Citrus Sinensis ID: 000470

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------1450------1460------1470--
MSSTPCVHKKFWQETDKAAYLLRQYFFNSLRDRLSTPPFLSLVEKKWLAFQLLLAVKQCHEKGICHGDIKCENVLVTSWNWLYLSDFASFKPTYIPYDDPSDFSFFFDTGGKRLCYLAPERFYEHGGEMQVAQDAPLKPSMDIFAVGCVIAELFLEVPFFELSHLLAYRRGQYDPSQHLEKIPDSGIRKMILHMIQLEPELRFSAESYLQNYAAVVFPTYFSPFLHNFYCCWNPLHSDMRVAMCRSVFPEILKQMMGNKSSEDIGSGVGTPSTAMSVKESQERVTKQNLNLAKALLEKREEMEKGRVQNRFRLLGDISTLIGDGKESNQCSNVKPMPEDVPNSTFSQDLRNSSVESSGELLQSISDAFRKNGHPFLKKITMNNLSSLMSEYDSQSDTFGMPFLPLPEDSMKCEGIVLIASLLCSCVRNVKLPHYRRAAILLLKSSSLFIDDEDRLQRVLPHVIAMLSDPAAIVRCAALETLCDILPLVRNFPPSDAKIFPEYILPMLSMLPDDPEESVRICYASNIAKLALTAYGFLVHSIRLSEAGVLDKLSAPHKSPSSSNETSVQLQRLNADVQLSQLRKSIAEVVQELVMGPKQTPSIRRALLQDIGNLCSFFGQRQSNDFLLPILPAFLNDRDEQLRAVFYGQIVYVCFFVGERSVEEYLLPYIEQALSDATEAVIVNALDCLAILCKSGYLRKRILLEMIERAFPLLCYPSQWVRRSVVTFIAASSESLGAVDSYVFLAPVIRPFLRRQPASLASVKALLSCLKPPVSREVFYQVLENARSSDMLERQRKIWYNTSSQSKQQETADLLKRGAEDLSSIKCWPDKQQSSEGHRPAGDTSKQPEFAQSDDNDGAKLRTLGSLVYNASSMADIRDPLCPEKLLFSGFMSQQVSGVNSLRCDKSSEGIPLYSFSMDKRAMGNLPVASDSVLQVNSLGIGSSTMPWMDTTNQSFSLASSVPPPNLVSGSFSISNGSKQFYRVVHEPEGRENDQMASVNCKFPEMGTSGTAKGSSINVEDASSPADLTGLPSFVRTSSIPDSGWRPRGILVAHLQEHCSAVNEIAISHDHSFFVSASDDSTVKVWDSRKLEKDISFRSRLTYHLEGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHISRGLGNVEKYSGISDIKKKDTKEGAIVTLVNYNTDNCASHMFMYSTQNCGIHLWDTRSNSNTWTLKAIPEEGYVSSLVTGPCGNWFVSGSSRGVLTLWDLRFLVPVNSWQYSQVCPIEKMCLFVPPPNAAVSTTARPLIYVAAGCNEVSLWNAENGSCHQVLRTANYDGDTEMSDLPWAFARPSSRSNPKTDLRRNVNQKYRVDELNEPPPRLLGIRSLLPLPGGDLLTGGTDLKIRRWDHCSPGRSYCICGPNLKGVGNDEFYETRSSSGVQVVQERKRQPLTSKLTAKAVLAAAATDSAGCHRDSILSLGSVKLNQRLLISSSRDGAIKVWK
cccccEEEEEEEEEcccEEEEEEEcccccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccccccccccEEEcccccEEEEcccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccEEcHHHHHHHHHccccccccHHHHHHHcccccccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHcccccccccHHHHHHHccccccccHHHHHHHHccHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccHHHcccccccccccccccccccccccccccccccccccEEEEEHHHHccccccccHHHHHHHHHHHHHHcccccHHHHHccccccHHHcccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHccccHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccEEcccccHHHcccccccccHHHHHHccccccHHHHHHHHHHHHccHHHHHHHHHHHHccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccEEcccccccEEEEEEEcccccccccccccccccccccccccccccccccccccccEEEEcccccccEEEcccccccccccEEEEEccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccEEEEEEcccccEEEEEcccccEEEEEcccccccccccccEEEEcccccEEEEEEEccccEEEEEEccccEEEEEccccccccccccccccccccEEcccccccEEEEEEEEcccccEEEEEEEEcccEEEEEEccccccccEEEcccccccEEEEEEcccccEEEEEEccccEEEEEcccccccccccccccccEEEEEEEccccccccccccccEEEEEEcccEEEEEEcccccEEEEEEEccccccccccccccccccccccccccccccccccccEEccccccccccccEEEEEEEccccEEEEEcccccEEEEEccccccEEEEEcccccccccccEEEEEcccccEEEEEEcccccccccccccHHHHcccccccccccccEEEEEEEccccEEEEEEccccEEEcc
ccccccccHHEEEEccHHHHHHHHHHHHcHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEcccEEEEEccccccccccccccccccEEEEEcccccEEEEccHHHccccccccccccccccHHHcHHHHHHHHHHHHcccccccHHHHHHHHcccccHHHHHHccccHHHHHHHHHHHHccHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccccccHHHccccccccEEEcccHHHHccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccccHHHHHHHccccccHHHHHHHHHccccHHHHHHHHHHccccccccccccHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccHcHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccHHHHHHHccccccccHHHHccccccccccccccccccccEEEEcccccccEEEEEEcccccEEEEEccccEEEEEEcHHcccccccccccEEcccccEEEEEEEEccccEEEEEEcccEEEEEEEEccccccccccccccEEEEEccccccccEEEEEEEccccccccEEEEEEcccEEEEEEccccccEEEEccccccccEEEEEEcccccEEEEEccccEEEEEEEEEcEEcccccccccccEEEEEEccccccEEEEccccEEEEEEccccEEEEEEcccccEEEEEEEcccccccccccccccccccccccccccccccccccHHHHHccccccccEEEEEEEccccccEEEEcccccEEEEEEcccccccEEEEcccccccccccEEEEEcccccEEEEEcccccccccccccccccccccccccccccHHEEEEEEcccccEEEEEccccEEEEEc
msstpcvhkkfWQETDKAAYLLRQYFFNSlrdrlstppflSLVEKKWLAFQLLLAVKQCHekgichgdikcenVLVTSWNwlylsdfasfkptyipyddpsdfsfffdtggkrlcylaperfyehggemqvaqdaplkpsmdIFAVGCVIAELFLEVPFFELSHLLAyrrgqydpsqhlekipdsGIRKMILHMIQLEPELRFSAESYLQNYAAVvfptyfspflhnfyccwnplhsDMRVAMCRSVFPEILKQMmgnkssedigsgvgtpstamsVKESQERVTKQNLNLAKALLEKREEMEKGRVQNRFRLLGDIStligdgkesnqcsnvkpmpedvpnstfsqdlrnssveSSGELLQSISDAFRKNGHPFLKKITMNNLSSLMSeydsqsdtfgmpflplpedsmkcEGIVLIASLLCSCvrnvklphYRRAAILLLKssslfiddedRLQRVLPHVIAMLSDPAAIVRCAALETLCdilplvrnfppsdakifpeyilpmlsmlpddpeesvRICYASNIAKLALTAYGFLVHSIRLseagvldklsaphkspsssnetSVQLQRLNADVQLSQLRKSIAEVVQELvmgpkqtpSIRRALLQDIGNLCSffgqrqsndfllpilpaflnDRDEQLRAVFYGQIVYVCFFVGERSVEEYLLPYIEQALSDATEAVIVNALDCLAILCKSGYLRKRILLEMIERAfpllcypsqwvRRSVVTFIAASSeslgavdsyvflapvirpflrrqpASLASVKALLsclkppvsrEVFYQVLENARSSDMLERQRKIWYNTSSQSKQQETADLLKRGaedlssikcwpdkqqsseghrpagdtskqpefaqsddndgakLRTLGSLVynassmadirdplcpekllfsgfmsqqvsgvnslrcdkssegiplysfsmdkramgnlpvasdSVLQVNslgigsstmpwmdttnqsfslassvpppnlvsgsfsisngsKQFYRVvhepegrendqmasvnckfpemgtsgtakgssinvedasspadltglpsfvrtssipdsgwrprGILVAHLQEHCSAVNEIaishdhsffvsasddstvkvwdsrklekdiSFRSRLTYHLEGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHIsrglgnvekysgisdikkkdtkegAIVTLVNyntdncashMFMYStqncgihlwdtrsnsntwtlkaipeegyvsslvtgpcgnwfvsgssrgvltlwdlrflvpvnswqysqvcpiekmclfvpppnaavsttarPLIYVAAGCNEvslwnaengschQVLRTanydgdtemsdlpwafarpssrsnpktdlrrnvnqkyrvdelneppprllgirsllplpggdlltggtdlkirrwdhcspgrsycicgpnlkgvgndefyetrsssgvqvvqerkrqpltsKLTAKAVLAAAAtdsagchrdsilsLGSVKLNQRLLISSSRDGAIKVWK
msstpcvhkkfwqETDKAAYLLRQYFFNSLRDRLSTPPFLSLVEKKWLAFQLLLAVKQCHEKGICHGDIKCENVLVTSWNWLYLSDFASFKPTYIPYDDPSDFSFFFDTGGKRLCYLAPERFYEHGGEMQVAQDAPLKPSMDIFAVGCVIAELFLEVPFFELSHLLAYRRGQYDPSQHLEKIPDSGIRKMILHMIQLEPELRFSAESYLQNYAAVVFPTYFSPFLHNFYCCWNPLHSDMRVAMCRSVFPEILKQMMGNKSSEDIGSGVGTPSTAMSVKESQERVTKQNLNLAKALlekreemekgrvqnrfrLLGDISTLIGDGKESNQCSNVKPMPEDVPNSTFSQDLRNSSVESSGELLQSISDAFRKNGHPFLKKITMNNLSSLMSEYDSQSDTFGMPFLPLPEDSMKCEGIVLIASLLCSCVRNVKLPHYRRAAILLLKSSSLFIDDEDRLQRVLPHVIAMLSDPAAIVRCAALETLCDILPLVRNFPPSDAKIFPEYILPMLSMLPDDPEESVRICYASNIAKLALTAYGFLVHSIRLSEAGVLDKLsaphkspsssnetsVQLQRLNADVQLSQLRKSIAEVVQELVMGPKQTPSIRRALLQDIGNLCSFFGQRQSNDFLLPILPAFLNDRDEQLRAVFYGQIVYVCFFVGERSVEEYLLPYIEQALSDATEAVIVNALDCLAILCKSGYLRKRILLEMIERAFPLLCYPSQWVRRSVVTFIAASseslgavdSYVFLAPVIRPFLRRQPASLASVKALLSCLKPPVSREVFYQVLENarssdmleRQRKIWyntssqskqqETADLLKRGAEDLSSIKCWPDKQQSSEGHRPAGDTSKQPEFAQSDDNDGAKLRTLGSLVYNASSMADIRDPLCPEKLLFSGFMSQQVSGVNSLRCDKSSEGIPLYSFSMDKRAMGNLPVASDSVLQVNSLGIGSSTMPWMDTTNQSFSLASSVPPPNLVSGSFSISNGSKQFYRVVHEPEGRENDQMASVNCKFPEMGTSGTAKGSSINVEDASSPADLTGLPSFVRTSSIPDSGWRPRGILVAHLQEHCSAVNEIAISHDHSFfvsasddstvkvwdsrklekdisfrsrltYHLEGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHISRGLGNVEKYsgisdikkkdtkegAIVTLVNYNTDNCASHMFMYSTQNCGIHLWDTRSNSNTWTLKAIPEEGYVSSLVTGPCGNWFVSGSSRGVLTLWDLRFLVPVNSWQYSQVCPIEKMCLFVPPPNAAVSTTARPLIYVAAGCNEVSLWNAENGSCHQVLRTANYDGDTEMSDLPWafarpssrsnpktdlrrnvnqkyrvdelneppprLLGIRSLLPLPGGDLLTGGTDLKIRRWDHCSPGRSYCICGPNLKGVGNDEFYETrsssgvqvvqerkrqpltskLTAKAVLAAAATDSAGCHRDSILslgsvklnqrllisssrdgaikvwk
MSSTPCVHKKFWQETDKAAYLLRQYFFNSLRDRLSTPPFLSLVEKKWLAFQLLLAVKQCHEKGICHGDIKCENVLVTSWNWLYLSDFASFKPTYIPYddpsdfsfffdTGGKRLCYLAPERFYEHGGEMQVAQDAPLKPSMDIFAVGCVIAELFLEVPFFELSHLLAYRRGQYDPSQHLEKIPDSGIRKMILHMIQLEPELRFSAESYLQNYAAVVFPTYFSPFLHNFYCCWNPLHSDMRVAMCRSVFPEILKQMMGNKSSEDIGSGVGTPSTAMSVKESQERVTKQNLNLAKALLEKREEMEKGRVQNRFRLLGDISTLIGDGKESNQCSNVKPMPEDVPNSTFSQDLRNSSVESSGELLQSISDAFRKNGHPFLKKITMNNLSSLMSEYDSQSDTFGMPFLPLPEDSMKCEGIVLIASLLCSCVRNVKLPHYRRAAILLLKSSSLFIDDEDRLQRVLPHVIAMLSDPAAIVRCAALETLCDILPLVRNFPPSDAKIFPEYILPMLSMLPDDPEESVRICYASNIAKLALTAYGFLVHSIRLSEAGVLDKLSAPHKSPSSSNETSVQLQRLNADVQLSQLRKSIAEVVQELVMGPKQTPSIRRALLQDIGNLCSFFGQRQSNDFLLPILPAFLNDRDEQLRAVFYGQIVYVCFFVGERSVEEYLLPYIEQALSDATEAVIVNALDCLAILCKSGYLRKRILLEMIERAFPLLCYPSQWVRRSVVTFIAASSESLGAVDSYVFLAPVIRPFLRRQPASLASVKALLSCLKPPVSREVFYQVLENARSSDMLERQRKIWYNTSSQSKQQETADLLKRGAEDLSSIKCWPDKQQSSEGHRPAGDTSKQPEFAQSDDNDGAKLRTLGSLVYNASSMADIRDPLCPEKLLFSGFMSQQVSGVNSLRCDKSSEGIPLYSFSMDKRAMGNLPVASDSVLQVNSLGIGSSTMPWMDTTNQSFSLASSVPPPNLVSGSFSISNGSKQFYRVVHEPEGRENDQMASVNCKFPEMGTSGTAKGSSINVEDASSPADLTGLPSFVRTSSIPDSGWRPRGILVAHLQEHCSAVNEIAISHDHSFFVSASDDSTVKVWDSRKLEKDISFRSRLTYHLEGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHISRGLGNVEKYSGISDIKKKDTKEGAIVTLVNYNTDNCASHMFMYSTQNCGIHLWDTRSNSNTWTLKAIPEEGYVSSLVTGPCGNWFVSGSSRGVLTLWDLRFLVPVNSWQYSQVCPIEKMCLFVPPPNAAVSTTARPLIYVAAGCNEVSLWNAENGSCHQVLRTANYDGDTEMSDLPWAFARPSSRSNPKTDLRRNVNQKYRVDELNEPPPRLLGIRSllplpggdlltggtdlKIRRWDHCSPGRSYCICGPNLKGVGNDEFYETRSSSGVQVVQERKRQPltskltakavlaaaatdsaGCHRDSILSLGSVKLNQRLLISSSRDGAIKVWK
*****CVHKKFWQETDKAAYLLRQYFFNSLRDRLSTPPFLSLVEKKWLAFQLLLAVKQCHEKGICHGDIKCENVLVTSWNWLYLSDFASFKPTYIPYDDPSDFSFFFDTGGKRLCYLAPERFYEHGGEMQVAQDAPLKPSMDIFAVGCVIAELFLEVPFFELSHLLAYRRGQYDPSQHLEKIPDSGIRKMILHMIQLEPELRFSAESYLQNYAAVVFPTYFSPFLHNFYCCWNPLHSDMRVAMCRSVFPEILK********************************************************RFRLLGDISTLI****************************************************************************FGMPFLPLPEDSMKCEGIVLIASLLCSCVRNVKLPHYRRAAILLLKSSSLFIDDEDRLQRVLPHVIAMLSDPAAIVRCAALETLCDILPLVRNFPPSDAKIFPEYILPMLSMLPDDPEESVRICYASNIAKLALTAYGFLVHSIRLSEAGVL*********************************KSIAEVVQELVMGPKQTPSIRRALLQDIGNLCSFFGQRQSNDFLLPILPAFLNDRDEQLRAVFYGQIVYVCFFVGERSVEEYLLPYIEQALSDATEAVIVNALDCLAILCKSGYLRKRILLEMIERAFPLLCYPSQWVRRSVVTFIAASSESLGAVDSYVFLAPVIRPFLRRQPASLASVKALLSCLKPPVSREVFYQVLENA***********IWY**************************************************************TLGSLVYNASSMADIRDPLCPEKLLFSGFMSQQVSGVNSLRC******IPLYSFS***************VLQVNSLGI****************************************************************************************************DSGWRPRGILVAHLQEHCSAVNEIAISHDHSFFVSASDDSTVKVWDSRKLEKDISFRSRLTYHLEGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHISRGLGNVEKYSGISDIKKKDTKEGAIVTLVNYNTDNCASHMFMYSTQNCGIHLWDTRSNSNTWTLKAIPEEGYVSSLVTGPCGNWFVSGSSRGVLTLWDLRFLVPVNSWQYSQVCPIEKMCLFVPPPNAAVSTTARPLIYVAAGCNEVSLWNAENGSCHQVLRTANYDGDT****LPWA*********************************LLGIRSLLPLPGGDLLTGGTDLKIRRWDHCSPGRSYCICGPNLKGVGNDEFY************************AKAVLAAAATDSAGCHRDSILSLGSVKLNQRLLI************
*SSTPCVHKKFWQETDKAAYLLRQYFFNSLRDRLSTPPFLSLVEKKWLAFQLLLAVKQCHEKGICHGDIKCENVLVTSWNWLYLSDFASFKPTYIPYDDPSDFSFFFDTGGKRLCYLAPERFYE***************SMDIFAVGCVIAELFLEVPFFELSHLLAYRRGQYDPSQHLEKIPDSGIRKMILHMIQLEPELRFSAESYLQNYAAVVFPTYFSPFLHNFYCCWNPLHSDMRVAMCRSVF*******************************************************************************************************************************************************MPFLPLPEDSMKCEGIVLIASLLCSCVRNVKLPHYRRAAILLLKSSSLFIDDEDRLQRVLPHVIAMLSDPAAIVRCAALETLCDILPLVRNFPPSDAKIFPEYILPMLSMLPDDPEESVRICYASNIAKLALTAYGFLVHSIRLS*****************************ADVQLSQLRKSIAEVVQELVMGPKQTPSIRRALLQDIGNLCSFFGQRQSNDFLLPILPAFLNDRDEQLRAVFYGQIVYVCFFVGERSVEEYLLPYIEQALSDATEAVIVNALDCLAILCKSGYLRKRILLEMIERAFPLLCYPSQWVRRSVVTFIAASSESLGAVDSYVFLAPVIRPFLRRQPASLASVKALLSCLKPPVSREVFYQVLENARSSDML**********************************************************AQSDDNDGAKLRTLGSLVYNASSMADIRDPLCPEKLLFSG********************IP********************************************************************************N*QMASV*****************INVEDASSPADLT**********IPDSGWRPRGILVAHLQEHCSAVNEIAISHDHSFFVSASDDSTVKVWDSRKL**************EGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHI*************SDIKKKDTKEGAIVTLVNYNTDNCASHMFMYSTQNCGIHLWDTRSNSNTWTLKAIPEEGYVSSLVTGPCGNWFVSGSSRGVLTLWDLRFLVPVNSWQYSQVCPIEKMCLFVPPPNAAVSTTARPLIYVAAGCNEVSLWNAENGSCHQVLRTANYDGDTEMSDLP**********NPKTDLRRNVNQKYRVDELNEPPPRLLGIRSLLPLPGGDLLTGGTDLKIRRWDHCSPGRSYCICGPNLKGVGNDEFYETRSSSGVQVVQ***********************SAGCHRDSILSLGSVKLNQRLLISSSRDGAIKVWK
MSSTPCVHKKFWQETDKAAYLLRQYFFNSLRDRLSTPPFLSLVEKKWLAFQLLLAVKQCHEKGICHGDIKCENVLVTSWNWLYLSDFASFKPTYIPYDDPSDFSFFFDTGGKRLCYLAPERFYEHGGEMQVAQDAPLKPSMDIFAVGCVIAELFLEVPFFELSHLLAYRRGQYDPSQHLEKIPDSGIRKMILHMIQLEPELRFSAESYLQNYAAVVFPTYFSPFLHNFYCCWNPLHSDMRVAMCRSVFPEILKQMMGN**************************TKQNLNLAKALLEKREEMEKGRVQNRFRLLGDISTLIGDGKESNQCSNVKPMPEDVPNSTFSQ************LLQSISDAFRKNGHPFLKKITMNNLSSLMSEYDSQSDTFGMPFLPLPEDSMKCEGIVLIASLLCSCVRNVKLPHYRRAAILLLKSSSLFIDDEDRLQRVLPHVIAMLSDPAAIVRCAALETLCDILPLVRNFPPSDAKIFPEYILPMLSMLPDDPEESVRICYASNIAKLALTAYGFLVHSIRLSEAGVLDK*****************LQRLNADVQLSQLRKSIAEVVQELVMGPKQTPSIRRALLQDIGNLCSFFGQRQSNDFLLPILPAFLNDRDEQLRAVFYGQIVYVCFFVGERSVEEYLLPYIEQALSDATEAVIVNALDCLAILCKSGYLRKRILLEMIERAFPLLCYPSQWVRRSVVTFIAASSESLGAVDSYVFLAPVIRPFLRRQPASLASVKALLSCLKPPVSREVFYQVLENARSSDMLERQRKIWYNTS*********DLLKRGAEDLSSIKCWP**********************QSDDNDGAKLRTLGSLVYNASSMADIRDPLCPEKLLFSGFMSQQVSGVNSLRCDKSSEGIPLYSFSMDKRAMGNLPVASDSVLQVNSLGIGSSTMPWMDTTNQSFSLASSVPPPNLVSGSFSISNGSKQFYRVVHEPEGRENDQMASVNCKFPEMGTSGTAKGSSINVEDASSPADLTGLPSFVRTSSIPDSGWRPRGILVAHLQEHCSAVNEIAISHDHSFFVSASDDSTVKVWDSRKLEKDISFRSRLTYHLEGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHISRGLGNVEKYSGISDIKKKDTKEGAIVTLVNYNTDNCASHMFMYSTQNCGIHLWDTRSNSNTWTLKAIPEEGYVSSLVTGPCGNWFVSGSSRGVLTLWDLRFLVPVNSWQYSQVCPIEKMCLFVPPPNAAVSTTARPLIYVAAGCNEVSLWNAENGSCHQVLRTANYDGDTEMSDLPWAFAR*********DLRRNVNQKYRVDELNEPPPRLLGIRSLLPLPGGDLLTGGTDLKIRRWDHCSPGRSYCICGPNLKGVGNDEFYE**************RQPLTSKLTAKAVLAAAATDSAGCHRDSILSLGSVKLNQRLLISSSRDGAIKVWK
**STPCVHKKFWQETDKAAYLLRQYFFNSLRDRLSTPPFLSLVEKKWLAFQLLLAVKQCHEKGICHGDIKCENVLVTSWNWLYLSDFASFKPTYIPYDDPSDFSFFFDTGGKRLCYLAPERFYEHGGE*****DAPLKPSMDIFAVGCVIAELFLEVPFFELSHLLAYRRGQYDPSQHLEKIPDSGIRKMILHMIQLEPELRFSAESYLQNYAAVVFPTYFSPFLHNFYCCWNPLHSDMRVAMCRSVFPEILKQMMGNKSSEDIGSGVGTPSTAMSVKESQERVTKQNLNLAKALLEKREEMEKGRVQNRFRLLGDISTLIGDGKESNQCSNVKPMPEDVPNSTFSQDLRNSSVESSGELLQSISDAFRKNGHPFLKKITMNNLSSLMSEYDSQSDTFGMPFLPLPEDSMKCEGIVLIASLLCSCVRNVKLPHYRRAAILLLKSSSLFIDDEDRLQRVLPHVIAMLSDPAAIVRCAALETLCDILPLVRNFPPSDAKIFPEYILPMLSMLPDDPEESVRICYASNIAKLALTAYGFLVHSIRLSEAGVLDKLSAPHKSPSSSNETSVQLQRLNADVQLSQLRKSIAEVVQELVMGPKQTPSIRRALLQDIGNLCSFFGQRQSNDFLLPILPAFLNDRDEQLRAVFYGQIVYVCFFVGERSVEEYLLPYIEQALSDATEAVIVNALDCLAILCKSGYLRKRILLEMIERAFPLLCYPSQWVRRSVVTFIAASSESLGAVDSYVFLAPVIRPFLRRQPASLASVKALLSCLKPPVSREVFYQVLENARSSDMLERQRKIWYNTSSQSKQQETADLLK********************************EFAQSDDNDGAKLRTLGSLVYNASSMADIRDPLCPEKLLFS******************************************************************************************QFYRVVHEPEGRENDQMASVNCKFPEMGTSGTAKGSSINVEDASSPADLTGLPSFVRTSSIPDSGWRPRGILVAHLQEHCSAVNEIAISHDHSFFVSASDDSTVKVWDSRKLEKDISFRSRLTYHLEGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHISRGLGNVEKYSGISDIKKKDTKEGAIVTLVNYNTDNCASHMFMYSTQNCGIHLWDTRSNSNTWTLKAIPEEGYVSSLVTGPCGNWFVSGSSRGVLTLWDLRFLVPVNSWQYSQVCPIEKMCLFVPPPNAAVSTTARPLIYVAAGCNEVSLWNAENGSCHQVLRTANY*****MSDLPWA************DLRRNVNQKYRVDELNEPPPRLLGIRSLLPLPGGDLLTGGTDLKIRRWDHCSPGRSYCICGPNLKGVGNDEFYETRSSSGVQVVQERK***********************CHRDSILSLGSVKLNQRLLISSSRDGAIKVWK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSTPCVHKKFWQETDKAAYLLRQYFFNSLRDRLSTPPFLSLVEKKWLAFQLLLAVKQCHEKGICHGDIKCENVLVTSWNWLYLSDFASFKPTYIPYDDPSDFSFFFDTGGKRLCYLAPERFYEHGGEMQVAQDAPLKPSMDIFAVGCVIAELFLEVPFFELSHLLAYRRGQYDPSQHLEKIPDSGIRKMILHMIQLEPELRFSAESYLQNYAAVVFPTYFSPFLHNFYCCWNPLHSDMRVAMCRSVFPEILKQMMGNKSSEDIGSGVGTPSTAMSVKESQERVTKQNLNLAKALLEKREEMEKGRVQNRFRLLGDISTLIGDGKESNQCSNVKPMPEDVPNSTFSQDLRNSSVESSGELLQSISDAFRKNGHPFLKKITMNNLSSLMSEYDSQSDTFGMPFLPLPEDSMKCEGIVLIASLLCSCVRNVKLPHYRRAAILLLKSSSLFIDDEDRLQRVLPHVIAMLSDPAAIVRCAALETLCDILPLVRNFPPSDAKIFPEYILPMLSMLPDDPEESVRICYASNIAKLALTAYGFLVHSIRLSEAGVLDKLSAPHKSPSSSNETSVQLQRLNADVQLSQLRKSIAEVVQELVMGPKQTPSIRRALLQDIGNLCSFFGQRQSNDFLLPILPAFLNDRDEQLRAVFYGQIVYVCFFVGERSVEEYLLPYIEQALSDATEAVIVNALDCLAILCKSGYLRKRILLEMIERAFPLLCYPSQWVRRSVVTFIAASSESLGAVDSYVFLAPVIRPFLRRQPASLASVKALLSCLKPPVSREVFYQVLENARSSDMLERQRKIWYNTSSQSKQQETADLLKRGAEDLSSIKCWPDKQQSSEGHRPAGDTSKQPEFAQSDDNDGAKLRTLGSLVYNASSMADIRDPLCPEKLLFSGFMSQQVSGVNSLRCDKSSEGIPLYSFSMDKRAMGNLPVASDSVLQVNSLGIGSSTMPWMDTTNQSFSLASSVPPPNLVSGSFSISNGSKQFYRVVHEPEGRENDQMASVNCKFPEMGTSGTAKGSSINVEDASSPADLTGLPSFVRTSSIPDSGWRPRGILVAHLQEHCSAVNEIAISHDHSFFVSASDDSTVKVWDSRKLEKDISFRSRLTYHLEGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHISRGLGNVEKYSGISDIKKKDTKEGAIVTLVNYNTDNCASHMFMYSTQNCGIHLWDTRSNSNTWTLKAIPEEGYVSSLVTGPCGNWFVSGSSRGVLTLWDLRFLVPVNSWQYSQVCPIEKMCLFVPPPNAAVSTTARPLIYVAAGCNEVSLWNAENGSCHQVLRTANYDGDTEMSDLPWAFARPSSRSNPKTDLRRNVNQKYRVDELNEPPPRLLGIRSLLPLPGGDLLTGGTDLKIRRWDHCSPGRSYCICGPNLKGVGNDEFYETRSSSGVQVVQERKRQPLTSKLTAKAVLAAAATDSAGCHRDSILSLGSVKLNQRLLISSSRDGAIKVWK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1472 2.2.26 [Sep-21-2011]
Q54S77 1966 Probable serine/threonine yes no 0.163 0.122 0.530 6e-70
Q995701358 Phosphoinositide 3-kinase yes no 0.169 0.184 0.463 5e-65
Q5R9I31358 Phosphoinositide 3-kinase yes no 0.167 0.181 0.462 2e-64
Q8VD651358 Phosphoinositide 3-kinase yes no 0.164 0.178 0.469 2e-63
O42900 1706 Serine/threonine-protein yes no 0.143 0.123 0.532 4e-63
P0C0R51358 Phosphoinositide 3-kinase yes no 0.164 0.178 0.465 5e-63
Q9UVG61340 Putative serine/threonine yes no 0.142 0.156 0.488 3e-55
P222191454 Serine/threonine-protein yes no 0.146 0.148 0.463 3e-55
Q9VP221157 Cyclin-dependent kinase 1 no no 0.069 0.089 0.307 5e-07
Q55C57473 Probable serine/threonine no no 0.070 0.219 0.305 1e-06
>sp|Q54S77|VPS15_DICDI Probable serine/threonine-protein kinase vps15 OS=Dictyostelium discoideum GN=vps15 PE=3 SV=1 Back     alignment and function desciption
 Score =  267 bits (682), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 131/247 (53%), Positives = 172/247 (69%), Gaps = 6/247 (2%)

Query: 14  ETDKAAYLLRQYFFNSLRDRLSTPPFLSLVEKKWLAFQLLLAVKQCHEKGICHGDIKCEN 73
           ETD++ YL+RQYF N+L DRLST PFLS++EKK++AFQLL A++Q   KG+ HGDIK EN
Sbjct: 90  ETDRSGYLIRQYFHNNLYDRLSTRPFLSMIEKKFIAFQLLKALEQSSFKGVFHGDIKSEN 149

Query: 74  VLVTSWNWLYLSDFASFKPTYIPYDDPSDFSFFFDTGGKRLCYLAPERFYEHGGEMQVAQ 133
           VLVT+ NW+YLSDFA +KPT+IP D+P+DFSF+FDT G+R CY+APERFYE         
Sbjct: 150 VLVTTSNWVYLSDFACYKPTFIPEDNPADFSFYFDTSGRRTCYIAPERFYETN--RGAPS 207

Query: 134 DAPLKPSMDIFAVGCVIAELFLE-VPFFELSHLLAYRRGQYDPSQHL-EKIPDSGIRKMI 191
           +  L P MDIF++GCVIAELFL+  P F+ S LL+YR+G+Y P   + ++I D  I+ +I
Sbjct: 208 NNELTPKMDIFSLGCVIAELFLDGFPIFDFSQLLSYRKGEYSPEPIIRQRIQDPNIQTLI 267

Query: 192 LHMIQLEPELRFSAESYLQNYAAVVFPTYFSPFLHNFYCCWNPLHSDMRVAMCRSVFPEI 251
           LHMIQ +P+ R++ E Y+  +   VFP YFS F H F      L +D RV      F EI
Sbjct: 268 LHMIQKDPDQRYTPEKYISKWNT-VFPQYFS-FAHQFIPELMRLENDDRVMCISDKFDEI 325

Query: 252 LKQMMGN 258
           +     N
Sbjct: 326 VDIFKNN 332

Dictyostelium discoideum (taxid: 44689)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q99570|PI3R4_HUMAN Phosphoinositide 3-kinase regulatory subunit 4 OS=Homo sapiens GN=PIK3R4 PE=1 SV=3 Back     alignment and function description
>sp|Q5R9I3|PI3R4_PONAB Phosphoinositide 3-kinase regulatory subunit 4 OS=Pongo abelii GN=PIK3R4 PE=2 SV=3 Back     alignment and function description
>sp|Q8VD65|PI3R4_MOUSE Phosphoinositide 3-kinase regulatory subunit 4 OS=Mus musculus GN=Pik3r4 PE=1 SV=3 Back     alignment and function description
>sp|O42900|PPK19_SCHPO Serine/threonine-protein kinase ppk19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk19 PE=1 SV=1 Back     alignment and function description
>sp|P0C0R5|PI3R4_RAT Phosphoinositide 3-kinase regulatory subunit 4 OS=Rattus norvegicus GN=Pik3r4 PE=2 SV=2 Back     alignment and function description
>sp|Q9UVG6|VPS15_PICPA Putative serine/threonine-protein kinase VPS15 OS=Komagataella pastoris GN=VPS15 PE=3 SV=3 Back     alignment and function description
>sp|P22219|VPS15_YEAST Serine/threonine-protein kinase VPS15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS15 PE=1 SV=4 Back     alignment and function description
>sp|Q9VP22|CDK12_DROME Cyclin-dependent kinase 12 OS=Drosophila melanogaster GN=Cdk12 PE=1 SV=1 Back     alignment and function description
>sp|Q55C57|GLKA_DICDI Probable serine/threonine-protein kinase glkA OS=Dictyostelium discoideum GN=glkA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1472
2555462971455 ATP binding protein, putative [Ricinus c 0.925 0.936 0.751 0.0
3594845321455 PREDICTED: phosphoinositide 3-kinase reg 0.925 0.936 0.758 0.0
3564975751521 PREDICTED: phosphoinositide 3-kinase reg 0.969 0.938 0.750 0.0
3565208221488 PREDICTED: phosphoinositide 3-kinase reg 0.948 0.938 0.743 0.0
4494357881445 PREDICTED: phosphoinositide 3-kinase reg 0.919 0.936 0.716 0.0
4494898041445 PREDICTED: LOW QUALITY PROTEIN: phosphoi 0.919 0.936 0.715 0.0
2978030981494 kinase family protein [Arabidopsis lyrat 0.952 0.938 0.698 0.0
152335641494 phosphoinositide-3-kinase, regulatory su 0.952 0.938 0.702 0.0
2240880491209 predicted protein [Populus trichocarpa] 0.820 0.999 0.755 0.0
2977387421349 unnamed protein product [Vitis vinifera] 0.647 0.706 0.750 0.0
>gi|255546297|ref|XP_002514208.1| ATP binding protein, putative [Ricinus communis] gi|223546664|gb|EEF48162.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 2217 bits (5744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1101/1465 (75%), Positives = 1214/1465 (82%), Gaps = 102/1465 (6%)

Query: 10   KFWQETDKAAYLLRQYFFNSLRDRLSTPPFLSLVEKKWLAFQLLLAVKQCHEKGICHGDI 69
            +FWQETDKAAYLLRQ+FFN+L DRLST PFLS VEKKWLAFQLLLAVKQCHEKGICHGDI
Sbjct: 91   QFWQETDKAAYLLRQFFFNNLHDRLSTRPFLSPVEKKWLAFQLLLAVKQCHEKGICHGDI 150

Query: 70   KCENVLVTSWNWLYLSDFASFKPTYIPYDDPSDFSFFFDTGGKRLCYLAPERFYEHGGEM 129
            KCENVLVTSWNWLYL+DFASFKPTYIPYDDPSDFSFFFDTGG+RLCYLAPERFYEHGGEM
Sbjct: 151  KCENVLVTSWNWLYLADFASFKPTYIPYDDPSDFSFFFDTGGRRLCYLAPERFYEHGGEM 210

Query: 130  QVAQDAPLKPSMDIFAVGCVIAELFLE-VPFFELSHLLAYRRGQYDPSQHLEKIPDSGIR 188
            QV+QDAPLKPSMDIFAVGCVIAELFLE    FELS LLAYRRGQYDPSQ+LEKIPDSGIR
Sbjct: 211  QVSQDAPLKPSMDIFAVGCVIAELFLEGQQLFELSQLLAYRRGQYDPSQNLEKIPDSGIR 270

Query: 189  KMILHMIQLEPELRFSAESYLQNYAAVVFPTYFSPFLHNFYCCWNPLHSDMRVAMCRSVF 248
            KMILHMIQLEPE R SAE YL NYA+VVFPTYFSPFLHNFYCCWNPLHSDMRVAMCRSVF
Sbjct: 271  KMILHMIQLEPEARLSAEGYLLNYASVVFPTYFSPFLHNFYCCWNPLHSDMRVAMCRSVF 330

Query: 249  PEILKQMMGNKSSEDIGSGVGTPSTAMSVKESQERVTKQNLNLAKALLEKREEMEKGRVQ 308
             EILKQMM NK+ E+  +G+ + +  M  K  ++ V KQNL+L K    KRE+ EKG V+
Sbjct: 331  HEILKQMMSNKTDEETVTGLCSSANCMGAKPVEDIVEKQNLDLTKDS-TKREKTEKGLVR 389

Query: 309  NRFRLLGDISTLIGDGKESNQCSNVKPMPEDVPNSTFSQDLRNSSVESSGELLQSISDAF 368
            ++++LLGDI+TL+GD K+S     +K  PE   NS FSQD+   +++S G+LLQ+IS+AF
Sbjct: 390  DQYKLLGDINTLLGDVKQSTD--YMKLTPESATNSAFSQDIEQCAMQSPGKLLQAISNAF 447

Query: 369  RKNGHPFLKKITMNNLSSLMSEYDSQSDTFGMPFLPLPEDSMKCEGIVLIASLLCSCVRN 428
            +KN HPFLKKITM++L+ LMSEYDSQSDTFG+PFLP PED+MKCEG+VLIASLLCSC+RN
Sbjct: 448  QKNDHPFLKKITMDDLTLLMSEYDSQSDTFGIPFLPTPEDNMKCEGMVLIASLLCSCIRN 507

Query: 429  VKLPHYRRAAILLLKSSSLFIDDEDRLQRVLPHVIAMLSDPAAIVRCAALETLCDILPLV 488
            VKLPH RR AILLLKSSSL+IDDEDRLQRVLP+VIAMLSDPAAIVR AALE+LCDILP V
Sbjct: 508  VKLPHLRRGAILLLKSSSLYIDDEDRLQRVLPYVIAMLSDPAAIVRSAALESLCDILPFV 567

Query: 489  RNFPPSDAKIFPEYILPMLSMLPDDPEESVRICYASNIAKLALTAYGFLVHSIRLSEAGV 548
            R+FPPSDAKIFPEYILPMLSMLPDDPEESVRICYASNIAKLALTAYGFL+HSI LSEAGV
Sbjct: 568  RDFPPSDAKIFPEYILPMLSMLPDDPEESVRICYASNIAKLALTAYGFLIHSISLSEAGV 627

Query: 549  LDKLSAPHKSPSSSNETSVQLQRLNADVQLSQLRKSIAEVVQELVMGPKQTPSIRRALLQ 608
            LD+++   KS +SS+ETS QLQ++  D QL+QLRKSIAEVVQELVMGPKQTP+IRRALLQ
Sbjct: 628  LDEMNLARKSLASSSETSRQLQKVKNDSQLAQLRKSIAEVVQELVMGPKQTPNIRRALLQ 687

Query: 609  DIGNLCSFFGQRQSNDFLLPILPAFLNDRDEQLRAVFYGQIVYVCFFVGERSVEEYLLPY 668
            DIG LC FFGQRQSNDFLLPILPAFLNDRDEQLRA+F+GQI+YVCFFVG+RSVEEYLLPY
Sbjct: 688  DIGKLCYFFGQRQSNDFLLPILPAFLNDRDEQLRALFFGQIIYVCFFVGQRSVEEYLLPY 747

Query: 669  IEQALSDATEAVIVNALDCLAILCKSGYLRKRILLEMIERAFPLLCYPSQWVRRSVVTFI 728
            IEQALSD TEAV+VNALDCLA+LCK G+LRKRILLEMIE AFPLLCYPSQWVRRS V FI
Sbjct: 748  IEQALSDQTEAVVVNALDCLAVLCKRGFLRKRILLEMIEHAFPLLCYPSQWVRRSAVAFI 807

Query: 729  AASSESLGAVDSYVFLAPVIRPFLRRQPASLASVKALLSCLKPPVSREVFYQVLENARSS 788
            AASSESLGAVDSYVFLAPVIRPFLRRQPASLAS K+LL CLK P S++VF +VLE ARSS
Sbjct: 808  AASSESLGAVDSYVFLAPVIRPFLRRQPASLASEKSLLLCLKSPFSKQVFSEVLEKARSS 867

Query: 789  DMLERQRKIWYNTSSQSKQQETADLLKRGAEDLSSIKCWPDKQQSSEGHRPAGDTSKQPE 848
            DMLERQRKIWYN+S+QSK  ETAD+L+R   +L SIK W DK                  
Sbjct: 868  DMLERQRKIWYNSSAQSKHWETADVLQREDGELHSIKSWSDK------------------ 909

Query: 849  FAQSDDNDGAKLRTLGSLVYNASSMADIRDPLCPEKLLFSGFMSQQVSGVNSLRCDKSSE 908
                      KL+                      KL FSG+MS Q+ GVNS   DKSSE
Sbjct: 910  ----------KLK----------------------KLQFSGYMSPQIGGVNSFIHDKSSE 937

Query: 909  GIPLYSFSMDKRAMGNLPVASDSVLQVNSLGIGSSTMPWMDTTNQSFSLASSVPPPNLVS 968
            GIPLYSFSMD+RA    P ASDS L++NSLGI                            
Sbjct: 938  GIPLYSFSMDRRAAKISPAASDSSLRMNSLGI---------------------------- 969

Query: 969  GSFSISNGSKQFYRVVHEPEGRENDQMASVNCKFPEMGTSGTAKGSSINVEDASSPADLT 1028
                               E RENDQ A V+ KF EMG SG  KG S+ VEDAS+  DLT
Sbjct: 970  -------------------ESRENDQTAYVSNKFQEMGISGGTKGGSLTVEDASASTDLT 1010

Query: 1029 GLPSFVRTSSIPDSGWRPRGILVAHLQEHCSAVNEIAISHDHSFFVSASDDSTVKVWDSR 1088
            GLPSF RT S+PDSGWRPRG+LVAHLQEH SAVN+IAIS+DHS FVSASDDSTVKVWDSR
Sbjct: 1011 GLPSFARTISVPDSGWRPRGVLVAHLQEHRSAVNDIAISNDHSLFVSASDDSTVKVWDSR 1070

Query: 1089 KLEKDISFRSRLTYHLEGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHISRGLGN-VEK 1147
            KLEKDISFRSRLTYHLEGSRALC++MLR+ +QVVVG CDG++H+FSVDHISRGLGN VEK
Sbjct: 1071 KLEKDISFRSRLTYHLEGSRALCSVMLRNFSQVVVGGCDGMMHVFSVDHISRGLGNVVEK 1130

Query: 1148 YSGISDIKKKDTKEGAIVTLVNYNTDNCASHMFMYSTQNCGIHLWDTRSNSNTWTLKAIP 1207
            YSGI+DIKKKD KEGAI++L+NY  DN AS + MYSTQNCGIHLWD R+N N WTLKA+P
Sbjct: 1131 YSGIADIKKKDVKEGAILSLLNYTADNSASQIVMYSTQNCGIHLWDIRANVNAWTLKAVP 1190

Query: 1208 EEGYVSSLVTGPCGNWFVSGSSRGVLTLWDLRFLVPVNSWQYSQVCPIEKMCLFVPPPNA 1267
            EEGYVSSLVTGPCGNWFVSGSSRGVLTLWDLRFL+PVNSWQYS VCPIEKMCLFVPP N 
Sbjct: 1191 EEGYVSSLVTGPCGNWFVSGSSRGVLTLWDLRFLIPVNSWQYSLVCPIEKMCLFVPPSNV 1250

Query: 1268 AVSTTARPLIYVAAGCNEVSLWNAENGSCHQVLRTANYDGDTEMSDLPWAFARPSSRSNP 1327
            AVS+ ARPLIYVAAGCNEVSLWNAENGSCHQVLR ANYD D EMSD+PWA ARPS + N 
Sbjct: 1251 AVSSAARPLIYVAAGCNEVSLWNAENGSCHQVLRLANYDNDAEMSDMPWALARPSGKVNF 1310

Query: 1328 KTDLRRNVNQKYRVDELNEPPPRLLGIRSLLPLPGGDLLTGGTDLKIRRWDHCSPGRSYC 1387
            K D RR VN KYRVDELN+PPPRLLGIRS+LPLPGGDLLTGGTDLKIRRWDH SP +SYC
Sbjct: 1311 KPDTRRKVNPKYRVDELNDPPPRLLGIRSMLPLPGGDLLTGGTDLKIRRWDHFSPKQSYC 1370

Query: 1388 ICGPNLKGVGNDEFYETRSSSGVQVVQERKRQPLTSKLTAKAVLAAAATDSAGCHRDSIL 1447
            ICGPNL GVG+D+ YE RSS GVQ+VQE K + L + +TAKAV+AAAATDSAGCHRDSIL
Sbjct: 1371 ICGPNLNGVGSDDSYEIRSSYGVQIVQETKGRHLNNTMTAKAVIAAAATDSAGCHRDSIL 1430

Query: 1448 SLGSVKLNQRLLISSSRDGAIKVWK 1472
            SL SVKLNQRLLISSSRDGAIKVWK
Sbjct: 1431 SLASVKLNQRLLISSSRDGAIKVWK 1455

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359484532|ref|XP_002280317.2| PREDICTED: phosphoinositide 3-kinase regulatory subunit 4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356497575|ref|XP_003517635.1| PREDICTED: phosphoinositide 3-kinase regulatory subunit 4-like [Glycine max] Back     alignment and taxonomy information
>gi|356520822|ref|XP_003529059.1| PREDICTED: phosphoinositide 3-kinase regulatory subunit 4-like [Glycine max] Back     alignment and taxonomy information
>gi|449435788|ref|XP_004135676.1| PREDICTED: phosphoinositide 3-kinase regulatory subunit 4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449489804|ref|XP_004158421.1| PREDICTED: LOW QUALITY PROTEIN: phosphoinositide 3-kinase regulatory subunit 4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297803098|ref|XP_002869433.1| kinase family protein [Arabidopsis lyrata subsp. lyrata] gi|297315269|gb|EFH45692.1| kinase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15233564|ref|NP_194667.1| phosphoinositide-3-kinase, regulatory subunit 4, p150 [Arabidopsis thaliana] gi|7269836|emb|CAB79696.1| putative protein [Arabidopsis thaliana] gi|332660224|gb|AEE85624.1| phosphoinositide-3-kinase, regulatory subunit 4, p150 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224088049|ref|XP_002308305.1| predicted protein [Populus trichocarpa] gi|222854281|gb|EEE91828.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297738742|emb|CBI27987.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1472
TAIR|locus:21182341494 VPS15 "vacuolar protein sortin 0.775 0.764 0.671 0.0
DICTYBASE|DDB_G0282627 1966 vps15 "VPS15 family protein ki 0.184 0.138 0.469 1.1e-141
UNIPROTKB|E2QZF51358 PIK3R4 "Uncharacterized protei 0.251 0.272 0.339 8.9e-137
MGI|MGI:19229191358 Pik3r4 "phosphatidylinositol 3 0.25 0.270 0.340 1.2e-135
ZFIN|ZDB-GENE-050309-841386 pik3r4 "phosphoinositide-3-kin 0.144 0.152 0.504 1.4e-135
RGD|13118091358 Pik3r4 "phosphoinositide-3-kin 0.251 0.272 0.336 5.2e-135
UNIPROTKB|Q995701358 PIK3R4 "Phosphoinositide 3-kin 0.251 0.272 0.336 1.3e-134
UNIPROTKB|A6QLW11358 PIK3R4 "PIK3R4 protein" [Bos t 0.256 0.278 0.335 1.4e-134
UNIPROTKB|Q5R9I31358 PIK3R4 "Phosphoinositide 3-kin 0.251 0.272 0.334 9.9e-133
UNIPROTKB|I3LEJ81354 PIK3R4 "Uncharacterized protei 0.258 0.281 0.326 4.4e-130
TAIR|locus:2118234 VPS15 "vacuolar protein sorting 15" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 4015 (1418.4 bits), Expect = 0., Sum P(2) = 0.
 Identities = 780/1161 (67%), Positives = 923/1161 (79%)

Query:   322 GD--GKESNQCSNVKPMPEDVPNSTF-------SQDLRNSSVESSGELLQSISDAFRKNG 372
             GD  G +S   SN  PM       TF       S+DL  ++V S  E+  SISDA +KN 
Sbjct:   343 GDEIGVDSPVTSN--PMNASTVQETFANHKLNSSKDLIRNTVNSKDEIFYSISDALKKNR 400

Query:   373 HPFLKKITMNNLSSLMSEYDSQSDTFGMPFLPLPEDSMKCEGIVLIASLLCSCVRNVKLP 432
             HPFLKKITM++L +LMS YDS+SDT+G PFLP+ E +M+CEG+VLIAS+LCSC+RN+KLP
Sbjct:   401 HPFLKKITMDDLGTLMSLYDSRSDTYGTPFLPV-EGNMRCEGMVLIASMLCSCIRNIKLP 459

Query:   433 HYRRAAILLLKSSSLFIDDEDRLQRVLPHVIAMLSDPAAIVRCAALETLCDILPLVRNFP 492
             H RR AILLL+S SL+IDD+DRLQRVLP+V+A+LSDP AIVRCAA+ETLCDILPLVR+FP
Sbjct:   460 HLRREAILLLRSCSLYIDDDDRLQRVLPYVVALLSDPTAIVRCAAMETLCDILPLVRDFP 519

Query:   493 PSDAKIFPEYILPMLSMLPDDPEESVRICYASNIAKLALTAYGFLVHSIRLSEAGVLDKL 552
             PSDAKIFPEYI PMLSMLP+D EESVRICYASNIAKLALTAYGFL+HS +LS+ GVL++L
Sbjct:   520 PSDAKIFPEYIFPMLSMLPEDTEESVRICYASNIAKLALTAYGFLIHSFQLSDVGVLNEL 579

Query:   553 SAPHKSPSSSNETSVQLQRLNADVQLSQLRKSIAEVVQELVMGPKQTPSIRRALLQDIGN 612
             ++   S + ++ET   LQ+ N + QL QLRK+IAEVVQELVMGPKQTP++RRALLQDIG 
Sbjct:   580 NSQQISTTPASETPSHLQKANGNAQLQQLRKTIAEVVQELVMGPKQTPNVRRALLQDIGE 639

Query:   613 LCSFFGQRQSNDFLLPILPAFLNDRDEQLRAVFYGQIVYVCFFVGERSVEEYLLPYIEQA 672
             LC FFGQRQSNDFLLPILPAFLNDRDEQLR+VF+ +IVYVCFFVG+RSVEEYLLPYI+QA
Sbjct:   640 LCFFFGQRQSNDFLLPILPAFLNDRDEQLRSVFFEKIVYVCFFVGQRSVEEYLLPYIDQA 699

Query:   673 LSDATEAVIVNALDCLAILCKSGYLRKRILLEMIERAFPLLCYPSQWVRRSVVTFIAASS 732
             LSD TEAVIVNAL+CL+ LCKS +LRKR LL+MIE  +PLLCYPSQWVRR+VVTFIAASS
Sbjct:   700 LSDQTEAVIVNALECLSTLCKSSFLRKRALLQMIECVYPLLCYPSQWVRRAVVTFIAASS 759

Query:   733 ESLGAVDSYVFLAPVIRPFLRRQPASLASVKALLSCLKPPVSREVFYQVLENARSSDMLE 792
             E LGAVDSY F+APVIR +L R PAS+AS + LLSCLKPPV+REV Y++ E  R+ + + 
Sbjct:   760 ECLGAVDSYAFIAPVIRSYLSRLPASIASEEGLLSCLKPPVTREVVYRIFEKTRNPEFMA 819

Query:   793 RQRKIWYNTSSQSKQQETADLLKRGAEDLSSIKCWPDKQQSSEGHRPAGDTSKQPEFAQS 852
             +QRK+WY++S QSK  E+ DL  + A +L+S++C  +++QS EG +     SKQPE    
Sbjct:   820 KQRKMWYSSSPQSKDWESVDLFDKDAGELNSVECRAEQKQSVEGKKQIKSASKQPEVQGK 879

Query:   853 DDNDGAKLRTLGSLVYNASSMADIRDPLCPEKLLFSGFMSQQVSGVNSLRCDKSSEGIPL 912
                  AKLR   +   NAS+  ++RDP+ PEKL FSGFM+  VSG NS       E IPL
Sbjct:   880 YAEKDAKLRIPRNPRPNASNTVELRDPVYPEKLQFSGFMAPYVSGANSFI---EPENIPL 936

Query:   913 YSFSMDKRAMGNLPVASDSVLQVNSLGIGSSTMPWMDTTNQSFSLASSVPPPNLVSGSFS 972
             YSFSMDKRA  N PVAS+S LQ+NSLG+GS ++PWMD+ ++SF+LASSVP P L+SGSF 
Sbjct:   937 YSFSMDKRAATNPPVASESSLQMNSLGMGSLSVPWMDSMSKSFNLASSVPVPKLISGSFH 996

Query:   973 ISNGSKQFYRVVHEPEGRENDQMASVNCKFPEMGTSGTAKGSSINVEDASSPADLTGLPS 1032
             +    KQFYRVVHEPE RENDQ++S   KF ++G S ++K +S+  EDASSPADL G PS
Sbjct:   997 VGTNPKQFYRVVHEPESRENDQISSAISKFQDLGVSSSSKSASVTSEDASSPADLVGEPS 1056

Query:  1033 FVRTSSIPDSGWRPRGILVAHLQEHCSAVNEIAISHDHSFFVSASDDSTVKVWDSRKLEK 1092
               RTS +PDSGW+PRG+LVAHLQEH SAVN+IA S DHSFFVSASDDSTVKVWDSRKLEK
Sbjct:  1057 LSRTS-VPDSGWKPRGVLVAHLQEHRSAVNDIATSSDHSFFVSASDDSTVKVWDSRKLEK 1115

Query:  1093 DISFRSRLTYHLEGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHISRGLGNV-EKYSGI 1151
             DISFRSRLTYHLEGSR +CT MLR+S QVVVGA DG+IHMFS+DHISRGLGNV EKYSGI
Sbjct:  1116 DISFRSRLTYHLEGSRGMCTTMLRNSTQVVVGASDGVIHMFSIDHISRGLGNVVEKYSGI 1175

Query:  1152 SDIKKKDTKEGAIVTLVNYNTDNCASHMFMYSTQNCGIHLWDTRSNSNTWTLKAIPEEGY 1211
              DIKKKD KEGA+V+L+NY  D+ +  M MYSTQNCGIHLWDTRS+ + WTLKA PEEGY
Sbjct:  1176 VDIKKKDVKEGALVSLLNYTADSLSGPMVMYSTQNCGIHLWDTRSDLDAWTLKANPEEGY 1235

Query:  1212 VSSLVTGPCGNWFVSGSSRGVLTLWDLRFLVPVNSWQYSQVCPIEKMCLFVPPPNAAVST 1271
             VSSLVT PCGNWFVSGSSRGVLTLWDLRF VPVNSWQY  +CPIEKMCL   PP+ +VST
Sbjct:  1236 VSSLVTSPCGNWFVSGSSRGVLTLWDLRFRVPVNSWQYPIICPIEKMCLCFLPPSVSVST 1295

Query:  1272 TARPLIYVAAGCNEVSLWNAENGSCHQVLRTANYDGDTEMSDLPWAFARPSSRSNPKTDL 1331
             T +PLIYVAAGCNEVSLWNAE GSCHQVLR ANY+ +T++S+  W    PS++ NPK + 
Sbjct:  1296 TMKPLIYVAAGCNEVSLWNAEGGSCHQVLRVANYENETDVSEFQWKL--PSNKVNPKPNH 1353

Query:  1332 RRNVNQKYRVDELNEPPPRLLGIRSXXXXXXXXXXXXXXXXKIRRWDHCSPGRSYCICGP 1391
             R+N++ KYR++ELNEPPPRL GIRS                KIRRWD+ SP RSYCICGP
Sbjct:  1354 RQNMSSKYRIEELNEPPPRLPGIRSLLPLPGGDLLTGGTDLKIRRWDYSSPERSYCICGP 1413

Query:  1392 NLKGVGNDEFYETRSSSGVQVVQERKRQPXXXXXXXXXXXXXXXXXXXGCHRDSILSLGS 1451
             +LKGVGND+FYE ++++GVQ VQE KR+P                   GCHRDS+ SL S
Sbjct:  1414 SLKGVGNDDFYELKTNTGVQFVQETKRRPLATKLTAKAVLAAAATDTAGCHRDSVQSLAS 1473

Query:  1452 VKLNQRLLISSSRDGAIKVWK 1472
             VKLNQRLLISSSRDGAIKVWK
Sbjct:  1474 VKLNQRLLISSSRDGAIKVWK 1494
GO:0004672 "protein kinase activity" evidence=IEA;ISS
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005794 "Golgi apparatus" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0080008 "Cul4-RING ubiquitin ligase complex" evidence=ISS
GO:0005737 "cytoplasm" evidence=IDA
GO:0009555 "pollen development" evidence=IMP
GO:0009846 "pollen germination" evidence=IMP
GO:0000303 "response to superoxide" evidence=RCA
GO:0006635 "fatty acid beta-oxidation" evidence=RCA
GO:0006869 "lipid transport" evidence=RCA
GO:0006891 "intra-Golgi vesicle-mediated transport" evidence=RCA
GO:0007165 "signal transduction" evidence=RCA
GO:0008219 "cell death" evidence=RCA
GO:0009630 "gravitropism" evidence=RCA
GO:0009755 "hormone-mediated signaling pathway" evidence=RCA
GO:0009863 "salicylic acid mediated signaling pathway" evidence=RCA
GO:0009873 "ethylene mediated signaling pathway" evidence=RCA
GO:0010351 "lithium ion transport" evidence=RCA
GO:0016558 "protein import into peroxisome matrix" evidence=RCA
GO:0044265 "cellular macromolecule catabolic process" evidence=RCA
GO:0048573 "photoperiodism, flowering" evidence=RCA
DICTYBASE|DDB_G0282627 vps15 "VPS15 family protein kinase Vps15" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|E2QZF5 PIK3R4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1922919 Pik3r4 "phosphatidylinositol 3 kinase, regulatory subunit, polypeptide 4, p150" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050309-84 pik3r4 "phosphoinositide-3-kinase, regulatory subunit 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1311809 Pik3r4 "phosphoinositide-3-kinase, regulatory subunit 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q99570 PIK3R4 "Phosphoinositide 3-kinase regulatory subunit 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A6QLW1 PIK3R4 "PIK3R4 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R9I3 PIK3R4 "Phosphoinositide 3-kinase regulatory subunit 4" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|I3LEJ8 PIK3R4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.7.11.1LOW CONFIDENCE prediction!
3rd Layer2.7.110.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh2_kg.7__1252__AT4G29380.1
annotation not avaliable (1494 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
fgenesh2_kg.2__412__AT1G60490.1
annotation not avaliable (813 aa)
   •••• 0.862
fgenesh2_kg.5__77__AT2G01690.2
annotation not avaliable (744 aa)
     •• 0.499

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1472
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 2e-21
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 1e-19
pfam00069260 pfam00069, Pkinase, Protein kinase domain 3e-14
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 1e-13
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-13
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 5e-13
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 1e-11
cd07833288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 7e-11
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 4e-10
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 5e-10
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 6e-10
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 6e-10
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 1e-09
cd07847286 cd07847, STKc_CDKL1_4, Catalytic domain of the Ser 1e-09
cd07864302 cd07864, STKc_CDK12, Catalytic domain of the Serin 3e-09
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 3e-09
cd07836284 cd07836, STKc_Pho85, Catalytic domain of the Serin 3e-09
cd07838287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 1e-08
cd07831282 cd07831, STKc_MOK, Catalytic domain of the Serine/ 1e-08
cd07830283 cd07830, STKc_MAK_like, Catalytic domain of Male g 2e-08
cd07845309 cd07845, STKc_CDK10, Catalytic domain of the Serin 3e-08
cd07832286 cd07832, STKc_CCRK, Catalytic domain of the Serine 4e-08
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 8e-08
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 9e-08
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 1e-07
smart0032040 smart00320, WD40, WD40 repeats 2e-07
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 2e-07
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 3e-07
cd07846286 cd07846, STKc_CDKL2_3, Catalytic domain of the Ser 5e-07
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 5e-07
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 6e-07
cd07841298 cd07841, STKc_CDK7, Catalytic domain of the Serine 7e-07
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 8e-07
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 9e-07
cd08221256 cd08221, STKc_Nek9, Catalytic domain of the Protei 1e-06
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-06
cd08220256 cd08220, STKc_Nek8, Catalytic domain of the Protei 3e-06
cd07866311 cd07866, STKc_BUR1, Catalytic domain of the Serine 4e-06
cd07848287 cd07848, STKc_CDKL5, Catalytic domain of the Serin 5e-06
cd07852337 cd07852, STKc_MAPK15, Catalytic domain of the Seri 9e-06
PTZ00036440 PTZ00036, PTZ00036, glycogen synthase kinase; Prov 2e-05
cd07843293 cd07843, STKc_CDC2L1, Catalytic domain of the Seri 3e-05
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 3e-05
cd08219255 cd08219, STKc_Nek3, Catalytic domain of the Protei 5e-05
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 6e-05
PTZ00283496 PTZ00283, PTZ00283, serine/threonine protein kinas 6e-05
cd07859338 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of 9e-05
cd08218256 cd08218, STKc_Nek1, Catalytic domain of the Protei 1e-04
cd07837295 cd07837, STKc_CdkB_plant, Catalytic domain of the 1e-04
cd07865310 cd07865, STKc_CDK9, Catalytic domain of the Serine 2e-04
cd08225257 cd08225, STKc_Nek5, Catalytic domain of the Protei 2e-04
cd07863288 cd07863, STKc_CDK4, Catalytic domain of the Serine 3e-04
cd07871288 cd07871, STKc_PCTAIRE3, Catalytic domain of the Se 3e-04
cd07834330 cd07834, STKc_MAPK, Catalytic domain of the Serine 4e-04
cd07835283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 6e-04
cd07862290 cd07862, STKc_CDK6, Catalytic domain of the Serine 6e-04
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 7e-04
PLN00009294 PLN00009, PLN00009, cyclin-dependent kinase A; Pro 7e-04
cd07872309 cd07872, STKc_PCTAIRE2, Catalytic domain of the Se 0.001
cd07860284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 0.001
cd05609305 cd05609, STKc_MAST, Catalytic domain of the Protei 0.001
PHA03211461 PHA03211, PHA03211, serine/threonine kinase US3; P 0.001
cd08528269 cd08528, STKc_Nek10, Catalytic domain of the Prote 0.001
cd08224267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 0.001
cd05580290 cd05580, STKc_PKA, Catalytic domain of the Protein 0.002
cd07839284 cd07839, STKc_CDK5, Catalytic domain of the Serine 0.002
pfam0298531 pfam02985, HEAT, HEAT repeat 0.003
cd07874355 cd07874, STKc_JNK3, Catalytic domain of the Serine 0.004
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 0.004
cd07873301 cd07873, STKc_PCTAIRE1, Catalytic domain of the Se 0.004
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information 
 Score = 95.3 bits (238), Expect = 2e-21
 Identities = 49/189 (25%), Positives = 76/189 (40%), Gaps = 28/189 (14%)

Query: 29  SLRDRLSTPPFLSLVEKKWLAFQLLLAVKQCHEKGICHGDIKCENVLVTSWNWLYLSDF- 87
            L D L     LS  E ++   Q+L A++  H KGI H D+K EN+L+     + L+DF 
Sbjct: 83  DLFDLLKKRGRLSEDEARFYLRQILSALEYLHSKGIVHRDLKPENILLDEDGHVKLADFG 142

Query: 88  -ASFKPTYIPYDDPSDFSFFFDTGGKRLCYLAPERFYEHGGEMQVAQDAPLKPSMDIFAV 146
            A         D     + F  T      Y+APE          V        ++DI+++
Sbjct: 143 LARQ------LDPGEKLTTFVGT----PEYMAPE----------VLLGKGYGKAVDIWSL 182

Query: 147 GCVIAELFL-EVPFFELSHLLAY----RRGQYDPSQHLEKIPDSGIRKMILHMIQLEPEL 201
           G ++ EL   + PF     LL       + +         I       +I  ++  +PE 
Sbjct: 183 GVILYELLTGKPPFPGDDQLLELFKKIGKPKPPFPPPEWDISPEAKD-LIRKLLVKDPEK 241

Query: 202 RFSAESYLQ 210
           R +AE  LQ
Sbjct: 242 RLTAEEALQ 250

Phosphotransferases. Serine or threonine-specific kinase subfamily. Length = 254
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>gnl|CDD|173333 PTZ00036, PTZ00036, glycogen synthase kinase; Provisional Back     alignment and domain information
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional Back     alignment and domain information
>gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>gnl|CDD|223009 PHA03211, PHA03211, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|202500 pfam02985, HEAT, HEAT repeat Back     alignment and domain information
>gnl|CDD|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1472
KOG12401431 consensus Protein kinase containing WD40 repeats [ 100.0
PLN00181793 protein SPA1-RELATED; Provisional 100.0
KOG0615475 consensus Serine/threonine protein kinase Chk2 and 100.0
KOG0575592 consensus Polo-like serine/threonine protein kinas 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0581364 consensus Mitogen-activated protein kinase kinase 100.0
KOG0592604 consensus 3-phosphoinositide-dependent protein kin 100.0
KOG0588786 consensus Serine/threonine protein kinase [Cell cy 100.0
KOG0599411 consensus Phosphorylase kinase gamma subunit [Carb 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0598357 consensus Ribosomal protein S6 kinase and related 100.0
KOG0661538 consensus MAPK related serine/threonine protein ki 100.0
KOG0593396 consensus Predicted protein kinase KKIAMRE [Genera 100.0
KOG0591375 consensus NIMA (never in mitosis)-related G2-speci 100.0
KOG0595429 consensus Serine/threonine-protein kinase involved 100.0
KOG0583370 consensus Serine/threonine protein kinase [Signal 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0611668 consensus Predicted serine/threonine protein kinas 100.0
KOG0616355 consensus cAMP-dependent protein kinase catalytic 100.0
KOG0033355 consensus Ca2+/calmodulin-dependent protein kinase 99.98
KOG0600560 consensus Cdc2-related protein kinase [Cell cycle 99.98
KOG0660359 consensus Mitogen-activated protein kinase [Signal 99.98
KOG0597808 consensus Serine-threonine protein kinase FUSED [G 99.98
KOG0582516 consensus Ste20-like serine/threonine protein kina 99.98
KOG0659318 consensus Cdk activating kinase (CAK)/RNA polymera 99.98
KOG0198313 consensus MEKK and related serine/threonine protei 99.97
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.97
KOG0605550 consensus NDR and related serine/threonine kinases 99.97
KOG4717864 consensus Serine/threonine protein kinase [Signal 99.97
KOG0578550 consensus p21-activated serine/threonine protein k 99.97
KOG0604400 consensus MAP kinase-activated protein kinase 2 [S 99.97
KOG0663419 consensus Protein kinase PITSLRE and related kinas 99.97
KOG0658364 consensus Glycogen synthase kinase-3 [Carbohydrate 99.97
KOG0295406 consensus WD40 repeat-containing protein [Function 99.97
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.97
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.97
KOG0594323 consensus Protein kinase PCTAIRE and related kinas 99.97
KOG0585576 consensus Ca2+/calmodulin-dependent protein kinase 99.97
KOG0192362 consensus Tyrosine kinase specific for activated ( 99.97
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.97
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 99.97
KOG0596677 consensus Dual specificity; serine/threonine and t 99.97
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.96
KOG0694694 consensus Serine/threonine protein kinase [Signal 99.96
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.96
KOG0589426 consensus Serine/threonine protein kinase [General 99.96
KOG4721904 consensus Serine/threonine protein kinase, contain 99.96
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.96
PTZ00263329 protein kinase A catalytic subunit; Provisional 99.96
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 99.96
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.96
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.96
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 99.96
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.96
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.96
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.96
KOG0315311 consensus G-protein beta subunit-like protein (con 99.96
KOG0610459 consensus Putative serine/threonine protein kinase 99.96
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.96
KOG0607463 consensus MAP kinase-interacting kinase and relate 99.96
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.96
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.96
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.96
KOG42791226 consensus Serine/threonine protein kinase [Signal 99.96
KOG0296399 consensus Angio-associated migratory cell protein 99.96
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.96
PTZ00267478 NIMA-related protein kinase; Provisional 99.96
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.96
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.96
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.96
KOG0032382 consensus Ca2+/calmodulin-dependent protein kinase 99.96
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.96
KOG0586596 consensus Serine/threonine protein kinase [General 99.96
KOG46451509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 99.96
KOG0201467 consensus Serine/threonine protein kinase [Signal 99.96
PHA03212391 serine/threonine kinase US3; Provisional 99.96
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.96
KOG0293519 consensus WD40 repeat-containing protein [Function 99.96
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.96
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.96
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.96
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.96
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.96
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.96
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.96
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.96
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.96
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 99.96
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.96
KOG0667586 consensus Dual-specificity tyrosine-phosphorylatio 99.96
KOG0315311 consensus G-protein beta subunit-like protein (con 99.96
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.96
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.95
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.95
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.95
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.95
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.95
PHA02988283 hypothetical protein; Provisional 99.95
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.95
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.95
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.95
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.95
PHA03207392 serine/threonine kinase US3; Provisional 99.95
KOG0266456 consensus WD40 repeat-containing protein [General 99.95
KOG0666438 consensus Cyclin C-dependent kinase CDK8 [Transcri 99.95
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.95
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 99.95
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.95
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.95
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.95
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.95
KOG1989738 consensus ARK protein kinase family [Signal transd 99.95
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 99.95
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.95
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.95
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.95
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.95
PTZ00036440 glycogen synthase kinase; Provisional 99.95
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.95
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.95
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.95
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.95
KOG0197468 consensus Tyrosine kinases [Signal transduction me 99.95
PHA03211461 serine/threonine kinase US3; Provisional 99.95
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 99.95
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.95
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.95
KOG05791187 consensus Ste20-like serine/threonine protein kina 99.95
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.95
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.95
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.95
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.95
PLN00034353 mitogen-activated protein kinase kinase; Provision 99.95
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.95
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 99.95
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.95
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.95
PHA03209357 serine/threonine kinase US3; Provisional 99.95
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.95
KOG0577948 consensus Serine/threonine protein kinase [Signal 99.95
KOG2345302 consensus Serine/threonine protein kinase/TGF-beta 99.95
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.95
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.95
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 99.95
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.94
PTZ00284467 protein kinase; Provisional 99.94
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.94
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.94
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.94
KOG0669376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 99.94
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.94
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.94
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.94
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 99.94
KOG0263707 consensus Transcription initiation factor TFIID, s 99.94
KOG0662292 consensus Cyclin-dependent kinase CDK5 [Intracellu 99.94
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.94
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.94
KOG0690516 consensus Serine/threonine protein kinase [Signal 99.94
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.94
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.94
PTZ00283496 serine/threonine protein kinase; Provisional 99.94
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.94
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.94
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.94
KOG0983391 consensus Mitogen-activated protein kinase (MAPK) 99.94
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.94
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.94
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.94
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.94
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.94
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.94
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.94
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.94
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.94
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.94
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.94
KOG0584632 consensus Serine/threonine protein kinase [General 99.94
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.94
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 99.94
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.94
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.94
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.94
KOG0614732 consensus cGMP-dependent protein kinase [Signal tr 99.94
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.94
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.94
KOG0645312 consensus WD40 repeat protein [General function pr 99.94
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.94
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.94
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.94
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.94
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.94
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.94
KOG0665369 consensus Jun-N-terminal kinase (JNK) [Signal tran 99.94
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.94
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.94
KOG0193678 consensus Serine/threonine protein kinase RAF [Sig 99.94
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.94
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.94
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.94
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.94
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.94
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.94
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.94
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.94
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.94
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.94
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 99.94
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.94
KOG0574502 consensus STE20-like serine/threonine kinase MST [ 99.94
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.94
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 99.94
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.94
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.94
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.94
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.94
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.94
PTZ002661021 NIMA-related protein kinase; Provisional 99.94
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.94
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.94
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.93
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.93
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.93
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.93
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.93
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.93
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.93
KOG0986591 consensus G protein-coupled receptor kinase [Signa 99.93
PHA03210501 serine/threonine kinase US3; Provisional 99.93
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 99.93
KOG06121317 consensus Rho-associated, coiled-coil containing p 99.93
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.93
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.93
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.93
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.93
KOG0263707 consensus Transcription initiation factor TFIID, s 99.93
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.93
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.93
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.93
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.93
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.93
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.93
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.93
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.93
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.93
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.93
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.93
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.93
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.93
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.93
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.93
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.93
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.93
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.93
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.93
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.93
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.93
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.93
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.93
KOG0286343 consensus G-protein beta subunit [General function 99.93
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.93
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.93
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.93
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.93
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.93
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.93
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 99.93
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.93
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.93
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.93
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.93
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.93
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.93
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.93
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.93
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.93
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.93
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.93
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.93
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 99.93
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.93
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.93
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.93
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.93
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.93
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.93
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.93
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.93
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.93
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.93
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.93
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.93
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.93
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.93
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.93
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.93
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.93
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.93
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.93
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.93
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.93
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.93
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.93
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.93
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.93
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.93
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.93
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.93
KOG1026774 consensus Nerve growth factor receptor TRKA and re 99.93
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 99.93
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.93
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.93
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.93
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.93
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.93
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.93
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.93
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.93
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.93
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.93
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.93
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.93
PTZ00024335 cyclin-dependent protein kinase; Provisional 99.93
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.92
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.92
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.92
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.92
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.92
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 99.92
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.92
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.92
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.92
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.92
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.92
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.92
PLN00009294 cyclin-dependent kinase A; Provisional 99.92
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.92
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.92
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.92
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.92
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.92
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.92
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.92
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.92
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.92
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.92
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.92
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.92
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.92
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.92
KOG0696683 consensus Serine/threonine protein kinase [Signal 99.92
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.92
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.92
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.92
KOG4236888 consensus Serine/threonine protein kinase PKC mu/P 99.92
PHA02882294 putative serine/threonine kinase; Provisional 99.92
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.92
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.92
KOG0643327 consensus Translation initiation factor 3, subunit 99.92
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.92
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.92
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.92
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.92
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.92
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.92
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.92
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.92
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.92
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.92
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.92
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.92
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.92
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.92
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.92
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.92
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.92
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.92
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.92
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.92
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.92
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.92
KOG0194474 consensus Protein tyrosine kinase [Signal transduc 99.92
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.92
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.92
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.92
KOG0295406 consensus WD40 repeat-containing protein [Function 99.92
KOG1027903 consensus Serine/threonine protein kinase and endo 99.92
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.92
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.91
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.91
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.91
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.91
KOG1187361 consensus Serine/threonine protein kinase [Signal 99.91
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.91
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.91
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.91
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.91
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.91
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.91
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.91
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.91
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.91
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.91
KOG1151775 consensus Tousled-like protein kinase [Signal tran 99.91
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.91
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 99.91
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 99.91
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.91
KOG0645312 consensus WD40 repeat protein [General function pr 99.91
KOG1006361 consensus Mitogen-activated protein kinase (MAPK) 99.91
KOG0671415 consensus LAMMER dual specificity kinases [Signal 99.91
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.91
KOG0318 603 consensus WD40 repeat stress protein/actin interac 99.91
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.91
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.91
KOG0266456 consensus WD40 repeat-containing protein [General 99.91
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.91
KOG0643327 consensus Translation initiation factor 3, subunit 99.91
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.9
KOG06081034 consensus Warts/lats-like serine threonine kinases 99.9
KOG10351351 consensus eIF-2alpha kinase GCN2 [Translation, rib 99.9
KOG10951025 consensus Protein tyrosine kinase [Signal transduc 99.9
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.9
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 99.9
KOG0695593 consensus Serine/threonine protein kinase [Signal 99.9
KOG0293519 consensus WD40 repeat-containing protein [Function 99.9
KOG4257974 consensus Focal adhesion tyrosine kinase FAK, cont 99.9
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.9
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.89
cd05610669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.89
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.89
KOG0296399 consensus Angio-associated migratory cell protein 99.89
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.89
KOG1094807 consensus Discoidin domain receptor DDR1 [Signal t 99.89
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.89
KOG0664449 consensus Nemo-like MAPK-related serine/threonine 99.89
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.89
PLN00181793 protein SPA1-RELATED; Provisional 99.89
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.89
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.89
KOG0310 487 consensus Conserved WD40 repeat-containing protein 99.89
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.89
KOG0587953 consensus Traf2- and Nck-interacting kinase and re 99.89
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.88
KOG0670752 consensus U4/U6-associated splicing factor PRP4 [R 99.88
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 99.88
KOG0668338 consensus Casein kinase II, alpha subunit [Signal 99.88
KOG0196996 consensus Tyrosine kinase, EPH (ephrin) receptor f 99.88
KOG42781157 consensus Protein tyrosine kinase [Signal transduc 99.88
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.88
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.88
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.88
KOG0984282 consensus Mitogen-activated protein kinase (MAPK) 99.88
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.87
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.87
KOG0300481 consensus WD40 repeat-containing protein [Function 99.87
KOG0283712 consensus WD40 repeat-containing protein [Function 99.87
KOG0289506 consensus mRNA splicing factor [General function p 99.87
KOG4250732 consensus TANK binding protein kinase TBK1 [Signal 99.87
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.87
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.87
PTZ00420568 coronin; Provisional 99.87
PTZ00421 493 coronin; Provisional 99.87
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.87
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.87
KOG1152772 consensus Signal transduction serine/threonine kin 99.86
PTZ00421493 coronin; Provisional 99.86
KOG4283397 consensus Transcription-coupled repair protein CSA 99.86
KOG01991039 consensus ACK and related non-receptor tyrosine ki 99.86
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.86
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.86
KOG2096420 consensus WD40 repeat protein [General function pr 99.86
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.86
KOG0289506 consensus mRNA splicing factor [General function p 99.86
KOG0772641 consensus Uncharacterized conserved protein, conta 99.86
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.85
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.85
PTZ00420 568 coronin; Provisional 99.85
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.85
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.85
KOG0200609 consensus Fibroblast/platelet-derived growth facto 99.85
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.85
KOG0639705 consensus Transducin-like enhancer of split protei 99.84
KOG3653534 consensus Transforming growth factor beta/activin 99.84
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.84
KOG0641350 consensus WD40 repeat protein [General function pr 99.84
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 99.84
PLN03224507 probable serine/threonine protein kinase; Provisio 99.84
KOG10251177 consensus Epidermal growth factor receptor EGFR an 99.83
KOG0294362 consensus WD40 repeat-containing protein [Function 99.83
KOG1345378 consensus Serine/threonine kinase [Signal transduc 99.83
KOG0300481 consensus WD40 repeat-containing protein [Function 99.83
KOG0294362 consensus WD40 repeat-containing protein [Function 99.83
KOG0641350 consensus WD40 repeat protein [General function pr 99.83
KOG0646 476 consensus WD40 repeat protein [General function pr 99.82
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.82
KOG0576829 consensus Mitogen-activated protein kinase kinase 99.82
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.82
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.81
KOG2052513 consensus Activin A type IB receptor, serine/threo 99.81
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=1.7e-211  Score=1892.56  Aligned_cols=1327  Identities=40%  Similarity=0.620  Sum_probs=974.9

Q ss_pred             CCCCCcceeeEEEEeCCeEEEEecccCCcHHHHHhCCCCCCHHHHHHHHHHHHHHHHHHHHCCCeecCCCCCCEEEccCC
Q 000470            1 MSSTPCVHKKFWQETDKAAYLLRQYFFNSLRDRLSTPPFLSLVEKKWLAFQLLLAVKQCHEKGICHGDIKCENVLVTSWN   80 (1472)
Q Consensus         1 l~HpNIv~~~~~~~~~~~~~lV~Ey~~gsL~d~l~~~~~l~~~~~~~i~~Qll~aL~~LH~~gIvH~DLKpeNILv~~~~   80 (1472)
                      ++|||+++|..+.+++++.|||++|+..+|||+|+.||+|...|++||++||++||..||+.||+|||||.|||||++|+
T Consensus        78 ~~~pn~lPfqk~~~t~kAAylvRqyvkhnLyDRlSTRPFL~~iEKkWiaFQLL~al~qcH~~gVcHGDIKsENILiTSWN  157 (1431)
T KOG1240|consen   78 MKAPNCLPFQKVLVTDKAAYLVRQYVKHNLYDRLSTRPFLVLIEKKWIAFQLLKALSQCHKLGVCHGDIKSENILITSWN  157 (1431)
T ss_pred             hcCCcccchHHHHHhhHHHHHHHHHHhhhhhhhhccchHHHHHHHHHHHHHHHHHHHHHHHcCccccccccceEEEeeec
Confidence            57999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cEEEEeccccccccCCCCCCCCCceeeccCCCCccccCcccccccCCccccccCCC-CCccchHHHHHHHHHHHHhC-CC
Q 000470           81 WLYLSDFASFKPTYIPYDDPSDFSFFFDTGGKRLCYLAPERFYEHGGEMQVAQDAP-LKPSMDIFAVGCVIAELFLE-VP  158 (1472)
Q Consensus        81 ~vkL~DFg~a~~~~~~~~~~~~~~~~~~~~~gt~~Y~APE~~~~~~~~~~~~~~~~-~t~~~DIwSlG~il~eLltg-~~  158 (1472)
                      |+.|+||+.+||+++|+|+|++|.+||+|++++.||+|||+|....+...+.+... ++++|||||+||+++|||+. .|
T Consensus       158 W~~LtDFAsFKPtYLPeDNPadf~fFFDTSrRRtCYiAPERFv~~~~~~~~~q~~~~L~paMDIFS~GCViaELf~Eg~P  237 (1431)
T KOG1240|consen  158 WLYLTDFASFKPTYLPEDNPADFTFFFDTSRRRTCYIAPERFVSALGKTSVGQDAPLLTPAMDIFSAGCVIAELFLEGRP  237 (1431)
T ss_pred             hhhhhcccccCCccCCCCCcccceEEEecCCceeeecChHhhhccccccccCCcccccChhhhhhhhhHHHHHHHhcCCC
Confidence            99999999999999999999999999999999999999999997664444445555 89999999999999999986 99


Q ss_pred             CCCchHHHHHHhc-CCCCCcccCCCCCHHHHHHHHHhcccCcCCCCCHHHHHHHhhcccCCCCCChhhhhhhhccCCCCC
Q 000470          159 FFELSHLLAYRRG-QYDPSQHLEKIPDSGIRKMILHMIQLEPELRFSAESYLQNYAAVVFPTYFSPFLHNFYCCWNPLHS  237 (1472)
Q Consensus       159 pf~~~~~~~~~~~-~~~~~~~l~~~~~~~l~~LI~~mL~~dP~~Rpsa~elL~~~~~~~fp~~f~~~l~~~~~~~~~~~~  237 (1472)
                      +|+++++.+|+++ .+.+...+.++.+..+++||..|+++||++|.+|+++|+.+++..||+|||+||++|+.++.++..
T Consensus       238 lF~LSQL~aYr~~~~~~~e~~Le~Ied~~~Rnlil~Mi~rdPs~RlSAedyL~~yrG~~FP~yFy~FL~~Y~~~~~~~~~  317 (1431)
T KOG1240|consen  238 LFTLSQLLAYRSGNADDPEQLLEKIEDVSLRNLILSMIQRDPSKRLSAEDYLQKYRGLVFPEYFYSFLYDYLDRFVPLTT  317 (1431)
T ss_pred             cccHHHHHhHhccCccCHHHHHHhCcCccHHHHHHHHHccCchhccCHHHHHHhhhccccHHHHHHHHHHHHHhcCCccc
Confidence            9999999999998 555667888999999999999999999999999999999999999999999999999999988763


Q ss_pred             cchhhhhccchHHHHHhhhCCCCCCCCCCCCCCCCccCchhhHHHHHHHHhHHHHHHHhhHHHHHhhhcccchhhhcccc
Q 000470          238 DMRVAMCRSVFPEILKQMMGNKSSEDIGSGVGTPSTAMSVKESQERVTKQNLNLAKALLEKREEMEKGRVQNRFRLLGDI  317 (1472)
Q Consensus       238 ~~r~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  317 (1472)
                      ...+.             ...-....++.         .++..++-.++                          .+.|+
T Consensus       318 ~~p~~-------------~~~~~gs~i~d---------~~~~~~~p~n~--------------------------~~~~~  349 (1431)
T KOG1240|consen  318 STPIS-------------DNTCTGSTIED---------NVKLLDGPTNK--------------------------IYRDF  349 (1431)
T ss_pred             cCccc-------------cccccCccccc---------ccccccCcccc--------------------------hhhhh
Confidence            22211             01111111110         00000000011                          22344


Q ss_pred             cccccCCCCCCccCCCCCCCCCCCCCcccccccCccccccchhhhhhhhhhhcCCCCcccccccccccccccccCCCCCC
Q 000470          318 STLIGDGKESNQCSNVKPMPEDVPNSTFSQDLRNSSVESSGELLQSISDAFRKNGHPFLKKITMNNLSSLMSEYDSQSDT  397 (1472)
Q Consensus       318 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  397 (1472)
                      ..+|+.....-.+.                 .+.  ..+.++.+..+.+....+.+++.......++-.....|++.++.
T Consensus       350 ~~~~h~ln~~~~~~-----------------~~~--~~S~De~~~~~~~al~~~r~~~~~l~~~~dl~~~~q~~~~~~~~  410 (1431)
T KOG1240|consen  350 SQICHCLNFPLIKD-----------------GGT--ITSSDEIIDSISKALEFSRHLIENLDVIQDLKPEKQLWTARSSP  410 (1431)
T ss_pred             hccccccccccccc-----------------ccc--ccCCcHHHHHHHHHHhhhhhhcccchhhhccchHHhcccccCCc
Confidence            44444433211110                 000  01122333333333322222222222222221222244443322


Q ss_pred             CCCCCCCCCCCCcccccchhhhHHHHhhhcccCCchhHHHHHHHHHHHhccCCcccccccccceeeecccCCcchhHHHH
Q 000470          398 FGMPFLPLPEDSMKCEGIVLIASLLCSCVRNVKLPHYRRAAILLLKSSSLFIDDEDRLQRVLPHVIAMLSDPAAIVRCAA  477 (1472)
Q Consensus       398 ~~~~~~~~~~~~~~~~~~~i~ls~i~s~~R~~~~~~sk~~al~ll~~~s~~~~de~~ldrilPy~~~ll~d~~~~Vr~~a  477 (1472)
                      +        ....+++|++||+++||||||+++.+++|++||+||..||+|++||.||||||||+|+|+.|+.+.|||+|
T Consensus       411 ~--------~~~~~~~ga~l~vs~lts~IR~lk~~~tK~~ALeLl~~lS~~i~de~~LDRVlPY~v~l~~Ds~a~Vra~A  482 (1431)
T KOG1240|consen  411 N--------IKDPKEEGAVLFVSVLTSCIRALKTIQTKLAALELLQELSTYIDDEVKLDRVLPYFVHLLMDSEADVRATA  482 (1431)
T ss_pred             c--------cCCccccceeeeHHHHHHHHHhhhcchhHHHHHHHHHHHhhhcchHHHHhhhHHHHHHHhcCchHHHHHHH
Confidence            1        12467899999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhcccccccCCCCCcccccccccccCCCCCC-CCchhhHHHHhhhHHHHHHHHHHHHHHHHhhhcccccccCCCC
Q 000470          478 LETLCDILPLVRNFPPSDAKIFPEYILPMLSMLPDD-PEESVRICYASNIAKLALTAYGFLVHSIRLSEAGVLDKLSAPH  556 (1472)
Q Consensus       478 l~~lt~~l~~v~~~~~~~~~iF~eYilP~l~~l~~d-~~~~vr~~~A~~l~~La~~a~rfl~~~~~~~~~~~~~~~~~~~  556 (1472)
                      |+|||++|.+|+.+||+|+|||||||||.|++|+.| ...+||+|||+||+.||.||.||||.+|.++..|.++..++. 
T Consensus       483 l~Tlt~~L~~Vr~~~~~daniF~eYlfP~L~~l~~d~~~~~vRiayAsnla~LA~tA~rFle~~q~~~~~g~~n~~nse-  561 (1431)
T KOG1240|consen  483 LETLTELLALVRDIPPSDANIFPEYLFPHLNHLLNDSSAQIVRIAYASNLAQLAKTAYRFLELTQELRQAGMLNDPNSE-  561 (1431)
T ss_pred             HHHHHHHHhhccCCCcccchhhHhhhhhhhHhhhccCccceehhhHHhhHHHHHHHHHHHHHHHHHHHhcccccCcccc-
Confidence            999999999999999999999999999999999999 789999999999999999999999999999988877654321 


Q ss_pred             CCCCCCCccchhhhccChHHHHHHHHHHHHHHHHHHhcCCCCChHHHHHHHhcccchhcccCcccccccccccccccccC
Q 000470          557 KSPSSSNETSVQLQRLNADVQLSQLRKSIAEVVQELVMGPKQTPSIRRALLQDIGNLCSFFGQRQSNDFLLPILPAFLND  636 (1472)
Q Consensus       557 ~~~~~~~~~~~~~~~~~~~~~l~~l~~~i~~~~~~ll~~~d~~~~vk~all~~i~~Lc~FFG~~ktnd~iL~hlit~LNd  636 (1472)
                               ...+.  ++++++++|++.+++.|++||+|  +++.||||||++|.+||+||||+|+||+|||||||||||
T Consensus       562 ---------t~~~~--~~~~~~~~L~~~V~~~v~sLlsd--~~~~Vkr~Lle~i~~LC~FFGk~ksND~iLshLiTfLND  628 (1431)
T KOG1240|consen  562 ---------TAPEQ--NYNTELQALHHTVEQMVSSLLSD--SPPIVKRALLESIIPLCVFFGKEKSNDVILSHLITFLND  628 (1431)
T ss_pred             ---------ccccc--ccchHHHHHHHHHHHHHHHHHcC--CchHHHHHHHHHHHHHHHHhhhcccccchHHHHHHHhcC
Confidence                     11223  34679999999999999999995  679999999999999999999999999999999999999


Q ss_pred             CChhHHHHHHhccceeeeeeccchhhHhHHHHHHhhcCCCchHHHHHHHHHHHHHHHcCCCchHHHHHHHHhhccccccC
Q 000470          637 RDEQLRAVFYGQIVYVCFFVGERSVEEYLLPYIEQALSDATEAVIVNALDCLAILCKSGYLRKRILLEMIERAFPLLCYP  716 (1472)
Q Consensus       637 ~d~~LR~aff~~i~~v~~~vG~~s~e~~ilPll~q~l~D~ee~Vv~~~l~~l~~l~~~gL~~k~~~~~~~~~~~~ll~HP  716 (1472)
                      |||+||+||||+|+|||.||||+|+|+||||||+|||+|+||+||++||+||+.|||+|||+|+++.|++..|+||||||
T Consensus       629 kDw~LR~aFfdsI~gvsi~VG~rs~seyllPLl~Q~ltD~EE~Viv~aL~~ls~Lik~~ll~K~~v~~i~~~v~PlL~hP  708 (1431)
T KOG1240|consen  629 KDWRLRGAFFDSIVGVSIFVGWRSVSEYLLPLLQQGLTDGEEAVIVSALGSLSILIKLGLLRKPAVKDILQDVLPLLCHP  708 (1431)
T ss_pred             ccHHHHHHHHhhccceEEEEeeeeHHHHHHHHHHHhccCcchhhHHHHHHHHHHHHHhcccchHHHHHHHHhhhhheeCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cHHHHHHHHHHHHHHHhcCCccceeEEEeeccccccccCCCccCCHHHHHhccCCCCcHHHHHHHHHHhh-hchHHHHHh
Q 000470          717 SQWVRRSVVTFIAASSESLGAVDSYVFLAPVIRPFLRRQPASLASVKALLSCLKPPVSREVFYQVLENAR-SSDMLERQR  795 (1472)
Q Consensus       717 n~wIR~~~~~~i~~~~~~l~~ad~~c~l~P~l~p~l~~~~~~~~~~~~ll~~l~~p~sr~v~~~~~~~~~-~~~~~~~~~  795 (1472)
                      |.|||+++++||++++++|+.|||||+|||+|||||+.++.++.+++.|++||||||||+||+++++|.. ...-..-++
T Consensus       709 N~WIR~~~~~iI~~~~~~ls~advyc~l~P~irpfl~~~v~~i~s~~~LlsclkpPVsRsv~~~l~r~~~ens~f~k~l~  788 (1431)
T KOG1240|consen  709 NLWIRRAVLGIIAAIARQLSAADVYCKLMPLIRPFLERPVIQIESKEVLLSCLKPPVSRSVFNQLLRWSDENSSFWKKLL  788 (1431)
T ss_pred             hHHHHHHHHHHHHHHHhhhhhhhheEEeehhhHHhhhccHhhhcchHHHHHHhcCCCcHHHHHHHHHHhhcchHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999999999999999999986 222123334


Q ss_pred             hhhcccCCCchhhhhhHhhhcCCCcccccc---------cCCcccCCcCCCCCCCCCCCCCcccCCCcChhhhHhhcccc
Q 000470          796 KIWYNTSSQSKQQETADLLKRGAEDLSSIK---------CWPDKQQSSEGHRPAGDTSKQPEFAQSDDNDGAKLRTLGSL  866 (1472)
Q Consensus       796 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~kl~~~~~~  866 (1472)
                      ..|+..+.+++.|..++...+..+...+-.         ...+++++.++....       + -.+.+++.|+..+++.+
T Consensus       789 ~~~~~s~~~s~d~~~~~~~~k~~g~l~~~e~~~~~~~~~~~~~~i~S~~~~e~~-------e-~~l~~k~~~~~~~r~~~  860 (1431)
T KOG1240|consen  789 ERHYSSSGNSRDEFIKNYSSKRYGFLPFEEGAGSSKWSNTGFKKIKSEGKTELV-------E-DKLLEKDIFLIRSRKPK  860 (1431)
T ss_pred             HHhhhccCccchhhhhcchhhhcccCCccccccchhhhhhhcceeecccccccc-------c-cccchhchhhhcccCCc
Confidence            455555555555443222111111111111         111111111111110       0 01223344444444432


Q ss_pred             hhccCccccCCCCCCC-ccccccccccccccccCccccCCCCCCCCcccccccccccCCCCccccccccccccccCCCCC
Q 000470          867 VYNASSMADIRDPLCP-EKLLFSGFMSQQVSGVNSLRCDKSSEGIPLYSFSMDKRAMGNLPVASDSVLQVNSLGIGSSTM  945 (1472)
Q Consensus       867 ~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  945 (1472)
                      ........ -.+...+ +.....++...++.+.+...   .+..++..++..|....++...........+.+.+++.+.
T Consensus       861 ~~~s~~~~-l~d~~~~~~~~~~~~v~~~~~n~~~t~~---~P~~~~~~~~~~d~n~~~~~~~~~~~~n~~~~l~~~~~~~  936 (1431)
T KOG1240|consen  861 SNISNRVL-LDDPAYPRNTNGREGVLTRQVNLVGTII---EPSNIHARVRRKDSNREGNESNMESPQNSKHLLPIGSPNK  936 (1431)
T ss_pred             cchhhhhh-hcCcccccccCCceeeeccccccccccc---ccccchhhhhhhhccccCCCccccCCCcchhhccCCCCCc
Confidence            21111110 0111111 11111222222221111111   1222333333333222221111011111112222222111


Q ss_pred             CCCCcccCCCC-CCC-CCCCCCCccCCccccCCCCccceeeccCCCCCccc-cccccccCCCCCCCCCcccccccccCCC
Q 000470          946 PWMDTTNQSFS-LAS-SVPPPNLVSGSFSISNGSKQFYRVVHEPEGRENDQ-MASVNCKFPEMGTSGTAKGSSINVEDAS 1022 (1472)
Q Consensus       946 ~~~~~~~~~~~-~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1022 (1472)
                      .|.+  |.... +.. +.+-...+++++......+..+.+.+...++.+.+ ...+.+...++++...++.......+..
T Consensus       937 ~~~~--~~~~~t~~~~~~~vp~~ts~~~~~~t~~~~~~~~~p~~ns~~~~~~~r~~~~~~dL~~~~~~~~~~~ss~~~s~ 1014 (1431)
T KOG1240|consen  937 LNHT--GSPRSTLLLDGNSVPTLTSSSVRVVTNLKPTKPVMPVPNSTANNQVERSLTCLNDLEMLTVSIPKRPSSESISH 1014 (1431)
T ss_pred             cccc--CCCcccccccCCccceeeccceeeeeccCCcccccccCCCCcccchhHHHHHHHhhhhhhhhcccccchhhccc
Confidence            1111  11000 000 00001111222222222222222233333332221 1233444555565555554443333321


Q ss_pred             CCCCCCCCCccccccCCCCCCcccccceeeeccccccceeEEEEcCCC-CEEEEEeCCCCEEEEeCCCCccc-cccccce
Q 000470         1023 SPADLTGLPSFVRTSSIPDSGWRPRGILVAHLQEHCSAVNEIAISHDH-SFFVSASDDSTVKVWDSRKLEKD-ISFRSRL 1100 (1472)
Q Consensus      1023 ~~~~~~g~~~~~~~~~~~~~~W~p~G~lV~~l~~H~~~V~~lafspd~-~~laSgS~DGtVkvWD~~~~e~~-~~~~~~~ 1100 (1472)
                       .-.+.+.|..... ..++++|+|+|.+|+||+||+..|+.++.++++ .+|+|||+||+||+||+++.++. .++++++
T Consensus      1015 -p~~~~~ep~~~~~-~~p~~gW~p~G~lVAhL~Ehs~~v~k~a~s~~~~s~FvsgS~DGtVKvW~~~k~~~~~~s~rS~l 1092 (1431)
T KOG1240|consen 1015 -PCLLNSEPSAWSV-GSPPPGWNPRGILVAHLHEHSSAVIKLAVSSEHTSLFVSGSDDGTVKVWNLRKLEGEGGSARSEL 1092 (1431)
T ss_pred             -hhhhccCCchhhc-CCCCCCCCccceEeehhhhccccccceeecCCCCceEEEecCCceEEEeeehhhhcCcceeeeeE
Confidence             1111121222211 356789999999999999999999999998765 89999999999999999998876 8899999


Q ss_pred             EEeccCCceEEEEEecCCCEEEEEeCCCcEEEEEccccccCCCccccccCcccceeec-CCCCcEEEEEEecCCCCCceE
Q 000470         1101 TYHLEGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHISRGLGNVEKYSGISDIKKKD-TKEGAIVTLVNYNTDNCASHM 1179 (1472)
Q Consensus      1101 t~~~~~~~I~~v~f~~~~~~las~s~DG~I~vwdv~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~v~~~~~~~d~~s~~~ 1179 (1472)
                      +|...++++.++.++++++.+|+++.||.|++.+++..     ...++... ..+..+ ...|..+.+.+|..+.++ ..
T Consensus      1093 tys~~~sr~~~vt~~~~~~~~Av~t~DG~v~~~~id~~-----~~~~~~~~-~~ri~n~~~~g~vv~m~a~~~~~~S-~~ 1165 (1431)
T KOG1240|consen 1093 TYSPEGSRVEKVTMCGNGDQFAVSTKDGSVRVLRIDHY-----NVSKRVAT-QVRIPNLKKDGVVVSMHAFTAIVQS-HV 1165 (1431)
T ss_pred             EEeccCCceEEEEeccCCCeEEEEcCCCeEEEEEcccc-----ccccceee-eeecccccCCCceEEeecccccccc-ee
Confidence            99988889999999999999999999999999999842     12222222 233333 356778889888887654 68


Q ss_pred             EEEEeCCCeEEEEeCCCCCccceeecCCCccceEEEEEcCCCCEEEEEeCCCcEEEEECCCCcccceEeccccCCceeEE
Q 000470         1180 FMYSTQNCGIHLWDTRSNSNTWTLKAIPEEGYVSSLVTGPCGNWFVSGSSRGVLTLWDLRFLVPVNSWQYSQVCPIEKMC 1259 (1472)
Q Consensus      1180 L~~at~dg~I~iwDlrt~~~~~~l~~~~h~g~Itsl~~sp~g~~LvsGssdG~I~lWDlr~~~~i~s~~~~~~~~I~~l~ 1259 (1472)
                      ++++|..+.|..||+|+...+|++++...+|.|+++|.||.++|+++||+.|.+.+||+||+.++.+|.+++..+|+++.
T Consensus      1166 lvy~T~~~~iv~~D~r~~~~~w~lk~~~~hG~vTSi~idp~~~WlviGts~G~l~lWDLRF~~~i~sw~~P~~~~i~~v~ 1245 (1431)
T KOG1240|consen 1166 LVYATDLSRIVSWDTRMRHDAWRLKNQLRHGLVTSIVIDPWCNWLVIGTSRGQLVLWDLRFRVPILSWEHPARAPIRHVW 1245 (1431)
T ss_pred             EEEEEeccceEEecchhhhhHHhhhcCccccceeEEEecCCceEEEEecCCceEEEEEeecCceeecccCcccCCcceEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             eecCCCCCccccCCCCEEEEEE-cCCeEEEEEcCCCeEEEEEecccCCCCCccCCCcccccCCCCCCCCCcccccccccc
Q 000470         1260 LFVPPPNAAVSTTARPLIYVAA-GCNEVSLWNAENGSCHQVLRTANYDGDTEMSDLPWAFARPSSRSNPKTDLRRNVNQK 1338 (1472)
Q Consensus      1260 ~~~p~~~~~~~~~~~~~l~vas-~dg~V~VWDl~t~~~~~~l~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~ 1338 (1472)
                      . +|....     ....+.+++ +.++|.+|++++|.|..+++.++.  .+..   .+.  .|.+.              
T Consensus      1246 ~-~~~~~~-----~S~~vs~~~~~~nevs~wn~~~g~~~~vl~~s~~--~p~l---s~~--~Ps~~-------------- 1298 (1431)
T KOG1240|consen 1246 L-CPTYPQ-----ESVSVSAGSSSNNEVSTWNMETGLRQTVLWASDG--APIL---SYA--LPSND-------------- 1298 (1431)
T ss_pred             e-eccCCC-----CceEEEecccCCCceeeeecccCcceEEEEcCCC--Ccch---hhh--ccccc--------------
Confidence            8 665430     122344444 678999999999999999997632  1111   111  11110              


Q ss_pred             ccccccCCCCCCcCCceEeccCCCCcEEEccCCCeEEEEeCCCCCCc-eEEeCCCCCCCCCCcceEEeecCceEEEEeee
Q 000470         1339 YRVDELNEPPPRLLGIRSLLPLPGGDLLTGGTDLKIRRWDHCSPGRS-YCICGPNLKGVGNDEFYETRSSSGVQVVQERK 1417 (1472)
Q Consensus      1339 ~~~~~l~~~~~~~~~V~sl~~~p~g~llTgg~Dg~IrlWDl~~~~~s-~vv~g~~~~~~~~~~~~~~~~~~~~~~~~e~~ 1417 (1472)
                            ....+...++.|....++|+++|||+|++||.||...++.+ +.+.|+.........+|..+..+|.++++|..
T Consensus      1299 ------~~kp~~~~~~~~~~~~~~~~~ltggsd~kIR~wD~~~p~~ss~~~~~~s~~~~~~~~s~~~~~i~~~~~i~e~i 1372 (1431)
T KOG1240|consen 1299 ------ARKPDSLAGISCGVCEKNGFLLTGGSDMKIRKWDPTRPEISSYAVPGPSTSYSTNSESYDLSTIPGSQFIDEFI 1372 (1431)
T ss_pred             ------CCCCCcccceeeecccCCceeeecCCccceeeccCCCcccccccccCccccccccchhccccccCCCccchhhh
Confidence                  00123344677777778889999999999999999999998 77777766555678899999999999999965


Q ss_pred             cCCcchhhh----hHHHHhhhhcCCCCCCccceeEEeeeecCCcEEEEEcCCceEEEcC
Q 000470         1418 RQPLTSKLT----AKAVLAAAATDSAGCHRDSILSLGSVKLNQRLLISSSRDGAIKVWK 1472 (1472)
Q Consensus      1418 ~~~~~~~~~----~~~~~~~~~~~~~~~H~d~I~~va~~~~~~~~LvS~s~DG~IkVWk 1472 (1472)
                      ..+.+...+    .....+....++..+|+|.|+|++.+..++.+|+++|+||+|||||
T Consensus      1373 ~~~~tv~~t~~~~~~~~~~~~~~~ps~~H~d~Itdma~~~~~q~llvs~s~dG~IkiWk 1431 (1431)
T KOG1240|consen 1373 IYQQTVGLTEALRENQKLRPGPSDPSTYHHDPITDMATLKSEQPLLVSSSRDGVIKIWK 1431 (1431)
T ss_pred             hhhhhcCchhhcccccccccCCCCCcccccchhhhhhhhccCccEEEEecCCCeeeecC
Confidence            544433332    1222333344566789999999998888899999999999999997

>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1472
3gre_A437 Crystal Structure Of Saccharomyces Cerevisiae Vps15 2e-10
3eb0_A383 Crystal Structure Of Cgd4_240 From Cryptosporidium 8e-07
1a06_A332 Calmodulin-Dependent Protein Kinase From Rat Length 2e-06
4fg7_A293 Crystal Structure Of Human Calcium/calmodulin-depen 3e-06
4fg8_A315 Crystal Structure Of Human Calcium/calmodulin-depen 4e-06
4fg9_A320 Crystal Structure Of Human Calcium/calmodulin-depen 4e-06
2pk9_A317 Structure Of The Pho85-pho80 Cdk-cyclin Complex Of 4e-06
4aaa_A331 Crystal Structure Of The Human Cdkl2 Kinase Domain 4e-06
3niz_A311 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 3e-05
2qkr_A313 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 3e-05
1q3d_A424 Gsk-3 Beta Complexed With Staurosporine Length = 42 6e-05
1pyx_A422 Gsk-3 Beta Complexed With Amp-Pnp Length = 422 6e-05
1i09_A420 Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Len 6e-05
4acc_A465 Gsk3b In Complex With Inhibitor Length = 465 6e-05
1q5k_A414 Crystal Structure Of Glycogen Synthase Kinase 3 In 7e-05
1r0e_A391 Glycogen Synthase Kinase-3 Beta In Complex With 3-I 7e-05
2y7j_A365 Structure Of Human Phosphorylase Kinase, Gamma 2 Le 8e-05
2o5k_A372 Crystal Structure Of Gsk3beta In Complex With A Ben 8e-05
1v0o_A288 Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulpho 8e-05
1ob3_A288 Structure Of P. Falciparum Pfpk5 Length = 288 8e-05
1bi8_A326 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 9e-05
1v0b_A288 Crystal Structure Of The T198a Mutant Of Pfpk5 Leng 9e-05
3sd0_A350 Identification Of A Glycogen Synthase Kinase-3b Inh 1e-04
1uv5_A350 Glycogen Synthase Kinase 3 Beta Complexed With 6-Br 1e-04
1h8f_A352 Glycogen Synthase Kinase 3 Beta. Length = 352 1e-04
3nup_A307 Cdk6 (Monomeric) In Complex With Inhibitor Length = 1e-04
3d5u_A317 Crystal Structure Of A Wildtype Polo-Like Kinase 1 1e-04
1jow_B308 Crystal Structure Of A Complex Of Human Cdk6 And A 1e-04
3d5w_A317 Crystal Structure Of A Phosphorylated Polo-Like Kin 1e-04
3d5v_A317 Crystal Structure Of An Activated (Thr->asp) Polo-L 1e-04
2w9f_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 1e-04
2w99_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 1e-04
3g33_A308 Crystal Structure Of Cdk4CYCLIN D3 Length = 308 2e-04
4agu_A311 Crystal Structure Of The Human Cdkl1 Kinase Domain 2e-04
3db6_A301 Crystal Structure Of An Activated (Thr->asp) Polo-L 2e-04
2w96_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 2e-04
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 4e-04
2v5q_A315 Crystal Structure Of Wild-type Plk-1 Kinase Domain 5e-04
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 5e-04
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 5e-04
3say_A430 Crystal Structure Of Human Glycogen Synthase Kinase 5e-04
2yac_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 5e-04
3kb7_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 5e-04
3vuk_A370 Crystal Structure Of A Cysteine-deficient Mutant M5 6e-04
2g99_A308 Structural Basis For The Specific Recognition Of Me 6e-04
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 6e-04
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 6e-04
2g9a_A311 Structural Basis For The Specific Recognition Of Me 7e-04
3thb_A333 Structure Of Plk1 Kinase Domain In Complex With A B 7e-04
2b9h_A353 Crystal Structure Of Fus3 With A Docking Motif From 7e-04
4dit_A382 Crystal Structure Of Gsk3beta In Complex With A Imi 7e-04
2ou7_A335 Structure Of The Catalytic Domain Of Human Polo-Lik 7e-04
4afj_A367 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selec 7e-04
1gng_A378 Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With 7e-04
2h9l_A329 Wdr5delta23 Length = 329 7e-04
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 7e-04
3zrk_A371 Identification Of 2-(4-Pyridyl)thienopyridinones As 7e-04
4apc_A350 Crystal Structure Of Human Nima-Related Kinase 1 (N 7e-04
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 8e-04
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 8e-04
4eoi_A299 Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc 8e-04
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 8e-04
3f88_A349 Glycogen Synthase Kinase 3beta Inhibitor Complex Le 8e-04
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 8e-04
3zdi_A350 Glycogen Synthase Kinase 3 Beta Complexed With Axin 8e-04
1o9u_A350 Glycogen Synthase Kinase 3 Beta Complexed With Axin 8e-04
2ow3_A352 Glycogen Synthase Kinase-3 Beta In Complex With Bis 8e-04
3gb2_A353 Gsk3beta Inhibitor Complex Length = 353 9e-04
3f7z_A350 X-ray Co-crystal Structure Of Glycogen Synthase Kin 9e-04
>pdb|3GRE|A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Vps15 Wd Repeat Domain Length = 437 Back     alignment and structure 
Iteration: 1

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/267 (22%), Positives = 115/267 (43%), Gaps = 37/267 (13%)
Query: 1047 RGILVAHLQEHC-SAVNEIAISHDHS-FFVSASDDSTVKVWDSRKLEKDISFRSRLTYHL 1104
            RG L+A L E+  +++   A+S   + + ++ SD   +K+W+ +++     + S LTY  
Sbjct: 51   RGKLIATLMENEPNSITSSAVSPGETPYLITGSDQGVIKIWNLKEIIVGEVYSSSLTYDC 110
Query: 1105 EGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHISRGLGNVEKYSGISDIKKKDTKEGAI 1164
              +    TM+    A   V + DG I +  V+H          Y   S++K  + +    
Sbjct: 111  SSTVTQITMIPNFDA-FAVSSKDGQIIVLKVNH----------YQQESEVKFLNCECIRK 159
Query: 1165 VTLVNYNTDNCASHMFMYS----------TQNCGIHLWDTRSNSNTWTLKAIPEEGYVSS 1214
            + L N+  +  A  M  +           T    + ++D R+      ++  P  G VSS
Sbjct: 160  INLKNFGKNEYAVRMRAFVNEEKSLLVALTNLSRVIIFDIRTLERLQIIENSPRHGAVSS 219
Query: 1215 LVTGPCGNWFVSGSSRGVLTLWDLRFLVPVNSWQYSQVCPIE--KMCLFVPPPNAAVSTT 1272
            +         + G++RG++ +WD+RF V + SW +    PI   ++C F           
Sbjct: 220  ICIDEECCVLILGTTRGIIDIWDIRFNVLIRSWSFGDHAPITHVEVCQFY---------- 269
Query: 1273 ARPLIYVAAGCNE--VSLWNAENGSCH 1297
             +  + V  G ++  +++WN   G C 
Sbjct: 270  GKNSVIVVGGSSKTFLTIWNFVKGHCQ 296
>pdb|3EB0|A Chain A, Crystal Structure Of Cgd4_240 From Cryptosporidium Parvum In Complex With Indirubin E804 Length = 383 Back     alignment and structure
>pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 Back     alignment and structure
>pdb|4FG7|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-293 In Complex With Atp Length = 293 Back     alignment and structure
>pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 Back     alignment and structure
>pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 Back     alignment and structure
>pdb|2PK9|A Chain A, Structure Of The Pho85-pho80 Cdk-cyclin Complex Of The Phosphate-responsive Signal Transduction Pathway Length = 317 Back     alignment and structure
>pdb|4AAA|A Chain A, Crystal Structure Of The Human Cdkl2 Kinase Domain Length = 331 Back     alignment and structure
>pdb|3NIZ|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Adp Bound Length = 311 Back     alignment and structure
>pdb|2QKR|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Indirubin 3'-Monoxime Bound Length = 313 Back     alignment and structure
>pdb|1Q3D|A Chain A, Gsk-3 Beta Complexed With Staurosporine Length = 424 Back     alignment and structure
>pdb|1PYX|A Chain A, Gsk-3 Beta Complexed With Amp-Pnp Length = 422 Back     alignment and structure
>pdb|1I09|A Chain A, Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Length = 420 Back     alignment and structure
>pdb|4ACC|A Chain A, Gsk3b In Complex With Inhibitor Length = 465 Back     alignment and structure
>pdb|1Q5K|A Chain A, Crystal Structure Of Glycogen Synthase Kinase 3 In Complexed With Inhibitor Length = 414 Back     alignment and structure
>pdb|1R0E|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With 3-Indolyl-4- Arylmaleimide Inhibitor Length = 391 Back     alignment and structure
>pdb|2Y7J|A Chain A, Structure Of Human Phosphorylase Kinase, Gamma 2 Length = 365 Back     alignment and structure
>pdb|2O5K|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Benzoimidazol Inhibitor Length = 372 Back     alignment and structure
>pdb|1V0O|A Chain A, Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulphonate Ligand Complex Length = 288 Back     alignment and structure
>pdb|1OB3|A Chain A, Structure Of P. Falciparum Pfpk5 Length = 288 Back     alignment and structure
>pdb|1BI8|A Chain A, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 326 Back     alignment and structure
>pdb|1V0B|A Chain A, Crystal Structure Of The T198a Mutant Of Pfpk5 Length = 288 Back     alignment and structure
>pdb|3SD0|A Chain A, Identification Of A Glycogen Synthase Kinase-3b Inhibitor That Attenuates Hyperactivity In Clock Mutant Mice Length = 350 Back     alignment and structure
>pdb|1UV5|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With 6-Bromoindirubin-3'-Oxime Length = 350 Back     alignment and structure
>pdb|1H8F|A Chain A, Glycogen Synthase Kinase 3 Beta. Length = 352 Back     alignment and structure
>pdb|3NUP|A Chain A, Cdk6 (Monomeric) In Complex With Inhibitor Length = 307 Back     alignment and structure
>pdb|3D5U|A Chain A, Crystal Structure Of A Wildtype Polo-Like Kinase 1 (Plk1) Catalytic Domain Length = 317 Back     alignment and structure
>pdb|1JOW|B Chain B, Crystal Structure Of A Complex Of Human Cdk6 And A Viral Cyclin Length = 308 Back     alignment and structure
>pdb|3D5W|A Chain A, Crystal Structure Of A Phosphorylated Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Adp Length = 317 Back     alignment and structure
>pdb|3D5V|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain. Length = 317 Back     alignment and structure
>pdb|2W9F|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|2W99|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|3G33|A Chain A, Crystal Structure Of Cdk4CYCLIN D3 Length = 308 Back     alignment and structure
>pdb|4AGU|A Chain A, Crystal Structure Of The Human Cdkl1 Kinase Domain Length = 311 Back     alignment and structure
>pdb|3DB6|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Compound 902 Length = 301 Back     alignment and structure
>pdb|2W96|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|2V5Q|A Chain A, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 315 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|3SAY|A Chain A, Crystal Structure Of Human Glycogen Synthase Kinase 3 Beta (Gsk3b) In Complex With Inhibitor 142 Length = 430 Back     alignment and structure
>pdb|2YAC|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With Nms-P937 Length = 311 Back     alignment and structure
>pdb|3KB7|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 311 Back     alignment and structure
>pdb|3VUK|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M5 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|3THB|A Chain A, Structure Of Plk1 Kinase Domain In Complex With A Benzolactam-Derived Inhibitor Length = 333 Back     alignment and structure
>pdb|2B9H|A Chain A, Crystal Structure Of Fus3 With A Docking Motif From Ste7 Length = 353 Back     alignment and structure
>pdb|4DIT|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Imidazopyridine Inhibitor Length = 382 Back     alignment and structure
>pdb|2OU7|A Chain A, Structure Of The Catalytic Domain Of Human Polo-Like Kinase 1 Length = 335 Back     alignment and structure
>pdb|4AFJ|A Chain A, 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selective Gsk-3 Inhibitors Length = 367 Back     alignment and structure
>pdb|1GNG|A Chain A, Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With Frattide Peptide Length = 378 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|3ZRK|A Chain A, Identification Of 2-(4-Pyridyl)thienopyridinones As Gsk-3beta Inhibitors Length = 371 Back     alignment and structure
>pdb|4APC|A Chain A, Crystal Structure Of Human Nima-Related Kinase 1 (Nek1) Length = 350 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|3F88|A Chain A, Glycogen Synthase Kinase 3beta Inhibitor Complex Length = 349 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|3ZDI|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide And Inhibitor 7d Length = 350 Back     alignment and structure
>pdb|1O9U|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide Length = 350 Back     alignment and structure
>pdb|2OW3|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With Bis- (Indole)maleimide Pyridinophane Inhibitor Length = 352 Back     alignment and structure
>pdb|3GB2|A Chain A, Gsk3beta Inhibitor Complex Length = 353 Back     alignment and structure
>pdb|3F7Z|A Chain A, X-ray Co-crystal Structure Of Glycogen Synthase Kinase 3beta In Complex With An Inhibitor Length = 350 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1472
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 1e-20
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 2e-20
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 7e-20
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 9e-20
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 2e-18
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 4e-18
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 6e-18
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 8e-18
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 8e-18
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 2e-17
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 2e-17
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 3e-17
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 1e-16
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 7e-16
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 8e-16
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 3e-15
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 3e-15
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 3e-15
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 3e-15
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 5e-15
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 5e-15
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 6e-15
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 9e-15
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 1e-14
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 1e-14
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 2e-14
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 2e-14
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 2e-14
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 2e-14
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 3e-14
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 3e-14
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 4e-14
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 6e-14
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 8e-14
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-13
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 4e-07
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 0.003
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 1e-13
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 1e-13
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 2e-13
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 3e-13
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 4e-13
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 6e-13
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 7e-13
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 8e-13
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 9e-13
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 6e-05
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-04
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 8e-04
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 0.002
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 1e-12
d1u6gc_ 1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 2e-12
d1u6gc_1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 6e-09
d1u6gc_ 1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 1e-07
d1u6gc_1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 4e-05
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 2e-12
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 2e-12
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 6e-12
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 7e-12
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 8e-12
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 1e-11
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 1e-11
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 2e-11
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-11
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-09
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 6e-06
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-05
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 3e-11
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-09
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 4e-04
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 4e-11
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 5e-11
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 7e-11
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 7e-11
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 9e-11
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 2e-10
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 1e-09
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 1e-09
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 3e-09
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 3e-07
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 3e-07
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 3e-04
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 7e-04
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 3e-09
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 5e-09
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 1e-04
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 9e-04
d1qgra_876 a.118.1.1 (A:) Importin beta {Human (Homo sapiens) 6e-09
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 7e-09
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-08
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 5e-04
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 0.004
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 3e-08
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 5e-08
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 1e-06
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 1e-04
d2vgla_584 a.118.1.10 (A:) Adaptin alpha C subunit N-terminal 5e-08
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 5e-08
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 2e-07
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 4e-06
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 7e-05
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 5e-04
d1sq9a_ 393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 0.001
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-07
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 9e-07
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 8e-04
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 0.002
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-06
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 7e-05
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 7e-05
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-04
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 3e-06
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 3e-06
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 1e-05
d1ibrb_458 a.118.1.1 (B:) Importin beta {Human (Homo sapiens) 1e-05
d1ibrb_458 a.118.1.1 (B:) Importin beta {Human (Homo sapiens) 1e-04
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 3e-05
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 4e-05
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 0.002
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 4e-05
d2bpta1861 a.118.1.1 (A:1-861) Importin beta {Baker's yeast ( 9e-05
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 9e-05
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 5e-04
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 0.001
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 0.001
d2vglb_579 a.118.1.10 (B:) Adaptin beta subunit N-terminal fr 0.002
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: gamma-subunit of glycogen phosphorylase kinase (Phk)
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]

 Score = 91.3 bits (226), Expect = 1e-20
 Identities = 44/211 (20%), Positives = 77/211 (36%), Gaps = 17/211 (8%)

Query: 5   PCVHKKFWQETDKAAYLLRQYFFN-SLRDRLSTPPFLSLVEKKWLAFQLLLAVKQCHEKG 63
             +  K   ET+   +L+        L D L+    LS  E + +   LL  +   H+  
Sbjct: 71  NIIQLKDTYETNTFFFLVFDLMKKGELFDYLTEKVTLSEKETRKIMRALLEVICALHKLN 130

Query: 64  ICHGDIKCENVLVTSWNWLYLSDFASFKPTYIPYDDPSDFSFFFDTGGKRLCYLAPERFY 123
           I H D+K EN+L+     + L+DF          D          T      YLAPE   
Sbjct: 131 IVHRDLKPENILLDDDMNIKLTDFGFSC----QLDPGEKLREVCGT----PSYLAPEIIE 182

Query: 124 EHGGEMQVAQDAPLKPSMDIFAVGCVIAE-LFLEVPFFELSHLLAYRR---GQYDPSQHL 179
               +            +D+++ G ++   L    PF+    +L  R    G Y      
Sbjct: 183 CSMNDNHPGYG----KEVDMWSTGVIMYTLLAGSPPFWHRKQMLMLRMIMSGNYQFGSPE 238

Query: 180 EKIPDSGIRKMILHMIQLEPELRFSAESYLQ 210
                  ++ ++   + ++P+ R++AE  L 
Sbjct: 239 WDDYSDTVKDLVSRFLVVQPQKRYTAEEALA 269
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 876 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 458 Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 458 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 861 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1472
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 100.0
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1s9ja_322 Dual specificity mitogen-activated protein kinase 100.0
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 100.0
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 100.0
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 100.0
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 100.0
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 100.0
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 100.0
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 100.0
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 100.0
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 100.0
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 100.0
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 100.0
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 100.0
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 100.0
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 100.0
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 100.0
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 100.0
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 100.0
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 100.0
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 100.0
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 100.0
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 100.0
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 100.0
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 100.0
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 100.0
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 100.0
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 100.0
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 100.0
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 100.0
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 100.0
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 100.0
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 100.0
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 100.0
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 100.0
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.97
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.97
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.96
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.96
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.95
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.95
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.94
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.94
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.93
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.92
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.91
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.89
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.87
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.87
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.86
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.85
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.8
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.79
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.78
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.78
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.77
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.74
d1b3ua_588 Constant regulatory domain of protein phosphatase 99.72
d1b3ua_588 Constant regulatory domain of protein phosphatase 99.71
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.68
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.68
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.6
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.45
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.38
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.34
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.32
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.14
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.12
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.02
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.0
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.95
d2vglb_579 Adaptin beta subunit N-terminal fragment {Human (H 98.91
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.88
d1u6gc_1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 98.84
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.79
d1u6gc_1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 98.7
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.69
d2bpta1861 Importin beta {Baker's yeast (Saccharomyces cerevi 98.69
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 98.68
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.59
d2vglb_579 Adaptin beta subunit N-terminal fragment {Human (H 98.56
d2bpta1861 Importin beta {Baker's yeast (Saccharomyces cerevi 98.43
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 98.41
d1qgra_876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 98.37
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.36
d1qgra_876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 98.35
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 98.29
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.28
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 98.11
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.04
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 98.03
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.02
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 98.01
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 97.93
d2vgla_584 Adaptin alpha C subunit N-terminal fragment {Mouse 97.85
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 97.84
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 97.79
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 97.73
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 97.73
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.71
d2vgla_584 Adaptin alpha C subunit N-terminal fragment {Mouse 97.63
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.56
d1wa5c_959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 97.5
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.11
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 96.98
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 96.94
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 96.92
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 96.88
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 96.63
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 96.38
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 96.16
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 96.12
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 96.07
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 95.87
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 95.55
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 95.47
d1wa5c_959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 95.29
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 95.05
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 94.48
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 94.18
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 93.72
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 93.25
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 93.12
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 92.88
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 92.68
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 91.78
d2pula1392 Methylthioribose kinase MtnK {Bacillus subtilis [T 91.48
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 89.72
d1zyla1325 RdoA {Escherichia coli [TaxId: 562]} 86.52
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=100.00  E-value=4.3e-42  Score=286.23  Aligned_cols=305  Identities=18%  Similarity=0.272  Sum_probs=256.4

Q ss_pred             CCCCCCCCEEEECCCCCCCEEEEEECCCCCEEEEEECCCCEEEEECCCCCCCCCCCCCEEEECCCCCEEEEEEECCCCEE
Q ss_conf             88555653634511234555589990799799999299979999399886442111105874169732799992499799
Q 000470         1042 SGWRPRGILVAHLQEHCSAVNEIAISHDHSFFVSASDDSTVKVWDSRKLEKDISFRSRLTYHLEGSRALCTMMLRHSAQV 1121 (1472)
Q Consensus      1042 ~~W~p~G~lV~~L~~H~~~V~~iafspd~~~lvSgS~DGtVkIWD~~~~e~~~~~~s~~t~~~~~~~I~~i~f~~~~~~l 1121 (1472)
                      ..|.|++....+|.||+++|++++|+|++++|+|||.||+|+|||+.+++      ...++.+|...|.+++|++++..+
T Consensus         1 k~w~p~~~~~~~L~GH~~~I~~l~~sp~~~~l~s~s~Dg~i~iWd~~~~~------~~~~~~~h~~~V~~~~~~~~~~~~   74 (317)
T d1vyhc1           1 KEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGD------FERTLKGHTDSVQDISFDHSGKLL   74 (317)
T ss_dssp             CCCCCCSSCSCEEECCSSCEEEEEECSSSSEEEEEESSSCEEEEETTTCC------CCEEECCCSSCEEEEEECTTSSEE
T ss_pred             CCCCCCCCCCEEECCCCCCEEEEEECCCCCEEEEEECCCEEEEEECCCCC------EEEEEECCCCCEEEEEEECCCCCC
T ss_conf             93689898448985888876899993898999999389929999899997------999995788867777630111101


Q ss_pred             EEEECCCCEEEEECCCCCCCCCCCCCCCCCCCCEEECCCCCCEEEEEEECCCCCCCEEEEEEECCCEEEEEECCCCCCCC
Q ss_conf             99917994999980112468886433468545233027998589999713799872199999589749999599898654
Q 000470         1122 VVGACDGIIHMFSVDHISRGLGNVEKYSGISDIKKKDTKEGAIVTLVNYNTDNCASHMFMYSTQNCGIHLWDTRSNSNTW 1201 (1472)
Q Consensus      1122 as~s~DG~I~iwdi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~d~~s~~~Lv~at~dg~I~iwDlrt~~~~~ 1201 (1472)
                      ++++.++.+..|+....              ........+...+....++++   ++.+++++.|+.+++||++++....
T Consensus        75 ~~~~~~~~~~~~~~~~~--------------~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~d~~~~~~~~~~~~~~~  137 (317)
T d1vyhc1          75 ASCSADMTIKLWDFQGF--------------ECIRTMHGHDHNVSSVSIMPN---GDHIVSASRDKTIKMWEVQTGYCVK  137 (317)
T ss_dssp             EEEETTSCCCEEETTSS--------------CEEECCCCCSSCEEEEEECSS---SSEEEEEETTSEEEEEETTTCCEEE
T ss_pred             CCCCCCCCCCCCCCCCC--------------CCCCCCCCCCCCCEEEECCCC---CCEEEEECCCCCEEEEECCCCEEEE
T ss_conf             11111111011100111--------------111110000000000001699---8557765267523575114430346


Q ss_pred             EEECCCCCCCEEEEEECCCCCEEEEEECCCCEEEEECCCCCCCCEEECCCCCCCEEEEEECCCCCCC-----------CC
Q ss_conf             0004787665389999699989999937993999978999510067415667720478425999974-----------44
Q 000470         1202 TLKAIPEEGYVSSLVTGPCGNWFVSGSSRGVLTLWDLRFLVPVNSWQYSQVCPIEKMCLFVPPPNAA-----------VS 1270 (1472)
Q Consensus      1202 ~l~~~~h~g~Itsi~~sp~g~~LvsGssdG~I~lWDlR~~~~i~s~~~~~~~~I~~l~~~~p~~~~~-----------~~ 1270 (1472)
                      .+..  |...+.++++++++.+|++|+.||.+++||++.+.....+.. +...+..+.+ .|.....           ..
T Consensus       138 ~~~~--~~~~~~~~~~~~~~~~l~~~~~d~~v~~~~~~~~~~~~~~~~-~~~~i~~~~~-~~~~~~~~~~~~~~~~~~~~  213 (317)
T d1vyhc1         138 TFTG--HREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELRE-HRHVVECISW-APESSYSSISEATGSETKKS  213 (317)
T ss_dssp             EEEC--CSSCEEEEEECTTSSEEEEEETTSCEEEEETTTCCEEEEECC-CSSCEEEEEE-CCSCGGGGGGGCCSCC----
T ss_pred             EECC--CCCCCEEEECCCCCCEEEEEECCCEEEEEEECCCEEEEEEEC-CCCCCEEEEE-EECCCCCEEECCCCCEEEEE
T ss_conf             8716--777630000166799999992798299975125403478824-7787337998-63256411103456303430


Q ss_pred             CCCCCEEEEEECCCEEEEEECCCCEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             68999799998699499998688717789861358898766877632358898899975332344533222344899988
Q 000470         1271 TTARPLIYVAAGCNEVSLWNAENGSCHQVLRTANYDGDTEMSDLPWAFARPSSRSNPKTDLRRNVNQKYRVDELNEPPPR 1350 (1472)
Q Consensus      1271 s~~~~~i~vas~dg~V~VWDl~tg~~~~~l~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~l~~~~~~ 1350 (1472)
                      ...+..+++++.++.|.+||+.++.+...+..+                                               
T Consensus       214 ~~~~~~~~~~~~d~~i~~~~~~~~~~~~~~~~~-----------------------------------------------  246 (317)
T d1vyhc1         214 GKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGH-----------------------------------------------  246 (317)
T ss_dssp             ---CCEEEEEETTSEEEEEETTTTEEEEEEECC-----------------------------------------------
T ss_pred             CCCCCEEEECCCCCEEEEEECCCCCEEEEEECC-----------------------------------------------
T ss_conf             258861475169978999888999688999688-----------------------------------------------


Q ss_pred             CCCCEEECCCCCC-CEEECCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCEEEEECCCEEEEEEEECCCCCHHHHHHH
Q ss_conf             6781583448999-189816999099973999999649718998899998406786058619999540588640124678
Q 000470         1351 LLGIRSLLPLPGG-DLLTGGTDLKIRRWDHCSPGRSYCICGPNLKGVGNDEFYETRSSSGVQVVQERKRQPLTSKLTAKA 1429 (1472)
Q Consensus      1351 ~~~V~sl~~~p~g-~LiTgg~Dg~IriWDl~~~~~s~vi~g~~~~~~~~~~~y~~~~~~~~~~~~e~~~~~~~~~~~~~~ 1429 (1472)
                      ...|.+++++|++ ++++|+.||.|++||+.+++....+.+                                       
T Consensus       247 ~~~v~~~~~~~~~~~l~s~~~dg~i~iwd~~~~~~~~~~~~---------------------------------------  287 (317)
T d1vyhc1         247 DNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNA---------------------------------------  287 (317)
T ss_dssp             SSCEEEEEECSSSSCEEEEETTTEEEEECCTTSCCCEEEEC---------------------------------------
T ss_pred             CCCEEEEEECCCCCEEEEEECCCEEEEEECCCCCEEEEECC---------------------------------------
T ss_conf             99879999879999999997989499999999919999928---------------------------------------


Q ss_pred             HHHHHHCCCCCCCCCCEEEEEEEECCCCEEEEECCCCEEEECC
Q ss_conf             8754201777887530458752206982899980894389839
Q 000470         1430 VLAAAATDSAGCHRDSILSLGSVKLNQRLLISSSRDGAIKVWK 1472 (1472)
Q Consensus      1430 ~~~~~~~~~~~~H~d~I~~ia~~~~~~~~LvS~s~DG~IkVWk 1472 (1472)
                                  |.+.|++++ |++++++|+||+.||+|+|||
T Consensus       288 ------------h~~~V~~~~-~s~~~~~l~s~s~Dg~i~iWd  317 (317)
T d1vyhc1         288 ------------HEHFVTSLD-FHKTAPYVVTGSVDQTVKVWE  317 (317)
T ss_dssp             ------------CSSCEEEEE-ECSSSSCEEEEETTSEEEEEC
T ss_pred             ------------CCCCEEEEE-ECCCCCEEEEEECCCEEEEEC
T ss_conf             ------------999889999-949999999992899499829
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure