: 163 VKLWN-RNGQLLQTLTGHSSSVWGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHS 221 Query: 393 HQIFCCAFNANGTVFVTGSSDTLARVWNACKPNTDDSDQPNHEIDVLSGHENDVNYVQF- 451 + AF+ +G + S D ++WN + + L+GH + VN V F Sbjct: 222 SSVRGVAFSPDGQTIASASDDKTVKLWN----------RNGQLLQTLTGHSSSVNGVAFR 271 Query: 452 -SGCAVASRFSLADSSKEDSTPKFKNS---------------W---FCHD--NIVTCSRD 490 G +A S+ +D T K N W F D I + S D Sbjct: 272 PDGQTIA-------SASDDKTVKLWNRNGQLLQTLTGHSSSVWGVAFSPDGQTIASASDD 324 Query: 491 GSAIIWIPRSRRSHP----KAARWTQAYH---LKVXXXXXXXXXXXXXXXXXILPTPRG- 542 + +W + ++ W A+ + +L T G Sbjct: 325 KTVKLWNRNGQHLQTLTGHSSSVWGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGH 384 Query: 543 ---VNMIVWSLDNRFVLAAIMDCRICVWNAADGSLVHSLTGHTESTYVLDVHPFNPRIAM 599 V + +S D + + +A D + +WN +G L+ +LTGH+ S + + P + IA Sbjct: 385 SSSVRGVAFSPDGQTIASASDDKTVKLWN-RNGQLLQTLTGHSSSVWGVAFSPDDQTIAS 443 Query: 600 SAGYDGKTIVWDIW--EGIPIRIYEISRFRLVDGKFSPDGASIILSDDVGQLYILN 653 ++ D KT+ +W G ++ + FSPDG +I + D + + N Sbjct: 444 AS--DDKTV--KLWNRNGQLLQTLTGHSSSVRGVAFSPDGQTIASASDDKTVKLWN 495
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana Length = 694 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|3MKS|B Chain B, Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH AN ALLOSTERIC Inhibitor Scf-I2 Length = 464 Back     alignment and structure
>pdb|3MKS|B Chain B, Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH AN ALLOSTERIC Inhibitor Scf-I2 Length = 464 Back     alignment and structure
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|3SN6|B Chain B, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 351 Back     alignment and structure
>pdb|1A0R|B Chain B, Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA-Gamma Length = 340 Back     alignment and structure
>pdb|1GOT|B Chain B, Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimera And The Gt-Beta-Gamma Subunits Length = 340 Back     alignment and structure
>pdb|2BCJ|B Chain B, Crystal Structure Of G Protein-coupled Receptor Kinase 2 In Complex With Galpha-q And Gbetagamma Subunits Length = 340 Back     alignment and structure
>pdb|1GG2|B Chain B, G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Beta_1 Gamma_2 With Gdp Bound Length = 340 Back     alignment and structure
>pdb|1NEX|B Chain B, Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Complex Length = 464 Back     alignment and structure
>pdb|1NEX|B Chain B, Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Complex Length = 464 Back     alignment and structure
>pdb|2HES|X Chain X, Cytosolic Iron-sulphur Assembly Protein- 1 Length = 330 Back     alignment and structure
>pdb|2PBI|B Chain B, The Multifunctional Nature Of Gbeta5RGS9 REVEALED FROM ITS CRYSTAL Structure Length = 354 Back     alignment and structure
>pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 435 Back     alignment and structure
>pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 435 Back     alignment and structure
>pdb|3JRO|A Chain A, Nup84-Nup145c-Sec13 Edge Element Of The Npc Lattice Length = 753 Back     alignment and structure
>pdb|3JRP|A Chain A, Sec13 With Nup145c (Aa109-179) Insertion Blade Length = 379 Back     alignment and structure
>pdb|2PM9|B Chain B, Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT OF THE Copii Vesicular Coat Length = 297 Back     alignment and structure
>pdb|2PM6|B Chain B, Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF THE Copii Vesicular Coat, Native Version Length = 297 Back     alignment and structure
>pdb|3MKQ|A Chain A, Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subcomplex Of The Copi Vesicular Coat Length = 814 Back     alignment and structure
>pdb|3RFH|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P21 Length = 319 Back     alignment and structure
>pdb|4GQB|B Chain B, Crystal Structure Of The Human Prmt5:mep50 Complex Length = 344 Back     alignment and structure
>pdb|2YNP|A Chain A, Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 604 Back     alignment and structure
>pdb|2YNO|A Chain A, Yeast Betaprime Cop 1-304h6 Length = 310 Back     alignment and structure
>pdb|2YNN|A Chain A, Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 304 Back     alignment and structure
>pdb|3ZEY|7 Chain 7, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 318 Back     alignment and structure
>pdb|3IZ6|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 380 Back     alignment and structure
>pdb|3RFG|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P63 Length = 319 Back     alignment and structure
>pdb|3JYV|R Chain R, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 313 Back     alignment and structure
>pdb|3IZB|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 319 Back     alignment and structure
>pdb|2PM7|B Chain B, Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF THE Copii Vesicular Coat, Selenomethionine Version Length = 297 Back     alignment and structure
>pdb|1TRJ|A Chain A, Homology Model Of Yeast Rack1 Protein Fitted Into 11.7a Cryo-em Map Of Yeast 80s Ribosome Length = 314 Back     alignment and structure
>pdb|2AQ5|A Chain A, Crystal Structure Of Murine Coronin-1 Length = 402 Back     alignment and structure
>pdb|2B4E|A Chain A, Crystal Structure Of Murine Coronin-1: Monoclinic Form Length = 402 Back     alignment and structure
>pdb|3FRX|A Chain A, Crystal Structure Of The Yeast Orthologue Of Rack1, Asc1. Length = 319 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1491
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 4e-32
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 7e-23
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 7e-18
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 5e-15
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-11
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 1e-26
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 2e-15
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 2e-09
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 3e-08
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 6e-05
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 6e-25
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-23
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 4e-21
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-15
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-13
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 8e-11
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 8e-24
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 2e-20
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 2e-17
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 9e-16
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 3e-11
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 1e-21
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 6e-17
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 3e-07
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 3e-05
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 1e-20
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 3e-18
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 6e-20
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 4e-13
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 5e-13
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 3e-12
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-07
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-07
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 5e-06
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 1e-19
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 1e-09
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 2e-08
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 3e-08
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 6e-06
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 1e-18
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 1e-08
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 2e-08
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 2e-07
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 6e-07
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 2e-06
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-17
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-12
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-08
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 4e-07
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 3e-17
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 9e-16
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 8e-13
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-07
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 8e-17
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 3e-10
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 3e-09
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 3e-16
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 4e-13
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 1e-09
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 1e-07
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 9e-07
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 1e-04
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 0.001
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 2e-14
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 2e-09
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 3e-09
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 4e-14
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-11
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 5e-05
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-12
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-09
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 7e-08
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-05
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 2e-10
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 3e-10
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 0.004
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 1e-09
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 3e-05
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 3e-09
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 8e-09
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 3e-08
d1qksa2432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 1e-08
d1qksa2432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 3e-04
d1ri6a_333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 2e-06
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 1e-05
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 3e-05
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 7e-04
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]
 Score =  126 bits (316), Expect = 4e-32
 Identities = 69/372 (18%), Positives = 130/372 (34%), Gaps = 68/372 (18%)

Query: 240 RGHRNAVYCAIFDRSGRYVITGSDDRLVKIWSMETAYCLASCRGHEGDITDLAVSSNNAL 299
            GHR+ V   IF      +++ S+D  +K+W  ET     + +GH   + D++   +  L
Sbjct: 14  SGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKL 73

Query: 300 VASASNDCIIRVWRLPDGLPISVLRGHTAAVTAIAFSPRPGSVYQLLSSSDDGTCRIWDA 359
           +AS S D  I++W       I  + GH   V++++  P       ++S+S D T ++W+ 
Sbjct: 74  LASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVSIMPNG---DHIVSASRDKTIKMWEV 130

Query: 360 RYSQFSPRIYIPRPSDAVAGRNMAPSSSAGPQSHQIFCCAFNANGTVFVTGSSDTLARVW 419
           +                                  +     N +GT+  + S+D   RVW
Sbjct: 131 QTGYCVKTFT--------------------GHREWVRMVRPNQDGTLIASCSNDQTVRVW 170

Query: 420 NACKPNTDDSDQPNHEIDVLSGHENDVNYVQFSGCAVASRFSLADSSKEDSTPKFKNSWF 479
                              L  H + V  + ++  +  S  S A  S+       K S  
Sbjct: 171 VV---------ATKECKAELREHRHVVECISWAPESSYSSISEATGSE------TKKSGK 215

Query: 480 CHDNIVTCSRDGSAIIWIPRSRRSHPKAARWTQAYHLKVPPPPMPPQPPRGGPRQRILPT 539
               +++ SRD +  +W   +                             G     ++  
Sbjct: 216 PGPFLLSGSRDKTIKMWDVST-----------------------------GMCLMTLVGH 246

Query: 540 PRGVNMIVWSLDNRFVLAAIMDCRICVWNAADGSLVHSLTGHTESTYVLDVHPFNPRIAM 599
              V  +++    +F+L+   D  + VW+  +   + +L  H      LD H   P +  
Sbjct: 247 DNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVV- 305

Query: 600 SAGYDGKTIVWD 611
           +   D    VW+
Sbjct: 306 TGSVDQTVKVWE 317


>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1491
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 100.0
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 100.0
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 100.0
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 100.0
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 100.0
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 100.0
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 100.0
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 100.0
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 100.0
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.97
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.97
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.96
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.96
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.96
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.93
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.92
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.92
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.92
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.9
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.89
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.89
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.85
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.84
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.8
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.8
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.72
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.68
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.49
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.44
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.44
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.37
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.35
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.35
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.34
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.33
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.28
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.21
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.21
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.18
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.12
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.04
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.94
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.89
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.65
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.5
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.44
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 98.3
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.29
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 98.28
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 98.25
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 98.18
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 97.96
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 97.58
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 97.44
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 97.33
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 97.23
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 97.09
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 96.9
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 96.48
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 96.38
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 96.05
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 95.9
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 95.24
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 95.07
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 95.05
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 94.5
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 93.96
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 93.87
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 89.34
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 82.02
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00  E-value=0  Score=313.72  Aligned_cols=311  Identities=20%  Similarity=0.319  Sum_probs=275.4

Q ss_pred             CEEEEEECCCCCCEEEEEECCCCCEEEEEECCCEEEEEECCCCEEEEEEECCCCCEEEEEECCCCCEEEEEECCCEEEEE
Q ss_conf             30589981679878999996899999999089769999878891889970689996999995799999999799819999
Q 000454          233 MQNIKRVRGHRNAVYCAIFDRSGRYVITGSDDRLVKIWSMETAYCLASCRGHEGDITDLAVSSNNALVASASNDCIIRVW  312 (1491)
Q Consensus       233 ~k~i~tL~GH~~~VtsIaFSpDGk~LATGS~DGtIkIWDl~Tg~~l~tL~gH~~~ItsIafSPDg~lLASGS~DGtIrIW  312 (1491)
                      ....++|+||.++|++|+|+|++++||||+.||+|+|||+.+++++.++.+|...|.+++|++++.+++++..++.+.+|
T Consensus         7 ~~~~~~L~GH~~~I~~l~~sp~~~~l~s~s~Dg~i~iWd~~~~~~~~~~~~h~~~V~~~~~~~~~~~~~~~~~~~~~~~~   86 (317)
T d1vyhc1           7 PPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLW   86 (317)
T ss_dssp             SSCSCEEECCSSCEEEEEECSSSSEEEEEESSSCEEEEETTTCCCCEEECCCSSCEEEEEECTTSSEEEEEETTSCCCEE
T ss_pred             CCCCEEECCCCCCEEEEEECCCCCEEEEEECCCEEEEEECCCCCEEEEEECCCCCEEEEEEECCCCCCCCCCCCCCCCCC
T ss_conf             98448985888876899993898999999389929999899997999995788867777630111101111111110111


Q ss_pred             ECCCCCCEEEECCCCCCEEEEEECCCCCCEEEEEEEECCCCEEEECCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             79999860331267775599995379995079999928991999706778765425137999732488878888899999
Q 000454          313 RLPDGLPISVLRGHTAAVTAIAFSPRPGSVYQLLSSSDDGTCRIWDARYSQFSPRIYIPRPSDAVAGRNMAPSSSAGPQS  392 (1491)
Q Consensus       313 Dl~tgk~i~~L~gHs~~VtsIafSPdg~s~~~LiSgS~DGtIrIWDl~tg~~i~~i~~~~~~~~~~g~~~~~~~~~~~h~  392 (1491)
                      +.........+.+|...+.++.|++++.   .+++++.|+.+++|++.++.....+.                    .+.
T Consensus        87 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~d~~~~~~~~~~~~~~~~~~--------------------~~~  143 (317)
T d1vyhc1          87 DFQGFECIRTMHGHDHNVSSVSIMPNGD---HIVSASRDKTIKMWEVQTGYCVKTFT--------------------GHR  143 (317)
T ss_dssp             ETTSSCEEECCCCCSSCEEEEEECSSSS---EEEEEETTSEEEEEETTTCCEEEEEE--------------------CCS
T ss_pred             CCCCCCCCCCCCCCCCCCEEEECCCCCC---EEEEECCCCCEEEEECCCCEEEEEEC--------------------CCC
T ss_conf             0011111111000000000000169985---57765267523575114430346871--------------------677


Q ss_pred             CCEEEEEECCCCCEEEEECCCCEEEEEECCCCCCCCCCCCCCEEEEECCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             63289998779988999308951999808999998999998402210488898107998267512223335688788886
Q 000454          393 HQIFCCAFNANGTVFVTGSSDTLARVWNACKPNTDDSDQPNHEIDVLSGHENDVNYVQFSGCAVASRFSLADSSKEDSTP  472 (1491)
Q Consensus       393 ~~V~sIafSPDG~~LasGs~DG~IrIWDl~t~~~~~s~~~~~~i~~l~gH~~~V~sIafSpdg~as~~s~~~~~~~~~~~  472 (1491)
                      ..+.+++|++++.+|++++.|+.|++|++..         ......+.+|...+.++.|.|.....              
T Consensus       144 ~~~~~~~~~~~~~~l~~~~~d~~v~~~~~~~---------~~~~~~~~~~~~~i~~~~~~~~~~~~--------------  200 (317)
T d1vyhc1         144 EWVRMVRPNQDGTLIASCSNDQTVRVWVVAT---------KECKAELREHRHVVECISWAPESSYS--------------  200 (317)
T ss_dssp             SCEEEEEECTTSSEEEEEETTSCEEEEETTT---------CCEEEEECCCSSCEEEEEECCSCGGG--------------
T ss_pred             CCCEEEECCCCCCEEEEEECCCEEEEEEECC---------CEEEEEEECCCCCCEEEEEEECCCCC--------------
T ss_conf             7630000166799999992798299975125---------40347882477873379986325641--------------


Q ss_pred             CCCCCCCCCCEEEEEECCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCEEEEEECCCC
Q ss_conf             45555567880899927980999926888888532221111245799999999999999940006999972299994799
Q 000454          473 KFKNSWFCHDNIVTCSRDGSAIIWIPRSRRSHPKAARWTQAYHLKVPPPPMPPQPPRGGPRQRILPTPRGVNMIVWSLDN  552 (1491)
Q Consensus       473 ~~~~~~~~~~~LvSgS~DGtIrIWDl~s~k~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~l~~h~~~VtsIafSPDG  552 (1491)
                                  ...                                                   .........+...+
T Consensus       201 ------------~~~---------------------------------------------------~~~~~~~~~~~~~~  217 (317)
T d1vyhc1         201 ------------SIS---------------------------------------------------EATGSETKKSGKPG  217 (317)
T ss_dssp             ------------GGG---------------------------------------------------GCCSCC-------C
T ss_pred             ------------EEE---------------------------------------------------CCCCCEEEEECCCC
T ss_conf             ------------110---------------------------------------------------34563034302588


Q ss_pred             CEEEEEECCCEEEEEECCCCCEEEEEECCCCCEEEEEEECCCCCEEEEEECCCCEEEEECCCCCEEEEEEECCCCEEEEE
Q ss_conf             89999954663999988999458998079988499999139994999995899199996899922899860786468999
Q 000454          553 RFVLAAIMDCRICVWNAADGSLVHSLTGHTESTYVLDVHPFNPRIAMSAGYDGKTIVWDIWEGIPIRIYEISRFRLVDGK  632 (1491)
Q Consensus       553 ~~LaSgs~DG~I~IWDl~tgkli~tL~gHs~~VtsIafSPdd~~lLaSgS~DGtIrIWDl~tGk~i~~l~~h~~~VtsIa  632 (1491)
                      .++++++.|+.|++|++.+++++..+.+|...|.+++|+| ++.+|++++.||.|+|||+.+++++..+..|...|++++
T Consensus       218 ~~~~~~~~d~~i~~~~~~~~~~~~~~~~~~~~v~~~~~~~-~~~~l~s~~~dg~i~iwd~~~~~~~~~~~~h~~~V~~~~  296 (317)
T d1vyhc1         218 PFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHS-GGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLD  296 (317)
T ss_dssp             CEEEEEETTSEEEEEETTTTEEEEEEECCSSCEEEEEECS-SSSCEEEEETTTEEEEECCTTSCCCEEEECCSSCEEEEE
T ss_pred             CEEEECCCCCEEEEEECCCCCEEEEEECCCCCEEEEEECC-CCCEEEEEECCCEEEEEECCCCCEEEEECCCCCCEEEEE
T ss_conf             6147516997899988899968899968899879999879-999999997989499999999919999928999889999


Q ss_pred             ECCCCCEEEEEECCCCEEEEE
Q ss_conf             948999999995898199999
Q 000454          633 FSPDGASIILSDDVGQLYILN  653 (1491)
Q Consensus       633 fSPDG~~LAsgs~DG~I~IWd  653 (1491)
                      |+|++++|++++.||.|+||+
T Consensus       297 ~s~~~~~l~s~s~Dg~i~iWd  317 (317)
T d1vyhc1         297 FHKTAPYVVTGSVDQTVKVWE  317 (317)
T ss_dssp             ECSSSSCEEEEETTSEEEEEC
T ss_pred             ECCCCCEEEEEECCCEEEEEC
T ss_conf             949999999992899499829



>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure