Citrus Sinensis ID: 000481


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------1450------1460------147
MAFLGTLLGGLSWTCEGEFDLGSFCIQSTIIDVINLVFFCVFYLSLLVGSFRKNHNYGRIRRECVSIVVSACCAVVGIAYLGYCLWNLIAKNDSSMSWLVSTVRGLIWVSLAISLLVKRSKWIRMLITLWWMSFSLLVLALNIEILARTYTINVVYILPLPVNLLLLFSAFRNFSHFTSPNREDKSLSEPLLAEKNQTELGKAGLLRKLTFSWINPLLSLGYSKPLALEDIPSLVPEDEASFAYQKFAYAWDSLVRENNSNNNGNLVRKVITNVYLKENIFIAICALLRTIAVVVGPLLLYAFVNYSNRGEENLQEGLSIVGCLIITKVVESFTQRHCFFGSRRSGMRMRSALMVAVYQKQLKLSSLGRKKHSTGEIVNYIAVDAYRMGEFPFWFHLTWSLALQLFLAIGVLFGVVGLGALPGLVLFLICGLLNVPFAKILQKCQSEFMIAQDERLRSTSEILNNMKIIKLQSWEEKFKSLIESRREKEFKWLSEAQLRKAYGTVIYWMSPTIISSVIFLGCALTGSAPLNASTIFTVLATLRSMGEPVRMIPEALSIMIQVKVSFDRINAFLLDHELNNDDVRRISLQKSDRSVKIQEGNFSWDPELAIPTLRGVNLDIKWAQKIAVCGSVGAGKSSLLYAILGEIPKISGTVNLYGSIAYVSQTSWIQSGSIRDNILYGKPMDKARYDKAIKACALDKDINNFDHGDLTEIGQRGLNLSGGQKQRIQLARAVYNDADIYLFDDPFSAVDAHTAATLFNECVMAALEKKTVILVTHQVEFLSEVDRILVLEGGQITQSGNYQELLLAGTAFEQLVNAHRDAITGLGPLDNAGQGGAEKVEKGRTARPEEPNGIYPRKESSEGEISVKGLTQLTEDEEMEIGDVGWKPFMDYLNVSKGMSLLCLGVLAQSGFVGLQAAATYWLAYAIQIPKITSGILIGVYAGVSTASAVFVYFRSFFAAHLGLKASKAFFSGFTNSIFKAPMLFFDSTPVGRILTRLSSDLSILDFDIPFSIVFVAASGTELLAIIGIMTFVTWQVLVVAIFAMVAVRFVQRYYIATARELIRINGTTKAPVMNYTAETSQGVVTIRAFNMVDRFFQNYLKLVDIDASLFFHTNGVMEWLILRVEALQNLTLFTAALFLVLIPRGYVAPGLVGLSLSYAFTLTGTQVFLSRWYCYLANYIISVERIKQFMHIPPEPPAIVEDKRPPSSWPFKGRIELRQLKIRYRPNAPLVLKGITCTFSEGTRVGVVGRTGSGKTTLISALFRLVEPAGGSILIDGVDICSMGLKDLRVKLSIIPQEPTLFRGSVRTNLDPLGLYSDDEIWKALEKCQLKTTISSLPNKLDSSVSDEGENWSAGQRQLFCLGRVLLKRNRILVLDEANASIDSATDAILQRIIRQEFSNCTVITVAHRVPTVIDSDMVMVLSYGKLLEYDEPSKLMETNSSFSKLVAEYWSSCRRNSYQNLNNFQ
ccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEEEEEEcccccccccccEEEEEEcccEEEEEccccccHHHHHHHHHcccccccEEEEEccEEEEEccccccccccccccccccccccHHHHHHHHHHHccHHHHHccccccccccccccccccHHHHHHHHHHHHHHccccEEEEccccHHHcHHHHHHHHHHHHHHHHcccEEEEEcccccccccccEEEEEEccEEEEEccHHHHHHcccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEEEEEEEEcccccccccccEEEEccccEEEEEccccccHHHHHHHHHHHcccccccEEEccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccHHHHccccccccccccccccccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHcccccEEEEEcccccccccccEEEEEEccEEEEccccHHHHHcccHHHHHHHHHHHHHHHcccccccccc
ccccccccccccHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHcccHHHHHHHHHHHHHHHccccccccHHccccccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccHcccHHHHHHHHHHHccHHHHHHHHcccccccccccccccccccccEEccccEEcccccccccEEEEEEEEEccccEEEEEEEccccccHHHHHHHcccccccEEEEEEEEEEEEcccHEEEcccHHHHccccccccHHHHHHHHHHHccHHHHHHccccccEEEcccHHHccHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHHHccccEEEEcccHHHHHHHcEEEEEcccEEEEcccHHHHHHccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccEEEEHHHHcccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEEEEEEcccccccEEEEEEEEccccEEEEEccccccHHHHHHHHcccccccEEEEEEccEEHHHEcHHHHHHHEEEEcccccccccEHHHHHcccccccHHHHHHHHHHHcHHHHHHHcccccccEEccccccccHHHHHHHHHHHHHHHcccEEEEcccHHcccHHHHHHHHHHHHHHHcccEEEEEEEEccccccccEEEEEEccEEEEcccHHHHHHcccHHHHHHHHHHcccccccHHcHcccc
MAFLGTLlgglswtcegefdlgsfciqSTIIDVINLVFFCVFYLSLLVGSfrknhnygrirRECVSIVVSACCAVVGIAYLGYCLWNLIAKNDSSMSWLVSTVRGLIWVSLAISLLVKRSKWIRMLITLWWMSFSLLVLALNIEILARTYTINVVYILPLPVNLLLLFSAFrnfshftspnredkslsepllaekNQTELGKAGLLRKLTFswinpllslgyskplaledipslvpedeasFAYQKFAYAWDSLVRennsnnngnLVRKVITNVYLKENIFIAICALLRTIAVVVGPLLLYAFVNYSNRGEENLQEGLSIVGCLIITKVVESFTQrhcffgsrrsgmRMRSALMVAVYQKQLKLsslgrkkhstgeIVNYIAVDayrmgefpfWFHLTWSLALQLFLAIGVLFGVVGLGALPGLVLFLICGLLNVPFAKILQKCQSEFMIAQDERLRSTSEILNNMKIIKLQSWEEKFKSLIESRREKEFKWLSEAQLRKAYGTVIYWMSPTIISSVIFLGCaltgsaplnasTIFTVLATLrsmgepvrmIPEALSIMIQVKVSFDRINAFLldhelnnddVRRISlqksdrsvkiqegnfswdpelaiptlrgvnldiKWAQKIAVCGSVGAGKSSLLYAILGeipkisgtvNLYGSIAYVsqtswiqsgsirdnilygkpmdkaRYDKAIKACAldkdinnfdhgdlteigqrglnlsggQKQRIQLARAVYndadiylfddpfsavdahtAATLFNECVMAALEKKTVILVTHQVEFLSEVDRILVLeggqitqsgnYQELLLAGTAFEQLVNAHRDaitglgpldnagqggaekvekgrtarpeepngiyprkessegeisvkgltqltedeemeigdvgwkpfMDYLNVSKGMSLLCLGVLAQSGFVGLQAAATYWLAYAIQIPKITSGILIGVYAGVSTASAVFVYFRSFFAAHLGLKaskaffsgftnsifkapmlffdstpvgrILTRLssdlsildfdipFSIVFVAASGTELLAIIGIMTFVTWQVLVVAIFAMVAVRFVQRYYIATARELIRingttkapvmnytaetsqGVVTIRAFNMVDRFFQNYLKLVDIDASLFFHTNGVMEWLILRVEALQNLTLFTAALFLVLIprgyvapglVGLSLSYAFTLTGTQVFLSRWYCYLANYIISVERIKqfmhippeppaivedkrppsswpfkgriELRQLKiryrpnaplvlkgitctfsegtrvgvvgrtgsgkTTLISALFRLvepaggsilidgVDICSMGLKDLRVklsiipqeptlfrgsvrtnldplglysDDEIWKALEKCQLKTtisslpnkldssvsdegenwsaGQRQLFCLGRVLLKRNRILVLDEANASIDSATDAILQRIIRQEFSNCTVITVahrvptvidsDMVMVLSYGKlleydepsklmetnSSFSKLVAEYWSSCRRNSYQNLNNFQ
MAFLGTLLGGLSWTCEGEFDLGSFCIQSTIIDVINLVFFCVFYLSLLVGSFRKNHNYGRIRRECVSIVVSACCAVVGIAYLGYCLWNLIAKNDSSMSWLVSTVRGLIWVSLAISLLVKRSKWIRMLITLWWMSFSLLVLALNIEILARTYTINVVYILPLPVNLLLLFSAFRNFSHFtspnredkslsePLLAEKNQTELGKAGLLRKLTFSWINPLLSLGYSKPLALEDIPSLVPEDEASFAYQKFAYAWDSLVRennsnnngnlVRKVITNVYLKENIFIAICALLRTIAVVVGPLLLYAFVNYSNRGEENLQEGLSIVGCLIITKVVESFTQRHCFfgsrrsgmrMRSALMVAVYQKQLKlsslgrkkhstgEIVNYIAVDAYRMGEFPFWFHLTWSLALQLFLAIGVLFGVVGLGALPGLVLFLICGLLNVPFAKILQKCQSEFMIAQDERLRSTSEILNNMKIIKLQSWEEKFKSLIESRREKEFKWLSEAQLRKAYGTVIYWMSPTIISSVIFLGCALTGSAPLNASTIFTVLATLRSMGEPVRMIPEALSIMIQVKVSFDRINAFLLdhelnnddvrrislqksdrsvkiqegnfswdpelaiPTLRGVNLDIKWAQKIAVCGSVGAGKSSLLYAILGEIPKISGTVNLYGSIAYVSqtswiqsgsirDNILYGKPMDKARYDKAIKACALDKDINNFDHGDLTEIGQRGLNLSGGQKQRIQLARAVYNDADIYLFDDPFSAVDAHTAATLFNECVMAALEKKTVILVTHQVEFLSEVDRILVLEGGQITQSGNYQELLLAGTAFEQLVNAHRDAITGlgpldnagqggaekvekgrtarpeepngiyprkessegeisvkgltqltedeemEIGDVGWKPFMDYLNVSKGMSLLCLGVLAQSGFVGLQAAATYWLAYAIQIPKITSGILIGVYAGVSTASAVFVYFRSFFAAHLGLKASKAFFSGFTNSIFKAPMLFFDSTPVGRILTRLSSDLSILDFDIPFSIVFVAASGTELLAIIGIMTFVTWQVLVVAIFAMVAVRFVQRYYIATARELIringttkapvmnytAETSQGVVTIRAFNMVDRFFQNYLKLVDIDASLFFHTNGVMEWLILRVEALQNLTLFTAALFLVLIPRGYVAPGLVGLSLSYAFTLTGTQVFLSRWYCYLANYIISVERIKQFMHIPPEppaivedkrppssWPFKGRIELRQLKIRYRPNAPLVLKGitctfsegtrvgvvgrtgsgkTTLISALFRLVEPAGGSILIDGVDICSMGLKDLRVKLsiipqeptlfrgsvrtnldPLGLYSDDEIWKALEKCQLKTTisslpnkldssVSDEGENWSAGQRQLFCLGRVLLKRNRILVLdeanasidsaTDAILQRIIRQEFSNCTVITVahrvptvidsdMVMVLSYGKLLEYDEPSKLMETNSSFSKLVAEYWSscrrnsyqnlnnfq
MAFLGTLLGGLSWTCEGEFDLGSFCIQSTIIDVINLVFFCVFYLSLLVGSFRKNHNYGRIRREcvsivvsaccavvgiaYLGYCLWNLIAKNDSSMSWLVSTVRGLIWVSLAISLLVKRSKWIRMLITLWWMSFSLLVLALNIEILARTYTINVVYIlplpvnllllFSAFRNFSHFTSPNREDKSLSEPLLAEKNQTELGKAGLLRKLTFSWINPLLSLGYSKPLALEDIPSLVPEDEASFAYQKFAYAWDSLVRENNSNNNGNLVRKVITNVYLKENIFIAICALLRTIAVVVGPLLLYAFVNYSNRGEENLQEGLSIVGCLIITKVVESFTQRHCFFgsrrsgmrmrsALMVAVYQKQLKLSSLGRKKHSTGEIVNYIAVDAYRMGEFPFWFHLTWSLALQlflaigvlfgvvglgalpglvlfliCGLLNVPFAKILQKCQSEFMIAQDERLRSTSEILNNMKIIKLQSWEEKFKSLIESRREKEFKWLSEAQLRKAYGTVIYWMSPTIISSVIFLGCALTGSAPLNASTIFTVLATLRSMGEPVRMIPEALSIMIQVKVSFDRINAFLLDHELNNDDVRRISLQKSDRSVKIQEGNFSWDPELAIPTLRGVNLDIKWAQKIAVCGSVGAGKSSLLYAILGEIPKISGTVNLYGSIAYVSQTSWIQSGSIRDNILYGKPMDKARYDKAIKACALDKDINNFDHGDLTEIGQRGLNLSGGQKQRIQLARAVYNDADIYLFDDPFSAVDAHTAATLFNECVMAALEKKTVILVTHQVEFLSEVDRILVLEGGQITQSGNYQELLLAGTAFEQLVNAHRDAITGLGPLDNAGQGGAEKVEKGRTARPEEPNGIYPRKESSEGEISVKGLTQLTEDEEMEIGDVGWKPFMDYLNVSKGMSLLCLGVLAQSGFVGLQAAATYWLAYAIQIPKITSGILIGVYAGVSTASAVFVYFRSFFAAHLGLKASKAFFSGFTNSIFKAPMLFFDSTPVGRILTRLSSDLSILDFDIPFSIVFVAASGTELLAIIGIMTFVTWQVLVVAIFAMVAVRFVQRYYIATARELIRINGTTKAPVMNYTAETSQGVVTIRAFNMVDRFFQNYLKLVDIDASLFFHTNGVMEWLILRVEALQNltlftaalflVLIPRGYVAPGLVGLSLSYAFTLTGTQVFLSRWYCYLANYIISVERIKQFMHIPPEPPAIVEDKRPPSSWPFKGRIELRQLKIRYRPNAPLVLKGITCTFSEgtrvgvvgrtgsgkttLISALFRLVEPAGGSILIDGVDICSMGLKDLRVKLSIIPQEPTLFRGSVRTNLDPLGLYSDDEIWKALEKCQLKTTISSLPNKLDSSVSDEGENWSAGQRQLFCLGRVLLKRNRILVLDEANASIDSATDAILQRIIRQEFSNCTVITVAHRVPTVIDSDMVMVLSYGKLLEYDEPSKLMETNSSFSKLVAEYWSSCRRNSYQNLNNFQ
**FLGTLLGGLSWTCEGEFDLGSFCIQSTIIDVINLVFFCVFYLSLLVGSFRKNHNYGRIRRECVSIVVSACCAVVGIAYLGYCLWNLIAKNDSSMSWLVSTVRGLIWVSLAISLLVKRSKWIRMLITLWWMSFSLLVLALNIEILARTYTINVVYILPLPVNLLLLFSAFRNFSHF**********************LGKAGLLRKLTFSWINPLLSLGYSKPLALEDIPSLVPEDEASFAYQKFAYAWDSLVRENNSNNNGNLVRKVITNVYLKENIFIAICALLRTIAVVVGPLLLYAFVNYSNRGEENLQEGLSIVGCLIITKVVESFTQRHCFFGSRRSGMRMRSALMVAVYQKQLKLSSLGRKKHSTGEIVNYIAVDAYRMGEFPFWFHLTWSLALQLFLAIGVLFGVVGLGALPGLVLFLICGLLNVPFAKILQKCQSEFMIAQDERLRSTSEILNNMKIIKLQSWEEKFKSLIESRREKEFKWLSEAQLRKAYGTVIYWMSPTIISSVIFLGCALTGSAPLNASTIFTVLATLRSMGEPVRMIPEALSIMIQVKVSFDRINAFLLDHELNNDDVRRISL******VKIQEGNFSWDPELAIPTLRGVNLDIKWAQKIAVCGSVGAGKSSLLYAILGEIPKISGTVNLYGSIAYVSQTSWIQSGSIRDNILYGKPMDKARYDKAIKACALDKDINNFDHGDLTEIGQRGLNLSGGQKQRIQLARAVYNDADIYLFDDPFSAVDAHTAATLFNECVMAALEKKTVILVTHQVEFLSEVDRILVLEGGQITQSGNYQELLLAGTAFEQLVNAHRDAITGLG***************************************************MEIGDVGWKPFMDYLNVSKGMSLLCLGVLAQSGFVGLQAAATYWLAYAIQIPKITSGILIGVYAGVSTASAVFVYFRSFFAAHLGLKASKAFFSGFTNSIFKAPMLFFDSTPVGRILTRLSSDLSILDFDIPFSIVFVAASGTELLAIIGIMTFVTWQVLVVAIFAMVAVRFVQRYYIATARELIRINGTTKAPVMNYTAETSQGVVTIRAFNMVDRFFQNYLKLVDIDASLFFHTNGVMEWLILRVEALQNLTLFTAALFLVLIPRGYVAPGLVGLSLSYAFTLTGTQVFLSRWYCYLANYIISVERIKQFMHIP***************WPFKGRIELRQLKIRYRPNAPLVLKGITCTFSEGTRVGVVGRTGSGKTTLISALFRLVEPAGGSILIDGVDICSMGLKDLRVKLSIIPQEPTLFRGSVRTNLDPLGLYSDDEIWKALEKCQLKTTI*****************WSAGQRQLFCLGRVLLKRNRILVLDEANASIDSATDAILQRIIRQEFSNCTVITVAHRVPTVIDSDMVMVLSYGKLLEYDE**********FSKLVAEYWSSCR***********
*AFLGTLLGGLSWTCEGEFDLGSFCIQSTIIDVINLVFFCVFYLSLLVGSFRKNHNYGRIRRECVSIVVSACCAVVGIAYLGYCLWNLIAKNDSSMSWLVSTVRGLIWVSLAISLLVKRSKWIRMLITLWWMSFSLLVLALNIEILARTYTINVVYILPLPVNLLLLFSAFRNFSHFTSP******************ELGKAGLLRKLTFSWINPLLSLGYSKPLALEDIPSLVPEDEASFAYQKFAYAW*****************KVITNVYLKENIFIAICALLRTIAVVVGPLLLYAFVNYSNRGEENLQEGLSIVGCLIITKVVESFTQRHCFFGSRRSGMRMRSALMVAVYQKQ****************VNYIAVDAYRMGEFPFWFHLTWSLALQLFLAIGVLFGVVGLGALPGLVLFLICGLLNVPFAKILQKCQSEFMIAQDERLRSTSEILNNMKIIKLQSWEEKFKSLIESRREKEFKWLSEAQLRKAYGTVIYWMSPTIISSVIFLGCALTGSAPLNASTIFTVLATLRSMGEPVRMIPEALSIMIQVKVSFDRINAFLLDHEL***************SVKIQEGNFSWDPELAIPTLRGVNLDIKWAQKIAVCGSVGAGKSSLLYAILGEIPKISGTVNLYGSIAYVSQTSWIQSGSIRDNILYGKPMDKARYDKAIKACALDKDINNFDHGDLTEIGQRGLNLSGGQKQRIQLARAVYNDADIYLFDDPFSAVDAHTAATLFNECVMAALEKKTVILVTHQVEFLSEVDRILVLEGGQITQSGNYQELLLAGTAFEQ********************************************************************DVGWKPFMDYLNVSKGMSLLCLGVLAQSGFVGLQAAATYWLAYAIQIPKITSGILIGVYAGVSTASAVFVYFRSFFAAHLGLKASKAFFSGFTNSIFKAPMLFFDSTPVGRILTRLSSDLSILDFDIPFSIVFVAASGTELLAIIGIMTFVTWQVLVVAIFAMVAVRFVQRYYIATARELIRINGTTKAPVMNYTAETSQGVVTIRAFNMVDRFFQNYLKLVDIDASLFFHTNGVMEWLILRVEALQNLTLFTAALFLVLIPRGYVAPGLVGLSLSYAFTLTGTQVFLSRWYCYLANYIISVERIKQFMHIPPEPP**********SWPFKGRIELRQLKIRYRPNAPLVLKGITCTFSEGTRVGVVGRTGSGKTTLISALFRLVEPAGGSILIDGVDICSMGLKDLRVKLSIIPQEPTLFRGSVRTNLDPLGLYSDDEIWKALEKCQLKTTISSLPNKLDSSVSDEGENWSAGQRQLFCLGRVLLKRNRILVLDEANASIDSATDAILQRIIRQEFSNCTVITVAHRVPTVIDSDMVMVLSYGKLLEYDEPSKLMETNSSFSK*********************
MAFLGTLLGGLSWTCEGEFDLGSFCIQSTIIDVINLVFFCVFYLSLLVGSFRKNHNYGRIRRECVSIVVSACCAVVGIAYLGYCLWNLIAKNDSSMSWLVSTVRGLIWVSLAISLLVKRSKWIRMLITLWWMSFSLLVLALNIEILARTYTINVVYILPLPVNLLLLFSAFRNFSHFTS********SEPLLAEKNQTELGKAGLLRKLTFSWINPLLSLGYSKPLALEDIPSLVPEDEASFAYQKFAYAWDSLVRENNSNNNGNLVRKVITNVYLKENIFIAICALLRTIAVVVGPLLLYAFVNYSNRGEENLQEGLSIVGCLIITKVVESFTQRHCFFGSRRSGMRMRSALMVAVYQKQLKLSSLGRKKHSTGEIVNYIAVDAYRMGEFPFWFHLTWSLALQLFLAIGVLFGVVGLGALPGLVLFLICGLLNVPFAKILQKCQSEFMIAQDERLRSTSEILNNMKIIKLQSWEEKFKSLIESRREKEFKWLSEAQLRKAYGTVIYWMSPTIISSVIFLGCALTGSAPLNASTIFTVLATLRSMGEPVRMIPEALSIMIQVKVSFDRINAFLLDHELNNDDVRRISLQKSDRSVKIQEGNFSWDPELAIPTLRGVNLDIKWAQKIAVCGSVGAGKSSLLYAILGEIPKISGTVNLYGSIAYVSQTSWIQSGSIRDNILYGKPMDKARYDKAIKACALDKDINNFDHGDLTEIGQRGLNLSGGQKQRIQLARAVYNDADIYLFDDPFSAVDAHTAATLFNECVMAALEKKTVILVTHQVEFLSEVDRILVLEGGQITQSGNYQELLLAGTAFEQLVNAHRDAITGLGPLDNA*****************EPNGIYPRKESSEGEISVKGLTQLTEDEEMEIGDVGWKPFMDYLNVSKGMSLLCLGVLAQSGFVGLQAAATYWLAYAIQIPKITSGILIGVYAGVSTASAVFVYFRSFFAAHLGLKASKAFFSGFTNSIFKAPMLFFDSTPVGRILTRLSSDLSILDFDIPFSIVFVAASGTELLAIIGIMTFVTWQVLVVAIFAMVAVRFVQRYYIATARELIRINGTTKAPVMNYTAETSQGVVTIRAFNMVDRFFQNYLKLVDIDASLFFHTNGVMEWLILRVEALQNLTLFTAALFLVLIPRGYVAPGLVGLSLSYAFTLTGTQVFLSRWYCYLANYIISVERIKQFMHIPPEPPAIVEDKRPPSSWPFKGRIELRQLKIRYRPNAPLVLKGITCTFSEGTRVGVVGRTGSGKTTLISALFRLVEPAGGSILIDGVDICSMGLKDLRVKLSIIPQEPTLFRGSVRTNLDPLGLYSDDEIWKALEKCQLKTTISSLPNK************SAGQRQLFCLGRVLLKRNRILVLDEANASIDSATDAILQRIIRQEFSNCTVITVAHRVPTVIDSDMVMVLSYGKLLEYDEPSKLMETNSSFSKLVAEYWSSCRRNSYQNLNNFQ
**FLGTLLGGLSWTCEGEFDLGSFCIQSTIIDVINLVFFCVFYLSLLVGSFRKNHNYGRIRRECVSIVVSACCAVVGIAYLGYCLWNLIAKNDSSMSWLVSTVRGLIWVSLAISLLVKRSKWIRMLITLWWMSFSLLVLALNIEILARTYTINVVYILPLPVNLLLLFSAFRNFSHFTSPNREDKSLSEPLLAEKNQTELGKAGLLRKLTFSWINPLLSLGYSKPLALEDIPSLVPEDEASFAYQKFAYAWDSLVRENNSNNNGNLVRKVITNVYLKENIFIAICALLRTIAVVVGPLLLYAFVNYSNRGEENLQEGLSIVGCLIITKVVESFTQRHCFFGSRRSGMRMRSALMVAVYQKQLKLSSLGRKKHSTGEIVNYIAVDAYRMGEFPFWFHLTWSLALQLFLAIGVLFGVVGLGALPGLVLFLICGLLNVPFAKILQKCQSEFMIAQDERLRSTSEILNNMKIIKLQSWEEKFKSLIESRREKEFKWLSEAQLRKAYGTVIYWMSPTIISSVIFLGCALTGSAPLNASTIFTVLATLRSMGEPVRMIPEALSIMIQVKVSFDRINAFLLDHELNNDDVRRISLQKSDRSVKIQEGNFSWDPELAIPTLRGVNLDIKWAQKIAVCGSVGAGKSSLLYAILGEIPKISGTVNLYGSIAYVSQTSWIQSGSIRDNILYGKPMDKARYDKAIKACALDKDINNFDHGDLTEIGQRGLNLSGGQKQRIQLARAVYNDADIYLFDDPFSAVDAHTAATLFNECVMAALEKKTVILVTHQVEFLSEVDRILVLEGGQITQSGNYQELLLAGTAFEQLVNAHRDA************************************************TQLTEDEEMEIGDVGWKPFMDYLNVSKGMSLLCLGVLAQSGFVGLQAAATYWLAYAIQIPKITSGILIGVYAGVSTASAVFVYFRSFFAAHLGLKASKAFFSGFTNSIFKAPMLFFDSTPVGRILTRLSSDLSILDFDIPFSIVFVAASGTELLAIIGIMTFVTWQVLVVAIFAMVAVRFVQRYYIATARELIRINGTTKAPVMNYTAETSQGVVTIRAFNMVDRFFQNYLKLVDIDASLFFHTNGVMEWLILRVEALQNLTLFTAALFLVLIPRGYVAPGLVGLSLSYAFTLTGTQVFLSRWYCYLANYIISVERIKQFMHIPPEPPAIVEDKRPPSSWPFKGRIELRQLKIRYRPNAPLVLKGITCTFSEGTRVGVVGRTGSGKTTLISALFRLVEPAGGSILIDGVDICSMGLKDLRVKLSIIPQEPTLFRGSVRTNLDPLGLYSDDEIWKALEKCQLKTTISSLPNKLDSSVSDEGENWSAGQRQLFCLGRVLLKRNRILVLDEANASIDSATDAILQRIIRQEFSNCTVITVAHRVPTVIDSDMVMVLSYGKLLEYDEPSKLMETNSSFSKLVAEYWS**************
ooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSoooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAFLGTLLGGLSWTCEGEFDLGSFCIQSTIIDVINLVFFCVFYLSLLVGSFRKNHNYGRIRRECVSIVVSACCAVVGIAYLGYCLWNLIAKNDSSMSWLVSTVRGLIWVSLAISLLVKRSKWIRMLITLWWMSFSLLVLALNIEILARTYTINVVYILPLPVNLLLLFSAFRNFSHFTSPNREDKSLSEPLLAEKNQTELGKAGLLRKLTFSWINPLLSLGYSKPLALEDIPSLVPEDEASFAYQKFAYAWDSLVRENNSNNNGNLVRKVITNVYLKENIFIAICALLRTIAVVVGPLLLYAFVNYSNRGEENLQEGLSIVGCLIITKVVESFTQRHCFFGSRRSGMRMRSALMVAVYQKQLKLSSLGRKKHSTGEIVNYIAVDAYRMGEFPFWFHLTWSLALQLFLAIGVLFGVVGLGALPGLVLFLICGLLNVPFAKILQKCQSEFMIAQDERLRSTSEILNNMKIIKLQSWEEKFKSLIESRREKEFKWLSEAQLRKAYGTVIYWMSPTIISSVIFLGCALTGSAPLNASTIFTVLATLRSMGEPVRMIPEALSIMIQVKVSFDRINAFLLDHELNNDDVRRISLQKSDRSVKIQEGNFSWDPELAIPTLRGVNLDIKWAQKIAVCGSVGAGKSSLLYAILGEIPKISGTVNLYGSIAYVSQTSWIQSGSIRDNILYGKPMDKARYDKAIKACALDKDINNFDHGDLTEIGQRGLNLSGGQKQRIQLARAVYNDADIYLFDDPFSAVDAHTAATLFNECVMAALEKKTVILVTHQVEFLSEVDRILVLEGGQITQSGNYQELLLAGTAFEQLVNAHRDAITGLGPLDNAGQGGAEKVEKGRTARPEEPNGIYPRKESSEGEISVKGLTQLTEDEEMEIGDVGWKPFMDYLNVSKGMSLLCLGVLAQSGFVGLQAAATYWLAYAIQIPKITSGILIGVYAGVSTASAVFVYFRSFFAAHLGLKASKAFFSGFTNSIFKAPMLFFDSTPVGRILTRLSSDLSILDFDIPFSIVFVAASGTELLAIIGIMTFVTWQVLVVAIFAMVAVRFVQRYYIATARELIRINGTTKAPVMNYTAETSQGVVTIRAFNMVDRFFQNYLKLVDIDASLFFHTNGVMEWLILRVEALQNLTLFTAALFLVLIPRGYVAPGLVGLSLSYAFTLTGTQVFLSRWYCYLANYIISVERIKQFMHIPPEPPAIVEDKRPPSSWPFKGRIELRQLKIRYRPNAPLVLKGITCTFSEGTRVGVVGRTGSGKTTLISALFRLVEPAGGSILIDGVDICSMGLKDLRVKLSIIPQEPTLFRGSVRTNLDPLGLYSDDEIWKALEKCQLKTTISSLPNKLDSSVSDEGENWSAGQRQLFCLGRVLLKRNRILVLDEANASIDSATDAILQRIIRQEFSNCTVITVAHRVPTVIDSDMVMVLSYGKLLEYDEPSKLMETNSSFSKLVAEYWSSCRRNSYQNLNNFQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1467 2.2.26 [Sep-21-2011]
Q8LGU11464 ABC transporter C family yes no 0.991 0.993 0.666 0.0
Q9LYS21453 ABC transporter C family no no 0.947 0.956 0.444 0.0
Q7GB251514 ABC transporter C family no no 0.916 0.888 0.431 0.0
Q9LK641514 ABC transporter C family no no 0.850 0.824 0.448 0.0
Q9M1C71506 ABC transporter C family no no 0.978 0.953 0.406 0.0
Q8VZZ41466 ABC transporter C family no no 0.941 0.942 0.411 0.0
Q9LZJ51539 ABC transporter C family no no 0.931 0.888 0.395 0.0
Q9LK621493 ABC transporter C family no no 0.850 0.835 0.425 0.0
Q7DM581516 ABC transporter C family no no 0.927 0.897 0.399 0.0
Q7FB561053 Putative ABC transporter no no 0.710 0.989 0.450 0.0
>sp|Q8LGU1|AB8C_ARATH ABC transporter C family member 8 OS=Arabidopsis thaliana GN=ABCC8 PE=2 SV=3 Back     alignment and function desciption
 Score = 1912 bits (4953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 980/1470 (66%), Positives = 1171/1470 (79%), Gaps = 16/1470 (1%)

Query: 4    LGTLLGGLSWTCEGEFDLGSFCIQSTIIDVINLVFFCVFYLSLLVGSFRKNHNYGRIRRE 63
            +   +G L W C+ E +L S C Q T I  +NL+F C+FYL  L+ S    H   R R++
Sbjct: 1    MAAFIGSLPW-CDVELNLASSCFQRTAIAFVNLLFLCIFYL-FLIASCVSTHFIVRGRKK 58

Query: 64   C-VSIVVSACCAVVGIAYLGYCLWNLI-AKND-SSMSWLVSTVRGLIWVSLAISLLVKRS 120
              + + V+ CCA+    +LG  L +LI   ND + +SW+   V G+IWVSLA+SLLV  S
Sbjct: 59   GWIFVAVAICCAITSFIFLGVGLNSLIHGGNDVTEISWVACFVEGIIWVSLAVSLLVNGS 118

Query: 121  KWIRMLITLWWMSFSLLVLALNIEILARTYTINVVYILPLPVNLLLLFSAFRNFSHFTSP 180
            KW+ +L+++WW+SF+LL L     IL +   I ++ IL LP++LLLL  ++ N    +S 
Sbjct: 119  KWVNILVSVWWVSFALLDLVAKSGILLQGNGIRILDILTLPMSLLLLLCSWMNLRS-SSA 177

Query: 181  NREDKS---LSEPLLAE---KNQTELGKAGLLRKLTFSWINPLLSLGYSKPLALEDIPSL 234
              +D S   LS+PLL +   K    L  AG    L+FSW+NPLLSLG+ KPL+ EDIPS+
Sbjct: 178  AAQDCSVTGLSDPLLTKNPRKESARLATAGFFSILSFSWMNPLLSLGFKKPLSPEDIPSV 237

Query: 235  VPEDEASFAYQKFAYAWDSLVRENNSNNNGNLVRKVITNVYLKENIFIAICALLRTIAVV 294
            VPEDEA  AY+KF+ AWD+L+ + +S    NLV + +  VY KENIFIA+ A LRT AVV
Sbjct: 238  VPEDEAQLAYKKFSQAWDTLLGDESSTKERNLVFRAVVKVYFKENIFIAVFAFLRTFAVV 297

Query: 295  VGPLLLYAFVNYSNRGEENLQEGLSIVGCLIITKVVESFTQRHCFFGSRRSGMRMRSALM 354
              PL+LY FV+Y+N    +L+ G   + CL++ K+VES T RH +F SRRSGMR+RSALM
Sbjct: 298  SLPLMLYVFVDYANSDHRDLRNGFFNLACLVMLKLVESLTMRHWYFASRRSGMRIRSALM 357

Query: 355  VAVYQKQLKLSSLGRKKHSTGEIVNYIAVDAYRMGEFPFWFHLTWSLALQLFLAIGVLFG 414
            VA Y+KQLKLSSLGRK+HS+GEIVNYIAVDAYRMGEF +WFH  WSL+LQL L+  VLFG
Sbjct: 358  VAAYKKQLKLSSLGRKRHSSGEIVNYIAVDAYRMGEFLWWFHSGWSLSLQLLLSTAVLFG 417

Query: 415  VVGLGALPGLVLFLICGLLNVPFAKILQKCQSEFMIAQDERLRSTSEILNNMKIIKLQSW 474
            VVG GA PGL+L L+CGLLN+PFAK+LQ CQ++FMIAQD+RLRSTSEILN+MK+IKLQSW
Sbjct: 418  VVGAGAFPGLILLLLCGLLNLPFAKMLQNCQTQFMIAQDKRLRSTSEILNSMKVIKLQSW 477

Query: 475  EEKFKSLIESRREKEFKWLSEAQLRKAYGTVIYWMSPTIISSVIFLGCALTGSAPLNAST 534
            E++FK  IES R+ EF WL++AQL KA+G+ +YWMSPTI+SSV+FLGCAL  SAPLNAST
Sbjct: 478  EDEFKKKIESCRDDEFTWLAKAQLTKAFGSFLYWMSPTIVSSVVFLGCALLKSAPLNAST 537

Query: 535  IFTVLATLRSMGEPVRMIPEALSIMIQVKVSFDRINAFLLDHELNNDDVRRISLQKSDRS 594
            IFTVLATLR M EPV++IP+A+S +IQ  VSF R+N FLLD EL  D++ R  L  S  +
Sbjct: 538  IFTVLATLRVMSEPVKIIPDAISAIIQGNVSFQRLNNFLLDDELKMDEIERSGLDASGTA 597

Query: 595  VKIQEGNFSWDPELAIPTLRGVNLDIKWAQKIAVCGSVGAGKSSLLYAILGEIPKISGTV 654
            V IQ GNF W+PE  IPTLR ++L+IK  QK+AVCG VGAGKSSLL+A+LGEIPK+SGTV
Sbjct: 598  VDIQVGNFGWEPETKIPTLRNIHLEIKHGQKVAVCGPVGAGKSSLLHAVLGEIPKVSGTV 657

Query: 655  NLYGSIAYVSQTSWIQSGSIRDNILYGKPMDKARYDKAIKACALDKDINNFDHGDLTEIG 714
             ++GSIAYVSQTSWIQSG+IRDNILYGKPM+  RY+ AIKACALDKD+N F HGDLTEIG
Sbjct: 658  KVFGSIAYVSQTSWIQSGTIRDNILYGKPMESRRYNAAIKACALDKDMNGFGHGDLTEIG 717

Query: 715  QRGLNLSGGQKQRIQLARAVYNDADIYLFDDPFSAVDAHTAATLFNECVMAALEKKTVIL 774
            QRG+NLSGGQKQRIQLARAVY DAD+YL DDPFSAVDAHTA  LF++CV  +L++KTVIL
Sbjct: 718  QRGINLSGGQKQRIQLARAVYADADVYLLDDPFSAVDAHTAGVLFHKCVEDSLKEKTVIL 777

Query: 775  VTHQVEFLSEVDRILVLEGGQITQSGNYQELLLAGTAFEQLVNAHRDAITGLGPLDNAGQ 834
            VTHQVEFLSEVD+ILV+E G ITQSG Y+ELL+ GTAF+QLVNAH DA+T L    N   
Sbjct: 778  VTHQVEFLSEVDQILVMEEGTITQSGKYEELLMMGTAFQQLVNAHNDAVTVLPLASNESL 837

Query: 835  GGAEKVEKGRTARPEEPNGIYPRKESSEGEISVKGLTQLTEDEEMEIGDVGWKPFMDYLN 894
            G   K  K R  R    N     K   E E +     QLT++EE E G VG KPF+DY+ 
Sbjct: 838  GDLRKEGKDREIR----NMTVVEKIEEEIEKTDIPGVQLTQEEEKESGYVGMKPFLDYIG 893

Query: 895  VSKGMSLLCLGVLAQSGFVGLQAAATYWLAYAIQIPKITSGILIGVYAGVSTASAVFVYF 954
            VS+G  LL   VL Q GFV  QAA+TYWLA+AI IPKIT+ +LIGVY+ +ST SA FVY 
Sbjct: 894  VSRGWCLLWSSVLGQVGFVVFQAASTYWLAFAIGIPKITNTMLIGVYSIISTLSAGFVYA 953

Query: 955  RSFFAAHLGLKASKAFFSGFTNSIFKAPMLFFDSTPVGRILTRLSSDLSILDFDIPFSIV 1014
            R+   AHLGLKASKAFFSGFTN++FKAPMLFFDSTPVGRILTR SSDL++LD+D+PF+ +
Sbjct: 954  RAITTAHLGLKASKAFFSGFTNAVFKAPMLFFDSTPVGRILTRASSDLNVLDYDVPFAFI 1013

Query: 1015 FVAASGTELLAIIGIMTFVTWQVLVVAIFAMVAVRFVQRYYIATARELIRINGTTKAPVM 1074
            FV A   EL A + IMT+VTWQV+++A+ A+ A + VQ YY+A+ARELIRINGTTKAPVM
Sbjct: 1014 FVVAPAVELTAALLIMTYVTWQVIIIALLALAATKVVQDYYLASARELIRINGTTKAPVM 1073

Query: 1075 NYTAETSQGVVTIRAFNMVDRFFQNYLKLVDIDASLFFHTNGVMEWLILRVEALQNLTLF 1134
            NY AETS GVVTIRAF   +RFF+NYL LVD DA LFF +N  MEW+ILR+E LQN+TLF
Sbjct: 1074 NYAAETSLGVVTIRAFGTAERFFKNYLNLVDADAVLFFLSNAAMEWVILRIETLQNVTLF 1133

Query: 1135 TAALFLVLIPRGYVAPGLVGLSLSYAFTLTGTQVFLSRWYCYLANYIISVERIKQFMHIP 1194
            T AL L+LIP+GY+APGLVGLSLSYA TLT TQVFL+RWYC L+N IISVERIKQ+M+IP
Sbjct: 1134 TCALLLILIPKGYIAPGLVGLSLSYALTLTQTQVFLTRWYCTLSNSIISVERIKQYMNIP 1193

Query: 1195 PEPPAIVEDKRPPSSWPFKGRIELRQLKIRYRPNAPLVLKGITCTFSEGTRVGVVGRTGS 1254
             EPPAI++DKRPPSSWP  G I L++LKIRYRPNAPLVLKGI+CTF EGTRVGVVGRTGS
Sbjct: 1194 EEPPAIIDDKRPPSSWPSNGTIHLQELKIRYRPNAPLVLKGISCTFREGTRVGVVGRTGS 1253

Query: 1255 GKTTLISALFRLVEPAGGSILIDGVDICSMGLKDLRVKLSIIPQEPTLFRGSVRTNLDPL 1314
            GK+TLISALFRLVEPA G ILIDG+DI  +GLKDLR+KLSIIPQEPTLFRG +RTNLDPL
Sbjct: 1254 GKSTLISALFRLVEPASGCILIDGIDISKIGLKDLRMKLSIIPQEPTLFRGCIRTNLDPL 1313

Query: 1315 GLYSDDEIWKALEKCQLKTTISSLPNKLDSSVSDEGENWSAGQRQLFCLGRVLLKRNRIL 1374
            G+YSDDEIWKALEKCQLKTTIS+LPNKLDSSVSDEGENWS GQRQLFCLGRVLLKRN+IL
Sbjct: 1314 GVYSDDEIWKALEKCQLKTTISNLPNKLDSSVSDEGENWSVGQRQLFCLGRVLLKRNKIL 1373

Query: 1375 VLDEANASIDSATDAILQRIIRQEFSNCTVITVAHRVPTVIDSDMVMVLSYGKLLEYDEP 1434
            VLDEA ASIDSATDAI+QRIIR+EF++CTVITVAHRVPTVIDSDMVMVLS+G L+EY+EP
Sbjct: 1374 VLDEATASIDSATDAIIQRIIREEFADCTVITVAHRVPTVIDSDMVMVLSFGDLVEYNEP 1433

Query: 1435 SKLMETNSSFSKLVAEYWSSCRRNSYQNLN 1464
            SKLMET+S FSKLVAEYW+SCR NS QNL 
Sbjct: 1434 SKLMETDSYFSKLVAEYWASCRGNSSQNLQ 1463




Pump for glutathione S-conjugates.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 3EC: .EC: 4EC: 4
>sp|Q9LYS2|AB10C_ARATH ABC transporter C family member 10 OS=Arabidopsis thaliana GN=ABCC10 PE=2 SV=2 Back     alignment and function description
>sp|Q7GB25|AB5C_ARATH ABC transporter C family member 5 OS=Arabidopsis thaliana GN=ABCC5 PE=2 SV=2 Back     alignment and function description
>sp|Q9LK64|AB3C_ARATH ABC transporter C family member 3 OS=Arabidopsis thaliana GN=ABCC3 PE=1 SV=1 Back     alignment and function description
>sp|Q9M1C7|AB9C_ARATH ABC transporter C family member 9 OS=Arabidopsis thaliana GN=ABCC9 PE=2 SV=2 Back     alignment and function description
>sp|Q8VZZ4|AB6C_ARATH ABC transporter C family member 6 OS=Arabidopsis thaliana GN=ABCC6 PE=2 SV=3 Back     alignment and function description
>sp|Q9LZJ5|AB14C_ARATH ABC transporter C family member 14 OS=Arabidopsis thaliana GN=ABCC14 PE=1 SV=1 Back     alignment and function description
>sp|Q9LK62|AB7C_ARATH ABC transporter C family member 7 OS=Arabidopsis thaliana GN=ABCC7 PE=2 SV=1 Back     alignment and function description
>sp|Q7DM58|AB4C_ARATH ABC transporter C family member 4 OS=Arabidopsis thaliana GN=ABCC4 PE=1 SV=2 Back     alignment and function description
>sp|Q7FB56|AB15C_ARATH Putative ABC transporter C family member 15 OS=Arabidopsis thaliana GN=ABCC15 PE=5 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1467
2555729851475 multidrug resistance-associated protein 0.991 0.985 0.745 0.0
3594825261469 PREDICTED: ABC transporter C family memb 0.996 0.995 0.736 0.0
3594825281465 PREDICTED: ABC transporter C family memb 0.991 0.993 0.721 0.0
3594825241462 PREDICTED: ABC transporter C family memb 0.991 0.995 0.727 0.0
3565288571469 PREDICTED: ABC transporter C family memb 0.983 0.982 0.698 0.0
3575153531463 ABC transporter C family member [Medicag 0.985 0.988 0.686 0.0
356522202 1951 PREDICTED: ABC transporter C family memb 0.981 0.738 0.691 0.0
3565260351465 PREDICTED: ABC transporter C family memb 0.990 0.991 0.692 0.0
3565288271494 PREDICTED: ABC transporter C family memb 0.986 0.968 0.669 0.0
297743104 2772 unnamed protein product [Vitis vinifera] 0.927 0.490 0.684 0.0
>gi|255572985|ref|XP_002527423.1| multidrug resistance-associated protein 1, 3 (mrp1, 3), abc-transoprter, putative [Ricinus communis] gi|223533233|gb|EEF34989.1| multidrug resistance-associated protein 1, 3 (mrp1, 3), abc-transoprter, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 2231 bits (5781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1092/1464 (74%), Positives = 1240/1464 (84%), Gaps = 10/1464 (0%)

Query: 9    GGLSWTCEGEFDLGSFCIQSTIIDVINLVFFCVFYLSLLVGSFRKNHNYGRIRRECVSIV 68
            G LSW CE + DLGS C Q  IID+INLVF  VFYL LL+GS RK+   G  RR+ +S+V
Sbjct: 16   GELSWICEEKLDLGSPCTQRIIIDIINLVFLGVFYLFLLLGSIRKHQVSGSNRRDWISVV 75

Query: 69   VSACCAVVGIAYLGYCLWNLIAKNDS--SMSWLVSTVRGLIWVSLAISLLVKRSKWIRML 126
            VS CC ++ IAYLG  LW+LIAKN S   +SWLV  VRG+IW+S+A+SLLV RS+W R+L
Sbjct: 76   VSICCTLISIAYLGVGLWDLIAKNHSFNHLSWLVYLVRGIIWISVAVSLLVTRSRWNRIL 135

Query: 127  ITLWWMSFSLLVLALNIEILARTYTINVVYILPLPVNLLLLFSAFRNFSHFTSPNREDKS 186
            +T+WW+SFSLL  ALNIEILAR  +I V+ ILP PVN LLL  A RNFSHF+S     K+
Sbjct: 136  VTVWWVSFSLLASALNIEILARANSIQVLDILPWPVNFLLLLCALRNFSHFSSQQASYKN 195

Query: 187  LSEPLLAEK--NQTELGKAGLLRKLTFSWINPLLSLGYSKPLALEDIPSLVPEDEASFAY 244
            L EPLL  K     +L  A  L  LTFSWINPLL LGYSKPL  EDIPSL+PEDEA  AY
Sbjct: 196  LFEPLLGAKEVKNQKLAHASFLSNLTFSWINPLLKLGYSKPLDDEDIPSLLPEDEADIAY 255

Query: 245  QKFAYAWDSLVRENNSNNNGNLVRKVITNVYLKENIFIAICALLRTIAVVVGPLLLYAFV 304
            QKFA+AWDSL+RENNSN+ GNLV + +  V+LKENIFI   ALLR IAV V PLLLYAFV
Sbjct: 256  QKFAHAWDSLIRENNSNDTGNLVLEAVAKVHLKENIFIGTYALLRAIAVAVLPLLLYAFV 315

Query: 305  NYSNRGEENLQEGLSIVGCLIITKVVESFTQRHCFFGSRRSGMRMRSALMVAVYQKQLKL 364
            NYSN  ++NL +GLSIVGCLI+ KVVES +QR  FF +R+SGMR+RSALMVAVYQKQL L
Sbjct: 316  NYSNLDQQNLYQGLSIVGCLILVKVVESLSQRRSFFLARQSGMRIRSALMVAVYQKQLNL 375

Query: 365  SSLGRKKHSTGEIVNYIAVDAYRMGEFPFWFHLTWSLALQLFLAIGVLFGVVGLGALPGL 424
            SSL R++HSTGE VNYIAVDAYRMGEFP+WFH TW+  LQLFL+I +LFGVVGLGA+ GL
Sbjct: 376  SSLARRRHSTGEFVNYIAVDAYRMGEFPWWFHATWAYVLQLFLSIIILFGVVGLGAVTGL 435

Query: 425  VLFLICGLLNVPFAKILQKCQSEFMIAQDERLRSTSEILNNMKIIKLQSWEEKFKSLIES 484
            V  LICGLLNVPFA+ LQKCQS+FMIAQDERLR+TSEILNNMKIIKLQSWEEKFKS IES
Sbjct: 436  VPLLICGLLNVPFARFLQKCQSKFMIAQDERLRATSEILNNMKIIKLQSWEEKFKSYIES 495

Query: 485  RREKEFKWLSEAQLRKAYGTVIYWMSPTIISSVIFLGCALTGSAPLNASTIFTVLATLRS 544
             R+ EFKWL+E+Q++K YGT++YW+SPTIISSV+F+GCAL  SAPLN+STIFTVLATLRS
Sbjct: 496  LRDTEFKWLTESQIKKTYGTILYWLSPTIISSVVFVGCALFRSAPLNSSTIFTVLATLRS 555

Query: 545  MGEPVRMIPEALSIMIQVKVSFDRINAFLLDHELNNDDVRRISLQKSDRSVKIQEGNFSW 604
            M EPVRMIPEALSI+IQVKVSFDRIN FLLD EL N+ +   S   S  S+ ++ G FSW
Sbjct: 556  MAEPVRMIPEALSILIQVKVSFDRINNFLLDDELKNESISTNSSYNSGESITVEGGKFSW 615

Query: 605  DPELAIPTLRGVNLDIKWAQKIAVCGSVGAGKSSLLYAILGEIPKISGTVNLYGSIAYVS 664
            DPEL++PTLR VNLDIK  QK AVCG VGAGKSSLLYA+LGEIPKISGTVN++GSIAYVS
Sbjct: 616  DPELSMPTLREVNLDIKRGQKFAVCGPVGAGKSSLLYAMLGEIPKISGTVNVFGSIAYVS 675

Query: 665  QTSWIQSGSIRDNILYGKPMDKARYDKAIKACALDKDINNFDHGDLTEIGQRGLNLSGGQ 724
            QTSWIQSG++RDNILYGKPMD+ +Y++AIKACALDKDIN+F+HGDLTEIGQRGLN+SGGQ
Sbjct: 676  QTSWIQSGTVRDNILYGKPMDQEKYERAIKACALDKDINSFNHGDLTEIGQRGLNMSGGQ 735

Query: 725  KQRIQLARAVYNDADIYLFDDPFSAVDAHTAATLFNECVMAALEKKTVILVTHQVEFLSE 784
            KQRIQLARAVYNDADIYL DDPFSAVDAHTAA LFN+C+M ALE KTVILVTHQV+FLS 
Sbjct: 736  KQRIQLARAVYNDADIYLLDDPFSAVDAHTAAILFNDCIMTALENKTVILVTHQVDFLSS 795

Query: 785  VDRILVLEGGQITQSGNYQELLLAGTAFEQLVNAHRDAITGLGPLDNAGQGGAEKVEKGR 844
            VD+ILV+EGGQITQSG+Y+ELL+A TAFEQLVNAH+D++T LG  D + +G + K +   
Sbjct: 796  VDQILVMEGGQITQSGSYEELLMACTAFEQLVNAHKDSVTVLGSYDKS-RGESLKAD--- 851

Query: 845  TARPEEPNGIYPRKESSEGEISVKGLT--QLTEDEEMEIGDVGWKPFMDYLNVSKGMSLL 902
              R E+ +     K++SEGEIS+KG+   QLTE+EE  IG+VGWKPF+DY+ +SKG    
Sbjct: 852  IVRQEDFSVSSHAKQNSEGEISMKGVAGVQLTEEEEKGIGNVGWKPFLDYILISKGTLFA 911

Query: 903  CLGVLAQSGFVGLQAAATYWLAYAIQIPKITSGILIGVYAGVSTASAVFVYFRSFFAAHL 962
             L  L+  GF+GLQAAATYWLAYA+QIP+I S +LIGVY  +S+ SA FVY RS+ A  L
Sbjct: 912  SLSTLSICGFIGLQAAATYWLAYAVQIPEIRSSMLIGVYTLISSLSASFVYLRSYLAVLL 971

Query: 963  GLKASKAFFSGFTNSIFKAPMLFFDSTPVGRILTRLSSDLSILDFDIPFSIVFVAASGTE 1022
            GLKASK+FFSGFTN+IFKAPMLFFDSTPVGRILTR SSDLSILDFDIPFS VF A    E
Sbjct: 972  GLKASKSFFSGFTNTIFKAPMLFFDSTPVGRILTRASSDLSILDFDIPFSYVFAAGGLVE 1031

Query: 1023 LLAIIGIMTFVTWQVLVVAIFAMVAVRFVQRYYIATARELIRINGTTKAPVMNYTAETSQ 1082
            L+  IGIM  VTWQVLV+A+ A+V  +++Q YY+A+ARELIRINGTTKAPVMNY AETS 
Sbjct: 1032 LVVTIGIMASVTWQVLVIAVLAIVGAKYIQDYYLASARELIRINGTTKAPVMNYAAETSL 1091

Query: 1083 GVVTIRAFNMVDRFFQNYLKLVDIDASLFFHTNGVMEWLILRVEALQNLTLFTAALFLVL 1142
            GVVTIRAF MV+RFFQNYLKLVD DA LFF +NG MEWLI+R EALQN+TLFTAAL LVL
Sbjct: 1092 GVVTIRAFKMVNRFFQNYLKLVDKDAVLFFLSNGAMEWLIIRTEALQNVTLFTAALLLVL 1151

Query: 1143 IPRGYVAPGLVGLSLSYAFTLTGTQVFLSRWYCYLANYIISVERIKQFMHIPPEPPAIVE 1202
            +P+G V PGL+GLSLSYA +LTGTQVF++RWYC LANY+ISVERIKQFMHIP EPPA+VE
Sbjct: 1152 LPKGVVTPGLIGLSLSYALSLTGTQVFVTRWYCNLANYVISVERIKQFMHIPSEPPAVVE 1211

Query: 1203 DKRPPSSWPFKGRIELRQLKIRYRPNAPLVLKGITCTFSEGTRVGVVGRTGSGKTTLISA 1262
            D RPPSSWP +GRIEL+ LKIRYRPNAPLVLKGI C F EGTRVGVVGRTGSGKTTLISA
Sbjct: 1212 DNRPPSSWPPEGRIELQDLKIRYRPNAPLVLKGINCIFEEGTRVGVVGRTGSGKTTLISA 1271

Query: 1263 LFRLVEPAGGSILIDGVDICSMGLKDLRVKLSIIPQEPTLFRGSVRTNLDPLGLYSDDEI 1322
            LFRLVEPA G ILIDG+DICS+GL+DLR KLSIIPQE TLFRGSVRTNLDPLGLYSD EI
Sbjct: 1272 LFRLVEPASGRILIDGLDICSIGLRDLRTKLSIIPQEATLFRGSVRTNLDPLGLYSDPEI 1331

Query: 1323 WKALEKCQLKTTISSLPNKLDSSVSDEGENWSAGQRQLFCLGRVLLKRNRILVLDEANAS 1382
            W+ALEKCQLKTTISSLPN+LDSSVSDEGENWSAGQRQLFCLGRVLL+RNRILVLDEA AS
Sbjct: 1332 WEALEKCQLKTTISSLPNQLDSSVSDEGENWSAGQRQLFCLGRVLLRRNRILVLDEATAS 1391

Query: 1383 IDSATDAILQRIIRQEFSNCTVITVAHRVPTVIDSDMVMVLSYGKLLEYDEPSKLMETNS 1442
            IDSATDAILQRIIRQEFS CTVITVAHRVPTVIDSDMVMVLSYGKL EYDEP KLME NS
Sbjct: 1392 IDSATDAILQRIIRQEFSMCTVITVAHRVPTVIDSDMVMVLSYGKLEEYDEPLKLMEINS 1451

Query: 1443 SFSKLVAEYWSSCRRNSYQNLNNF 1466
            SFSKLVAEYWSSCRRNS +N   +
Sbjct: 1452 SFSKLVAEYWSSCRRNSEKNFGKY 1475




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359482526|ref|XP_002276212.2| PREDICTED: ABC transporter C family member 8-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482528|ref|XP_002276236.2| PREDICTED: ABC transporter C family member 8-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482524|ref|XP_002276193.2| PREDICTED: ABC transporter C family member 8-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356528857|ref|XP_003533014.1| PREDICTED: ABC transporter C family member 8-like [Glycine max] Back     alignment and taxonomy information
>gi|357515353|ref|XP_003627965.1| ABC transporter C family member [Medicago truncatula] gi|355521987|gb|AET02441.1| ABC transporter C family member [Medicago truncatula] Back     alignment and taxonomy information
>gi|356522202|ref|XP_003529736.1| PREDICTED: ABC transporter C family member 8-like [Glycine max] Back     alignment and taxonomy information
>gi|356526035|ref|XP_003531625.1| PREDICTED: ABC transporter C family member 8-like [Glycine max] Back     alignment and taxonomy information
>gi|356528827|ref|XP_003532999.1| PREDICTED: ABC transporter C family member 8-like [Glycine max] Back     alignment and taxonomy information
>gi|297743104|emb|CBI35971.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1467
TAIR|locus:20777501453 ABCC10 "ATP-binding cassette C 0.918 0.927 0.433 5.8e-295
TAIR|locus:20202351514 ABCC5 "ATP-binding cassette C5 0.485 0.470 0.411 2.3e-280
TAIR|locus:20900291514 ABCC3 "ATP-binding cassette C3 0.851 0.824 0.426 1.6e-269
TAIR|locus:20900391466 ABCC6 "ATP-binding cassette C6 0.914 0.914 0.401 1.3e-267
TAIR|locus:20900491493 ABCC7 "ATP-binding cassette C7 0.897 0.881 0.395 1.8e-259
TAIR|locus:20817551539 ABCC14 "ATP-binding cassette C 0.395 0.376 0.452 8.9e-259
TAIR|locus:20432681516 ABCC4 "ATP-binding cassette C4 0.856 0.829 0.397 6.3e-253
UNIPROTKB|E1C6S51552 ABCC2 "Uncharacterized protein 0.397 0.375 0.366 1.1e-189
DICTYBASE|DDB_G02848671593 abcC8 "ABC transporter C famil 0.351 0.323 0.389 9.7e-189
UNIPROTKB|O154391325 ABCC4 "Multidrug resistance-as 0.848 0.939 0.330 2.7e-187
TAIR|locus:2077750 ABCC10 "ATP-binding cassette C10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2832 (1002.0 bits), Expect = 5.8e-295, P = 5.8e-295
 Identities = 604/1392 (43%), Positives = 853/1392 (61%)

Query:    85 LWNLIAKNDSS--MSWLVSTVRGLIWVSLAISLLVKRSKWIRM----LITLWWMSFSLLV 138
             +W ++ +N S   + WLV  ++G  W+ + + + V+ ++ IR     L++++   + L+ 
Sbjct:    76 IW-VLRENHSKPLILWLVILIQGFTWLFINLIICVRGTR-IRKSSLRLLSIFSFFYGLVS 133

Query:   139 LALNI-------EILARTYTINVVYIXXXXXXXXXXFSAFR----NFSHFTSP-NREDKS 186
               L++       E+  RT  ++V+ +          +  +R      S    P N  D +
Sbjct:   134 SCLSVNNAVFGDELAVRTI-LDVLLLPGSVLLLLSAYKGYRFDESGESSLYEPLNAGDSN 192

Query:   187 -LSEPLLAEKNQTELGKAGLLRKLTFSWINPLLSLGYSKPLALEDIPSLVPEDEASFAYQ 245
               SE    +   ++  KAGL   L+F W+N L+  G  K L  EDIP L  E+ A   Y 
Sbjct:   193 GFSEKADFDNRVSQFAKAGLFSTLSFWWLNSLIKRGNVKDLEEEDIPELRKEERAETCYS 252

Query:   246 KFAYAWDSLVRENNSNNNGNLVRKVITNVYLKENIFIAICALLRTIAVVVGPLLLYAFVN 305
              F        R   S+   ++++  +  V+ +E +     A ++ +AV  GPLLL AF+ 
Sbjct:   253 LFEENLIEQKRRLGSSCQPSILKVTVLCVW-RELLTSGFFAFMKIVAVSAGPLLLNAFIL 311

Query:   306 YSNRGEENLQEGLSIVGCLIITKVVESFTQRHCFFXXXXXXXXXXXALMVAVYQKQLKLS 365
              +        EGL +   L  +K++ES +QR  +F            L  A+ +KQL+L+
Sbjct:   312 VAEGNASFRYEGLVLAVLLFFSKMIESLSQRQWYFRCRIVGLRVRSLLTAAINKKQLRLN 371

Query:   366 SLGRKKHSTGEIVNYIAVDAYRMGEFPFWFHLTWSLALQXXXXXXXXXXXXXXXXXXXXX 425
             +  R  HS  EI+NY  VDAYR+GEFP+WFH  W+ + Q                     
Sbjct:   372 NSSRLIHSGSEIMNYATVDAYRIGEFPYWFHQLWTTSFQLLIALGILFHSVGVATFSALA 431

Query:   426 XXXXCGLLNVPFAKILQKCQSEFMIAQDERLRSTSEILNNMKIIKLQSWEEKFKSLIESR 485
                   L N P AK+  K QSE M +QDERL++ +E L NMK++KL +WE  FK +IE  
Sbjct:   432 VIILTVLCNAPIAKLQNKFQSELMTSQDERLKACNESLVNMKVLKLYAWESHFKKVIEKL 491

Query:   486 REKEFKWLSEAQLRKAYGTVIYWMSPTIISSVIFLGCALTGSAPLNASTIFTVLATLRSM 545
             R  E K L   Q+RKAY  V++W SP  +S+  F  C      PL AS +FT +ATLR +
Sbjct:   492 RNIELKSLKAVQMRKAYNAVLFWSSPVFVSAATFATCYFL-DIPLRASNVFTFVATLRLV 550

Query:   546 GEPVRMIPEALSIMIQVKVSFDRINAFLLDHELNNDDVRRISLQKSDRS-VKIQEGNFSW 604
              +PVRMIP+ + + IQ KV+F RI  FL   EL   + RR    + +++ + I+  +FSW
Sbjct:   551 QDPVRMIPDVIGVTIQAKVAFSRIATFLEAPELQGGERRRKQRSEGNQNAIIIKSASFSW 610

Query:   605 DPELAI-PTLRGVNLDIKWAQKIAVCGSVGAGKSSLLYAILGEIPKISGTVNLYGSIAYV 663
             + + +  P LR V+L++K+ +K+AVCG VG+GKS+LL AILGE P +SGT++ YG+IAYV
Sbjct:   611 EEKGSTKPNLRNVSLEVKFGEKVAVCGEVGSGKSTLLAAILGETPCVSGTIDFYGTIAYV 670

Query:   664 SQTSWIQSGSIRDNILYGKPMDKARYDKAIKACALDKDINNFDHGDLTEIGQRGLNLSGG 723
             SQT+WIQ+G+IRDNIL+G  MD+ RY + I+  +LDKD+     GD TEIG+RG+NLSGG
Sbjct:   671 SQTAWIQTGTIRDNILFGGVMDEHRYRETIQKSSLDKDLELLPDGDQTEIGERGVNLSGG 730

Query:   724 QKQRIQLARAVYNDADIYLFDDPFSAVDAHTAATLFNECVMAALEKKTVILVTHQVEFLS 783
             QKQRIQLARA+Y DADIYL DDPFSAVDAHTA++LF E VM AL  K V+LVTHQV+FL 
Sbjct:   731 QKQRIQLARALYQDADIYLLDDPFSAVDAHTASSLFQEYVMDALAGKAVLLVTHQVDFLP 790

Query:   784 EVDRILVLEGGQITQSGNYQELLLAGTAFEQLVNAHRDAITGLGPLDNAGQGGAEKVEKG 843
               D +L++  G+IT++  YQELL     F+ LVNAHR+              G+E+V   
Sbjct:   791 AFDSVLLMSDGEITEADTYQELLARSRDFQDLVNAHRET------------AGSERVVA- 837

Query:   844 RTARPEEPNGIYPRKESSEGEISVKGLTQLTEDEEMEIGDVGWKPFMDYLNVSKGMSLLC 903
                 P +P     R  SS+ ++ +K  ++L + EE E GD G +P++ Y+N +KG     
Sbjct:   838 -VENPTKPVKEINRVISSQSKV-LKP-SRLIKQEEREKGDTGLRPYIQYMNQNKGYIFFF 894

Query:   904 LGVLAQSGFVGLQAAATYWLAYAIQIPKITSGILIGVYAGVSTASAVFVYFRSFFAAHLG 963
             +  LAQ  F   Q     W+A  +  P++++  LI VY  +   S + +  RS     + 
Sbjct:   895 IASLAQVTFAVGQILQNSWMAANVDNPQVSTLKLILVYLLIGLCSVLCLMVRSVCVVIMC 954

Query:   964 LKASKAFFSGFTNSIFKAPMLFFDSTPVGRILTRLSSDLSILDFDIPFSIVFVAASGTEL 1023
             +K+S + FS   NS+F+APM F+DSTP+GRIL+R+SSDLSI+D D+PF ++FV AS    
Sbjct:   955 MKSSASLFSQLLNSLFRAPMSFYDSTPLGRILSRVSSDLSIVDLDVPFGLIFVVASSVNT 1014

Query:  1024 LAIIGIMTFVTWQVLVVAIFAMVAVRF-VQRYYIATARELIRINGTTKAPVMNYTAETSQ 1082
                +G++  VTWQVL V++  MV + F +Q+YY  TA+EL+RINGTT++ V N+ AE+  
Sbjct:  1015 GCSLGVLAIVTWQVLFVSV-PMVYLAFRLQKYYFQTAKELMRINGTTRSYVANHLAESVA 1073

Query:  1083 GVVTIRAFNMVDRFFQNYLKLVDIDASLFFHTNGVMEWLILRVEALQNXXXXXXXXXXVL 1142
             G +TIRAF+  +RFF+  L L+D +AS FFH+    EWLI R+E +            +L
Sbjct:  1074 GAITIRAFDEEERFFKKSLTLIDTNASPFFHSFAANEWLIQRLETVSAIVLASTAFCMIL 1133

Query:  1143 IPRGYVAPGLVGLSLSYAFTLTGTQVFLSRWYCYLANYIISVERIKQFMHIPPEPPAIVE 1202
             +P G  + G +G++LSY  +L    V+  +  CYLAN+IISVER+ Q+ H+ PE P ++E
Sbjct:  1134 LPTGTFSSGFIGMALSYGLSLNMGLVYSVQNQCYLANWIISVERLNQYTHLTPEAPEVIE 1193

Query:  1203 DKRPPSSWPFKGRIELRQLKIRYRPNAPLVLKGITCTFSEXXXXXXXXXXXXXXXXLISA 1262
             + RPP +WP  GR+E+  L+IRYR  +PLVLKGI+CTF                  LISA
Sbjct:  1194 ETRPPVNWPVTGRVEISDLQIRYRRESPLVLKGISCTFEGGHKIGIVGRTGSGKTTLISA 1253

Query:  1263 LFRLVEPAGGSILIDGVDICSMGLKDLRVKLSIIPQEPTLFRGSVRTNLDPLGLYSDDEI 1322
             LFRLVEP GG I++DGVDI  +G+ DLR +  IIPQ+PTLF G+VR NLDPL  +SD EI
Sbjct:  1254 LFRLVEPVGGKIVVDGVDISKIGVHDLRSRFGIIPQDPTLFNGTVRFNLDPLCQHSDAEI 1313

Query:  1323 WKALEKCQLKTTISSLPNKLDSSVSDEGENWSAGQRQLFCLGRVLLKRNRILVLDEANAS 1382
             W+ L KCQLK  +    N LDS V ++G NWS GQRQLFCLGR +L+R+R+LVLDEA AS
Sbjct:  1314 WEVLGKCQLKEVVQEKENGLDSLVVEDGSNWSMGQRQLFCLGRAVLRRSRVLVLDEATAS 1373

Query:  1383 IDSATDAILQRIIRQEFSNCTVITVAHRVPTVIDSDMVMVLSYGKLLEYDEPSKLM-ETN 1441
             ID+ATD ILQ+ IR+EF++CTVITVAHR+PTV+D  MV+ +S G+++EYDEP KLM + N
Sbjct:  1374 IDNATDLILQKTIRREFADCTVITVAHRIPTVMDCTMVLSISDGRIVEYDEPMKLMKDEN 1433

Query:  1442 SSFSKLVAEYWS 1453
             S F KLV EYWS
Sbjct:  1434 SLFGKLVKEYWS 1445




GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM
GO:0006810 "transport" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
GO:0016887 "ATPase activity" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0042626 "ATPase activity, coupled to transmembrane movement of substances" evidence=IEA;ISS
GO:0055085 "transmembrane transport" evidence=IEA
GO:0005774 "vacuolar membrane" evidence=IDA
TAIR|locus:2020235 ABCC5 "ATP-binding cassette C5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090029 ABCC3 "ATP-binding cassette C3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090039 ABCC6 "ATP-binding cassette C6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090049 ABCC7 "ATP-binding cassette C7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081755 ABCC14 "ATP-binding cassette C14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043268 ABCC4 "ATP-binding cassette C4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E1C6S5 ABCC2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0284867 abcC8 "ABC transporter C family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|O15439 ABCC4 "Multidrug resistance-associated protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8LGU1AB8C_ARATH3, ., 6, ., 3, ., 4, 40.66660.99110.9931yesno
P39109YCFI_YEASTNo assigned EC number0.31710.96860.9379yesno
Q10185ABC2_SCHPO3, ., 6, ., 3, ., -0.34050.84250.8362yesno
O35379MRP1_MOUSENo assigned EC number0.33680.85270.8187yesno
Q54JR2ABCC3_DICDINo assigned EC number0.34840.82340.8555yesno
Q63120MRP2_RATNo assigned EC number0.34720.84520.8046yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00034196001
SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (1456 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00002277001
SubName- Full=Chromosome undetermined scaffold_129, whole genome shotgun sequence; (129 aa)
       0.481
GSVIVG00002276001
SubName- Full=Chromosome undetermined scaffold_129, whole genome shotgun sequence; (81 aa)
       0.481

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1467
PLN03130 1622 PLN03130, PLN03130, ABC transporter C family membe 0.0
TIGR009571522 TIGR00957, MRP_assoc_pro, multi drug resistance-as 0.0
PLN032321495 PLN03232, PLN03232, ABC transporter C family membe 0.0
PTZ002431560 PTZ00243, PTZ00243, ABC transporter; Provisional 1e-150
cd03244221 cd03244, ABCC_MRP_domain2, ATP-binding cassette do 1e-120
cd03250204 cd03250, ABCC_MRP_domain1, ATP-binding cassette do 1e-106
COG1132567 COG1132, MdlB, ABC-type multidrug transport system 2e-90
cd03369207 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 2e-87
TIGR01271 1490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 5e-76
TIGR012711490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 3e-75
cd03288257 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 4e-74
COG1132567 COG1132, MdlB, ABC-type multidrug transport system 6e-67
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 4e-66
cd03254229 cd03254, ABCC_Glucan_exporter_like, ATP-binding ca 1e-59
cd03291282 cd03291, ABCC_CFTR1, ATP-binding cassette domain o 2e-57
cd03289275 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 4e-55
cd03290218 cd03290, ABCC_SUR1_N, ATP-binding cassette domain 5e-53
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 3e-51
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 1e-50
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett 2e-50
cd03253236 cd03253, ABCC_ATM1_transporter, ATP-binding casset 2e-49
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/AT 5e-49
cd03251234 cd03251, ABCC_MsbA, ATP-binding cassette domain of 1e-48
PRK10790592 PRK10790, PRK10790, putative multidrug transporter 1e-48
COG4988559 COG4988, CydD, ABC-type transport system involved 1e-47
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) 2e-46
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP 2e-44
COG4988559 COG4988, CydD, ABC-type transport system involved 8e-44
TIGR03796710 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin syste 8e-44
COG4987573 COG4987, CydC, ABC-type transport system involved 3e-43
TIGR03797686 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste 3e-43
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion syste 3e-42
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion syste 8e-42
COG4987573 COG4987, CydC, ABC-type transport system involved 2e-41
cd03245220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 2e-41
cd03245220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 2e-41
cd03252237 cd03252, ABCC_Hemolysin, ATP-binding cassette doma 2e-41
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, Cyd 2e-40
cd03254229 cd03254, ABCC_Glucan_exporter_like, ATP-binding ca 3e-40
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 6e-40
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC trans 5e-39
cd03251234 cd03251, ABCC_MsbA, ATP-binding cassette domain of 3e-38
TIGR02868530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 3e-38
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett 6e-38
cd03253236 cd03253, ABCC_ATM1_transporter, ATP-binding casset 2e-37
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion syste 2e-37
COG5265497 COG5265, ATM1, ABC-type transport system involved 2e-37
cd03248226 cd03248, ABCC_TAP, ATP-binding cassette domain of 8e-37
PRK13657588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra 9e-37
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t 1e-36
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t 3e-36
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, Cyd 4e-36
PTZ00243 1560 PTZ00243, PTZ00243, ABC transporter; Provisional 6e-35
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/AT 5e-34
TIGR01192585 TIGR01192, chvA, glucan exporter ATP-binding prote 9e-33
cd03246173 cd03246, ABCC_Protease_Secretion, ATP-binding cass 2e-32
PRK10789569 PRK10789, PRK10789, putative multidrug transporter 2e-32
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion syste 7e-32
cd03244221 cd03244, ABCC_MRP_domain2, ATP-binding cassette do 1e-31
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP 2e-31
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC trans 4e-31
PRK11176582 PRK11176, PRK11176, lipid transporter ATP-binding/ 2e-30
TIGR03797686 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste 1e-29
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion syste 4e-29
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion syste 8e-29
cd03252237 cd03252, ABCC_Hemolysin, ATP-binding cassette doma 9e-29
cd03260227 cd03260, ABC_PstB_phosphate_transporter, ATP-bindi 9e-29
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport 1e-28
TIGR02868530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 3e-28
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 7e-28
cd03235213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 7e-28
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport 2e-27
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c 2e-27
cd03247178 cd03247, ABCC_cytochrome_bd, ATP-binding cassette 3e-27
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 3e-27
COG1131293 COG1131, CcmA, ABC-type multidrug transport system 3e-27
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC trans 9e-27
cd03248226 cd03248, ABCC_TAP, ATP-binding cassette domain of 1e-26
PRK13657588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra 1e-26
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 2e-26
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 5e-26
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 6e-26
cd03246173 cd03246, ABCC_Protease_Secretion, ATP-binding cass 7e-26
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon 7e-26
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Second domain of 1e-25
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) 2e-25
cd03247178 cd03247, ABCC_cytochrome_bd, ATP-binding cassette 3e-25
COG1131293 COG1131, CcmA, ABC-type multidrug transport system 3e-25
TIGR03796710 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin syste 2e-24
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, A 2e-24
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC trans 3e-24
PTZ002651466 PTZ00265, PTZ00265, multidrug resistance protein ( 4e-24
cd03259213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 6e-24
PRK11176582 PRK11176, PRK11176, lipid transporter ATP-binding/ 9e-24
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 3e-23
cd03255218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 3e-23
cd03229178 cd03229, ABC_Class3, ATP-binding cassette domain o 4e-23
cd03257228 cd03257, ABC_NikE_OppD_transporters, ATP-binding c 5e-23
pfam00664274 pfam00664, ABC_membrane, ABC transporter transmemb 1e-22
pfam00664274 pfam00664, ABC_membrane, ABC transporter transmemb 2e-22
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 2e-22
COG1135339 COG1135, AbcC, ABC-type metal ion transport system 2e-22
cd03260227 cd03260, ABC_PstB_phosphate_transporter, ATP-bindi 3e-22
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nic 3e-22
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca 3e-22
COG3839338 COG3839, MalK, ABC-type sugar transport systems, A 4e-22
cd03229178 cd03229, ABC_Class3, ATP-binding cassette domain o 6e-22
PRK13632271 PRK13632, cbiO, cobalt transporter ATP-binding sub 6e-22
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 7e-22
cd03250204 cd03250, ABCC_MRP_domain1, ATP-binding cassette do 9e-22
TIGR01192585 TIGR01192, chvA, glucan exporter ATP-binding prote 2e-21
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, A 2e-21
COG1118345 COG1118, CysA, ABC-type sulfate/molybdate transpor 2e-21
COG3839338 COG3839, MalK, ABC-type sugar transport systems, A 3e-21
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP- 3e-21
COG1123539 COG1123, COG1123, ATPase components of various ABC 3e-21
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide tran 4e-21
COG5265497 COG5265, ATM1, ABC-type transport system involved 5e-21
PRK10789569 PRK10789, PRK10789, putative multidrug transporter 6e-21
cd03299235 cd03299, ABC_ModC_like, ATP-binding cassette domai 6e-21
COG3842352 COG3842, PotA, ABC-type spermidine/putrescine tran 1e-20
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 3e-20
cd03230173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 3e-20
cd03256241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 3e-20
COG1127263 COG1127, Ttg2A, ABC-type transport system involved 4e-20
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 7e-20
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon 7e-20
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine t 8e-20
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate t 8e-20
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas 1e-19
cd03262213 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai 1e-19
cd03230173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 2e-19
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain 2e-19
cd03224222 cd03224, ABC_TM1139_LivF_branched, ATP-binding cas 2e-19
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate t 3e-19
cd03235213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 4e-19
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, 4e-19
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP 4e-19
COG1123 539 COG1123, COG1123, ATPase components of various ABC 5e-19
cd03259213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 7e-19
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport 1e-18
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid 1e-18
cd03369207 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 2e-18
cd03257228 cd03257, ABC_NikE_OppD_transporters, ATP-binding c 3e-18
TIGR03265353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate 3e-18
cd03258233 cd03258, ABC_MetN_methionine_transporter, ATP-bind 5e-18
cd03294269 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette 7e-18
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding sub 7e-18
cd03224222 cd03224, ABC_TM1139_LivF_branched, ATP-binding cas 1e-17
COG0488530 COG0488, Uup, ATPase components of ABC transporter 1e-17
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 1e-17
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca 2e-17
cd03258233 cd03258, ABC_MetN_methionine_transporter, ATP-bind 3e-17
cd03296239 cd03296, ABC_CysA_sulfate_importer, ATP-binding ca 3e-17
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPa 4e-17
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide tran 5e-17
cd03256241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 5e-17
cd03220224 cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon 5e-17
PRK10790592 PRK10790, PRK10790, putative multidrug transporter 6e-17
COG1123539 COG1123, COG1123, ATPase components of various ABC 6e-17
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-bind 6e-17
TIGR00957 1522 TIGR00957, MRP_assoc_pro, multi drug resistance-as 7e-17
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, 7e-17
pfam00005119 pfam00005, ABC_tran, ABC transporter 8e-17
COG1117253 COG1117, PstB, ABC-type phosphate transport system 8e-17
COG4178604 COG4178, COG4178, ABC-type uncharacterized transpo 9e-17
PRK13641287 PRK13641, cbiO, cobalt transporter ATP-binding sub 9e-17
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 9e-17
pfam00005119 pfam00005, ABC_tran, ABC transporter 1e-16
COG4175386 COG4175, ProV, ABC-type proline/glycine betaine tr 1e-16
cd03255218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 2e-16
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid 2e-16
PRK14254285 PRK14254, PRK14254, phosphate ABC transporter ATP- 2e-16
COG4525259 COG4525, TauB, ABC-type taurine transport system, 2e-16
cd03288257 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 3e-16
cd03266218 cd03266, ABC_NatA_sodium_exporter, ATP-binding cas 3e-16
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c 5e-16
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, 5e-16
cd03219236 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas 6e-16
PRK11264250 PRK11264, PRK11264, putative amino-acid ABC transp 6e-16
cd03216163 cd03216, ABC_Carb_Monos_I, First domain of the ATP 6e-16
COG1135339 COG1135, AbcC, ABC-type metal ion transport system 7e-16
TIGR01186363 TIGR01186, proV, glycine betaine/L-proline transpo 7e-16
TIGR03415382 TIGR03415, ABC_choXWV_ATP, choline ABC transporter 7e-16
PRK09452375 PRK09452, potA, putrescine/spermidine ABC transpor 9e-16
cd03298211 cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin 9e-16
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas 1e-15
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, 1e-15
PRK13636283 PRK13636, cbiO, cobalt transporter ATP-binding sub 1e-15
COG4619223 COG4619, COG4619, ABC-type uncharacterized transpo 1e-15
COG1134249 COG1134, TagH, ABC-type polysaccharide/polyol phos 1e-15
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ATP-bind 1e-15
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding pr 1e-15
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine t 2e-15
COG0488530 COG0488, Uup, ATPase components of ABC transporter 2e-15
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport s 2e-15
cd03218232 cd03218, ABC_YhbG, ATP-binding cassette component 2e-15
PRK14247250 PRK14247, PRK14247, phosphate ABC transporter ATP- 2e-15
PRK13648269 PRK13648, cbiO, cobalt transporter ATP-binding sub 2e-15
TIGR01277213 TIGR01277, thiQ, thiamine ABC transporter, ATP-bin 3e-15
COG1129500 COG1129, MglA, ABC-type sugar transport system, AT 3e-15
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nic 4e-15
TIGR01187325 TIGR01187, potA, spermidine/putrescine ABC transpo 4e-15
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPa 5e-15
COG1117253 COG1117, PstB, ABC-type phosphate transport system 5e-15
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, 5e-15
cd03300232 cd03300, ABC_PotA_N, ATP-binding cassette domain o 5e-15
cd03221144 cd03221, ABCF_EF-3, ATP-binding cassette domain of 5e-15
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, 7e-15
PRK13644274 PRK13644, cbiO, cobalt transporter ATP-binding sub 8e-15
COG4619223 COG4619, COG4619, ABC-type uncharacterized transpo 9e-15
PRK14262250 PRK14262, PRK14262, phosphate ABC transporter ATP- 9e-15
cd03289275 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 1e-14
COG1123539 COG1123, COG1123, ATPase components of various ABC 1e-14
PRK14240250 PRK14240, PRK14240, phosphate transporter ATP-bind 1e-14
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP- 1e-14
cd03269210 cd03269, ABC_putative_ATPase, ATP-binding cassette 1e-14
COG1127263 COG1127, Ttg2A, ABC-type transport system involved 2e-14
PRK13635279 PRK13635, cbiO, cobalt transporter ATP-binding sub 2e-14
COG1119257 COG1119, ModF, ABC-type molybdenum transport syste 2e-14
PRK14236272 PRK14236, PRK14236, phosphate transporter ATP-bind 2e-14
cd03234226 cd03234, ABCG_White, White pigment protein homolog 2e-14
PRK13642277 PRK13642, cbiO, cobalt transporter ATP-binding sub 2e-14
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 2e-14
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport 3e-14
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nic 3e-14
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC 3e-14
TIGR03258362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans 3e-14
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, 3e-14
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing sys 3e-14
TIGR01271 1490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 4e-14
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 5e-14
cd03218232 cd03218, ABC_YhbG, ATP-binding cassette component 5e-14
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell d 5e-14
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding sub 5e-14
cd03291282 cd03291, ABCC_CFTR1, ATP-binding cassette domain o 6e-14
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP 6e-14
TIGR03258 362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans 6e-14
PRK14249251 PRK14249, PRK14249, phosphate ABC transporter ATP- 6e-14
cd03215182 cd03215, ABC_Carb_Monos_II, Second domain of the A 6e-14
PRK14274259 PRK14274, PRK14274, phosphate ABC transporter ATP- 6e-14
PRK09536402 PRK09536, btuD, corrinoid ABC transporter ATPase; 7e-14
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Second domain of 1e-13
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nic 1e-13
cd03262213 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai 1e-13
TIGR01277213 TIGR01277, thiQ, thiamine ABC transporter, ATP-bin 1e-13
PRK09536 402 PRK09536, btuD, corrinoid ABC transporter ATPase; 1e-13
PRK15056272 PRK15056, PRK15056, manganese/iron transporter ATP 1e-13
PRK14267253 PRK14267, PRK14267, phosphate ABC transporter ATP- 1e-13
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-bind 1e-13
cd03292214 cd03292, ABC_FtsE_transporter, ATP-binding cassett 1e-13
PRK14245250 PRK14245, PRK14245, phosphate ABC transporter ATP- 1e-13
PRK10851353 PRK10851, PRK10851, sulfate/thiosulfate transporte 1e-13
COG1129 500 COG1129, MglA, ABC-type sugar transport system, AT 2e-13
PRK11231255 PRK11231, fecE, iron-dicitrate transporter ATP-bin 2e-13
TIGR02314343 TIGR02314, ABC_MetN, D-methionine ABC transporter, 2e-13
COG4608268 COG4608, AppF, ABC-type oligopeptide transport sys 2e-13
COG4608268 COG4608, AppF, ABC-type oligopeptide transport sys 2e-13
COG3842352 COG3842, PotA, ABC-type spermidine/putrescine tran 3e-13
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP- 3e-13
TIGR01184230 TIGR01184, ntrCD, nitrate transport ATP-binding su 3e-13
COG4604252 COG4604, CeuD, ABC-type enterochelin transport sys 3e-13
PRK14251251 PRK14251, PRK14251, phosphate ABC transporter ATP- 3e-13
PRK11248255 PRK11248, tauB, taurine transporter ATP-binding su 3e-13
PRK11000369 PRK11000, PRK11000, maltose/maltodextrin transport 4e-13
COG1101263 COG1101, PhnK, ABC-type uncharacterized transport 4e-13
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP- 5e-13
PRK14244251 PRK14244, PRK14244, phosphate ABC transporter ATP- 5e-13
PRK13650279 PRK13650, cbiO, cobalt transporter ATP-binding sub 5e-13
PRK14243264 PRK14243, PRK14243, phosphate transporter ATP-bind 5e-13
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra 1e-12
COG4559259 COG4559, COG4559, ABC-type hemin transport system, 1e-12
PRK13632271 PRK13632, cbiO, cobalt transporter ATP-binding sub 2e-12
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 2e-12
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport s 2e-12
PRK14244251 PRK14244, PRK14244, phosphate ABC transporter ATP- 2e-12
TIGR02769265 TIGR02769, nickel_nikE, nickel import ATP-binding 2e-12
TIGR02142 354 TIGR02142, modC_ABC, molybdenum ABC transporter, A 2e-12
PRK14269246 PRK14269, PRK14269, phosphate ABC transporter ATP- 2e-12
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding sub 2e-12
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid 2e-12
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin ex 2e-12
cd03298211 cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin 3e-12
PRK14270251 PRK14270, PRK14270, phosphate ABC transporter ATP- 3e-12
PRK09493240 PRK09493, glnQ, glutamine ABC transporter ATP-bind 3e-12
PRK13638271 PRK13638, cbiO, cobalt transporter ATP-binding sub 3e-12
PRK11153343 PRK11153, metN, DL-methionine transporter ATP-bind 3e-12
PRK14242253 PRK14242, PRK14242, phosphate transporter ATP-bind 3e-12
PRK14266250 PRK14266, PRK14266, phosphate ABC transporter ATP- 3e-12
PRK14264305 PRK14264, PRK14264, phosphate ABC transporter ATP- 3e-12
COG4148352 COG4148, ModC, ABC-type molybdate transport system 4e-12
COG4161242 COG4161, ArtP, ABC-type arginine transport system, 4e-12
PRK11650356 PRK11650, ugpC, glycerol-3-phosphate transporter A 4e-12
PRK14253249 PRK14253, PRK14253, phosphate ABC transporter ATP- 4e-12
PTZ002651466 PTZ00265, PTZ00265, multidrug resistance protein ( 5e-12
COG4178604 COG4178, COG4178, ABC-type uncharacterized transpo 5e-12
cd03299235 cd03299, ABC_ModC_like, ATP-binding cassette domai 6e-12
cd03296239 cd03296, ABC_CysA_sulfate_importer, ATP-binding ca 6e-12
PRK11231255 PRK11231, fecE, iron-dicitrate transporter ATP-bin 6e-12
PRK14273254 PRK14273, PRK14273, phosphate ABC transporter ATP- 8e-12
COG4181228 COG4181, COG4181, Predicted ABC-type transport sys 8e-12
PRK14256252 PRK14256, PRK14256, phosphate ABC transporter ATP- 8e-12
COG4615546 COG4615, PvdE, ABC-type siderophore export system, 8e-12
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin ex 9e-12
TIGR01194555 TIGR01194, cyc_pep_trnsptr, cyclic peptide transpo 9e-12
COG1129500 COG1129, MglA, ABC-type sugar transport system, AT 1e-11
PRK14251251 PRK14251, PRK14251, phosphate ABC transporter ATP- 1e-11
PRK14264305 PRK14264, PRK14264, phosphate ABC transporter ATP- 1e-11
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC trans 1e-11
COG3845501 COG3845, COG3845, ABC-type uncharacterized transpo 1e-11
PRK10744260 PRK10744, pstB, phosphate transporter ATP-binding 1e-11
PRK11629233 PRK11629, lolD, lipoprotein transporter ATP-bindin 1e-11
TIGR012711490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 2e-11
TIGR01186 363 TIGR01186, proV, glycine betaine/L-proline transpo 2e-11
COG1101263 COG1101, PhnK, ABC-type uncharacterized transport 2e-11
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi 2e-11
PRK14252265 PRK14252, PRK14252, phosphate ABC transporter ATP- 2e-11
PRK14272252 PRK14272, PRK14272, phosphate ABC transporter ATP- 2e-11
PRK10619257 PRK10619, PRK10619, histidine/lysine/arginine/orni 2e-11
PRK14257329 PRK14257, PRK14257, phosphate ABC transporter ATP- 3e-11
PRK13634290 PRK13634, cbiO, cobalt transporter ATP-binding sub 3e-11
COG4598256 COG4598, HisP, ABC-type histidine transport system 3e-11
PRK14263261 PRK14263, PRK14263, phosphate ABC transporter ATP- 3e-11
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c 3e-11
PRK14237267 PRK14237, PRK14237, phosphate transporter ATP-bind 3e-11
TIGR02633 500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 3e-11
COG4559259 COG4559, COG4559, ABC-type hemin transport system, 4e-11
cd03223166 cd03223, ABCD_peroxisomal_ALDP, ATP-binding casset 4e-11
cd03223166 cd03223, ABCD_peroxisomal_ALDP, ATP-binding casset 4e-11
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 4e-11
PRK14271276 PRK14271, PRK14271, phosphate ABC transporter ATP- 4e-11
PRK11247257 PRK11247, ssuB, aliphatic sulfonates transport ATP 4e-11
cd03290218 cd03290, ABCC_SUR1_N, ATP-binding cassette domain 5e-11
PRK14267253 PRK14267, PRK14267, phosphate ABC transporter ATP- 5e-11
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC trans 5e-11
PRK14261253 PRK14261, PRK14261, phosphate ABC transporter ATP- 5e-11
PRK10070400 PRK10070, PRK10070, glycine betaine transporter AT 5e-11
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-b 5e-11
PRK13644274 PRK13644, cbiO, cobalt transporter ATP-binding sub 7e-11
PRK14249251 PRK14249, PRK14249, phosphate ABC transporter ATP- 7e-11
PRK13536340 PRK13536, PRK13536, nodulation factor exporter sub 7e-11
COG4167267 COG4167, SapF, ABC-type antimicrobial peptide tran 7e-11
COG4604252 COG4604, CeuD, ABC-type enterochelin transport sys 8e-11
PRK13652277 PRK13652, cbiO, cobalt transporter ATP-binding sub 8e-11
PRK10535648 PRK10535, PRK10535, macrolide transporter ATP-bind 8e-11
PRK14240250 PRK14240, PRK14240, phosphate transporter ATP-bind 9e-11
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP- 9e-11
PRK13633280 PRK13633, PRK13633, cobalt transporter ATP-binding 9e-11
TIGR01187 325 TIGR01187, potA, spermidine/putrescine ABC transpo 1e-10
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 1e-10
PRK14258261 PRK14258, PRK14258, phosphate ABC transporter ATP- 1e-10
PRK11124242 PRK11124, artP, arginine transporter ATP-binding s 1e-10
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit 1e-10
PRK13549 506 PRK13549, PRK13549, xylose transporter ATP-binding 1e-10
COG4152300 COG4152, COG4152, ABC-type uncharacterized transpo 1e-10
PRK09984262 PRK09984, PRK09984, phosphonate/organophosphate es 1e-10
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi 1e-10
PRK14260259 PRK14260, PRK14260, phosphate ABC transporter ATP- 1e-10
PRK14247250 PRK14247, PRK14247, phosphate ABC transporter ATP- 2e-10
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell d 2e-10
PRK14266250 PRK14266, PRK14266, phosphate ABC transporter ATP- 2e-10
TIGR03005252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine AB 2e-10
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protei 2e-10
PRK13647274 PRK13647, cbiO, cobalt transporter ATP-binding sub 2e-10
PRK14259269 PRK14259, PRK14259, phosphate ABC transporter ATP- 2e-10
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein ( 3e-10
COG1118345 COG1118, CysA, ABC-type sulfate/molybdate transpor 3e-10
COG3845 501 COG3845, COG3845, ABC-type uncharacterized transpo 3e-10
PRK14261253 PRK14261, PRK14261, phosphate ABC transporter ATP- 3e-10
PRK10070 400 PRK10070, PRK10070, glycine betaine transporter AT 3e-10
cd03237246 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-bin 3e-10
PRK11144352 PRK11144, modC, molybdate transporter ATP-binding 3e-10
PRK10895241 PRK10895, PRK10895, lipopolysaccharide ABC transpo 3e-10
PRK10771232 PRK10771, thiQ, thiamine transporter ATP-binding s 3e-10
cd03294269 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette 4e-10
cd03220224 cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon 4e-10
PRK13643288 PRK13643, cbiO, cobalt transporter ATP-binding sub 4e-10
PRK14238271 PRK14238, PRK14238, phosphate transporter ATP-bind 4e-10
PRK14235267 PRK14235, PRK14235, phosphate transporter ATP-bind 4e-10
COG0488 530 COG0488, Uup, ATPase components of ABC transporter 5e-10
PRK13652277 PRK13652, cbiO, cobalt transporter ATP-binding sub 5e-10
PRK13647274 PRK13647, cbiO, cobalt transporter ATP-binding sub 5e-10
PRK10744260 PRK10744, pstB, phosphate transporter ATP-binding 8e-10
TIGR02142354 TIGR02142, modC_ABC, molybdenum ABC transporter, A 9e-10
PRK14254285 PRK14254, PRK14254, phosphate ABC transporter ATP- 1e-09
PRK14262250 PRK14262, PRK14262, phosphate ABC transporter ATP- 1e-09
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, 1e-09
cd03292214 cd03292, ABC_FtsE_transporter, ATP-binding cassett 1e-09
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra 1e-09
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid 1e-09
PRK14242253 PRK14242, PRK14242, phosphate transporter ATP-bind 1e-09
PRK14237267 PRK14237, PRK14237, phosphate transporter ATP-bind 1e-09
PRK10575265 PRK10575, PRK10575, iron-hydroxamate transporter A 1e-09
cd03265220 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist 1e-09
COG4175 386 COG4175, ProV, ABC-type proline/glycine betaine tr 2e-09
cd03219236 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas 2e-09
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding sub 2e-09
PRK14253249 PRK14253, PRK14253, phosphate ABC transporter ATP- 2e-09
PRK14272252 PRK14272, PRK14272, phosphate ABC transporter ATP- 2e-09
PRK10771232 PRK10771, thiQ, thiamine transporter ATP-binding s 2e-09
COG4133209 COG4133, CcmA, ABC-type transport system involved 2e-09
COG4172534 COG4172, COG4172, ABC-type uncharacterized transpo 2e-09
COG4172534 COG4172, COG4172, ABC-type uncharacterized transpo 2e-09
PRK14248268 PRK14248, PRK14248, phosphate ABC transporter ATP- 2e-09
PRK10584228 PRK10584, PRK10584, putative ABC transporter ATP-b 2e-09
PRK13635279 PRK13635, cbiO, cobalt transporter ATP-binding sub 3e-09
PRK11153343 PRK11153, metN, DL-methionine transporter ATP-bind 3e-09
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c 3e-09
PRK11247257 PRK11247, ssuB, aliphatic sulfonates transport ATP 3e-09
PRK14265274 PRK14265, PRK14265, phosphate ABC transporter ATP- 3e-09
PRK13646286 PRK13646, cbiO, cobalt transporter ATP-binding sub 3e-09
TIGR00954659 TIGR00954, 3a01203, Peroxysomal Fatty Acyl CoA Tra 3e-09
PRK09700510 PRK09700, PRK09700, D-allose transporter ATP-bindi 3e-09
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ATP-bind 4e-09
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding pr 4e-09
PRK14252265 PRK14252, PRK14252, phosphate ABC transporter ATP- 4e-09
PRK13649280 PRK13649, cbiO, cobalt transporter ATP-binding sub 4e-09
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport syst 4e-09
PRK14275286 PRK14275, PRK14275, phosphate ABC transporter ATP- 4e-09
COG4615546 COG4615, PvdE, ABC-type siderophore export system, 5e-09
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protei 5e-09
TIGR00955617 TIGR00955, 3a01204, The Eye Pigment Precursor Tran 5e-09
cd03269210 cd03269, ABC_putative_ATPase, ATP-binding cassette 6e-09
PRK14269246 PRK14269, PRK14269, phosphate ABC transporter ATP- 6e-09
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain 7e-09
PRK10419268 PRK10419, nikE, nickel transporter ATP-binding pro 7e-09
COG0396251 COG0396, sufC, Cysteine desulfurase activator ATPa 7e-09
cd03231201 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biog 8e-09
cd03231201 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biog 8e-09
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein ( 1e-08
COG4148 352 COG4148, ModC, ABC-type molybdate transport system 1e-08
COG4181228 COG4181, COG4181, Predicted ABC-type transport sys 1e-08
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 1e-08
PRK14258261 PRK14258, PRK14258, phosphate ABC transporter ATP- 1e-08
PRK14275286 PRK14275, PRK14275, phosphate ABC transporter ATP- 1e-08
PRK09544251 PRK09544, znuC, high-affinity zinc transporter ATP 1e-08
PRK11614237 PRK11614, livF, leucine/isoleucine/valine transpor 1e-08
PRK14268258 PRK14268, PRK14268, phosphate ABC transporter ATP- 1e-08
PRK13631320 PRK13631, cbiO, cobalt transporter ATP-binding sub 1e-08
PTZ00243 1560 PTZ00243, PTZ00243, ABC transporter; Provisional 2e-08
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding sub 2e-08
cd03265220 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist 2e-08
COG4133209 COG4133, CcmA, ABC-type transport system involved 2e-08
PRK13631320 PRK13631, cbiO, cobalt transporter ATP-binding sub 2e-08
PRK11432351 PRK11432, fbpC, ferric transporter ATP-binding sub 2e-08
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter famil 2e-08
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing sys 3e-08
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit 3e-08
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi 3e-08
PRK14259269 PRK14259, PRK14259, phosphate ABC transporter ATP- 3e-08
PRK14235267 PRK14235, PRK14235, phosphate transporter ATP-bind 3e-08
PRK13537306 PRK13537, PRK13537, nodulation ABC transporter Nod 3e-08
PRK13642277 PRK13642, cbiO, cobalt transporter ATP-binding sub 4e-08
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein 4e-08
TIGR02324224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase sys 4e-08
PRK14257329 PRK14257, PRK14257, phosphate ABC transporter ATP- 5e-08
PRK13643288 PRK13643, cbiO, cobalt transporter ATP-binding sub 5e-08
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transpo 5e-08
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-bind 6e-08
TIGR02314343 TIGR02314, ABC_MetN, D-methionine ABC transporter, 6e-08
PRK15112267 PRK15112, PRK15112, antimicrobial peptide ABC syst 6e-08
PRK15079331 PRK15079, PRK15079, oligopeptide ABC transporter A 6e-08
PRK15079331 PRK15079, PRK15079, oligopeptide ABC transporter A 6e-08
cd03266218 cd03266, ABC_NatA_sodium_exporter, ATP-binding cas 7e-08
cd03215182 cd03215, ABC_Carb_Monos_II, Second domain of the A 7e-08
PRK14238271 PRK14238, PRK14238, phosphate transporter ATP-bind 7e-08
PRK13641287 PRK13641, cbiO, cobalt transporter ATP-binding sub 8e-08
PRK14270251 PRK14270, PRK14270, phosphate ABC transporter ATP- 8e-08
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein 8e-08
TIGR01184230 TIGR01184, ntrCD, nitrate transport ATP-binding su 9e-08
PRK14241258 PRK14241, PRK14241, phosphate transporter ATP-bind 9e-08
PRK14274259 PRK14274, PRK14274, phosphate ABC transporter ATP- 1e-07
TIGR02769265 TIGR02769, nickel_nikE, nickel import ATP-binding 1e-07
PRK14256252 PRK14256, PRK14256, phosphate ABC transporter ATP- 1e-07
COG3845501 COG3845, COG3845, ABC-type uncharacterized transpo 1e-07
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 1e-07
PRK09700510 PRK09700, PRK09700, D-allose transporter ATP-bindi 1e-07
PRK15439510 PRK15439, PRK15439, autoinducer 2 ABC transporter 1e-07
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC t 1e-07
PRK11831269 PRK11831, PRK11831, putative ABC transporter ATP-b 1e-07
cd03222177 cd03222, ABC_RNaseL_inhibitor, ATP-binding cassett 1e-07
cd03267236 cd03267, ABC_NatA_like, ATP-binding cassette domai 1e-07
PRK14273254 PRK14273, PRK14273, phosphate ABC transporter ATP- 2e-07
PRK10535 648 PRK10535, PRK10535, macrolide transporter ATP-bind 2e-07
PRK13633280 PRK13633, PRK13633, cobalt transporter ATP-binding 2e-07
TIGR03005252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine AB 2e-07
PRK14268258 PRK14268, PRK14268, phosphate ABC transporter ATP- 2e-07
PRK13538204 PRK13538, PRK13538, cytochrome c biogenesis protei 2e-07
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibi 2e-07
PRK15064530 PRK15064, PRK15064, ABC transporter ATP-binding pr 2e-07
PRK10261 623 PRK10261, PRK10261, glutathione transporter ATP-bi 2e-07
smart00382148 smart00382, AAA, ATPases associated with a variety 2e-07
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding 2e-07
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-bind 3e-07
cd03216163 cd03216, ABC_Carb_Monos_I, First domain of the ATP 3e-07
cd03300232 cd03300, ABC_PotA_N, ATP-binding cassette domain o 3e-07
PRK13650279 PRK13650, cbiO, cobalt transporter ATP-binding sub 3e-07
PRK13537306 PRK13537, PRK13537, nodulation ABC transporter Nod 3e-07
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding 3e-07
TIGR02770230 TIGR02770, nickel_nikD, nickel import ATP-binding 3e-07
COG4136213 COG4136, COG4136, ABC-type uncharacterized transpo 3e-07
PRK10253265 PRK10253, PRK10253, iron-enterobactin transporter 3e-07
TIGR02323253 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase sys 4e-07
TIGR03522301 TIGR03522, GldA_ABC_ATP, gliding motility-associat 4e-07
TIGR03740223 TIGR03740, galliderm_ABC, gallidermin-class lantib 4e-07
PRK10908222 PRK10908, PRK10908, cell division protein FtsE; Pr 4e-07
PRK10851353 PRK10851, PRK10851, sulfate/thiosulfate transporte 5e-07
COG4167267 COG4167, SapF, ABC-type antimicrobial peptide tran 5e-07
COG4107258 COG4107, PhnK, ABC-type phosphonate transport syst 6e-07
COG1119257 COG1119, ModF, ABC-type molybdenum transport syste 7e-07
PLN03073718 PLN03073, PLN03073, ABC transporter F family; Prov 7e-07
PRK11607377 PRK11607, potG, putrescine transporter ATP-binding 7e-07
PRK14245250 PRK14245, PRK14245, phosphate ABC transporter ATP- 8e-07
TIGR01194555 TIGR01194, cyc_pep_trnsptr, cyclic peptide transpo 8e-07
PRK13634290 PRK13634, cbiO, cobalt transporter ATP-binding sub 8e-07
PRK11264250 PRK11264, PRK11264, putative amino-acid ABC transp 1e-06
COG1134249 COG1134, TagH, ABC-type polysaccharide/polyol phos 1e-06
PRK14271276 PRK14271, PRK14271, phosphate ABC transporter ATP- 1e-06
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-b 1e-06
PRK13536340 PRK13536, PRK13536, nodulation factor exporter sub 1e-06
PRK14260259 PRK14260, PRK14260, phosphate ABC transporter ATP- 1e-06
PRK15112267 PRK15112, PRK15112, antimicrobial peptide ABC syst 1e-06
PRK15439 510 PRK15439, PRK15439, autoinducer 2 ABC transporter 1e-06
COG4136213 COG4136, COG4136, ABC-type uncharacterized transpo 1e-06
PLN03073718 PLN03073, PLN03073, ABC transporter F family; Prov 1e-06
COG4586325 COG4586, COG4586, ABC-type uncharacterized transpo 1e-06
PRK13636283 PRK13636, cbiO, cobalt transporter ATP-binding sub 2e-06
cd03221144 cd03221, ABCF_EF-3, ATP-binding cassette domain of 2e-06
PRK14236272 PRK14236, PRK14236, phosphate transporter ATP-bind 2e-06
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC 2e-06
PRK14248268 PRK14248, PRK14248, phosphate ABC transporter ATP- 2e-06
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC t 2e-06
PRK11607 377 PRK11607, potG, putrescine transporter ATP-binding 2e-06
PRK10522547 PRK10522, PRK10522, multidrug transporter membrane 2e-06
PRK13645289 PRK13645, cbiO, cobalt transporter ATP-binding sub 2e-06
COG3845501 COG3845, COG3845, ABC-type uncharacterized transpo 3e-06
cd03237246 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-bin 3e-06
COG4172534 COG4172, COG4172, ABC-type uncharacterized transpo 3e-06
COG0396251 COG0396, sufC, Cysteine desulfurase activator ATPa 3e-06
TIGR03269 520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 4e-06
COG4172 534 COG4172, COG4172, ABC-type uncharacterized transpo 4e-06
PRK10261623 PRK10261, PRK10261, glutathione transporter ATP-bi 4e-06
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP- 5e-06
PRK10619257 PRK10619, PRK10619, histidine/lysine/arginine/orni 5e-06
PRK10895241 PRK10895, PRK10895, lipopolysaccharide ABC transpo 5e-06
PRK13646286 PRK13646, cbiO, cobalt transporter ATP-binding sub 5e-06
TIGR01978243 TIGR01978, sufC, FeS assembly ATPase SufC 5e-06
COG4161242 COG4161, ArtP, ABC-type arginine transport system, 6e-06
PRK11432351 PRK11432, fbpC, ferric transporter ATP-binding sub 6e-06
PRK10762501 PRK10762, PRK10762, D-ribose transporter ATP bindi 6e-06
PRK10982491 PRK10982, PRK10982, galactose/methyl galaxtoside t 6e-06
PRK13648269 PRK13648, cbiO, cobalt transporter ATP-binding sub 7e-06
PRK13538204 PRK13538, PRK13538, cytochrome c biogenesis protei 7e-06
TIGR03411242 TIGR03411, urea_trans_UrtD, urea ABC transporter, 7e-06
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi 8e-06
COG0488530 COG0488, Uup, ATPase components of ABC transporter 9e-06
TIGR03265 353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate 1e-05
COG4525259 COG4525, TauB, ABC-type taurine transport system, 1e-05
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport syst 1e-05
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter famil 1e-05
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transpo 1e-05
PRK14241258 PRK14241, PRK14241, phosphate transporter ATP-bind 1e-05
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibi 1e-05
TIGR02323253 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase sys 1e-05
COG4586325 COG4586, COG4586, ABC-type uncharacterized transpo 1e-05
COG4138248 COG4138, BtuD, ABC-type cobalamin transport system 1e-05
PRK15134529 PRK15134, PRK15134, microcin C ABC transporter ATP 1e-05
PRK11248255 PRK11248, tauB, taurine transporter ATP-binding su 2e-05
PRK10575265 PRK10575, PRK10575, iron-hydroxamate transporter A 2e-05
cd03267236 cd03267, ABC_NatA_like, ATP-binding cassette domai 2e-05
TIGR03411242 TIGR03411, urea_trans_UrtD, urea ABC transporter, 2e-05
COG2401593 COG2401, COG2401, ABC-type ATPase fused to a predi 2e-05
PRK09544251 PRK09544, znuC, high-affinity zinc transporter ATP 3e-05
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibi 3e-05
TIGR03719552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot 3e-05
PRK11022326 PRK11022, dppD, dipeptide transporter ATP-binding 3e-05
smart00382148 smart00382, AAA, ATPases associated with a variety 4e-05
PRK10908222 PRK10908, PRK10908, cell division protein FtsE; Pr 4e-05
PRK10522547 PRK10522, PRK10522, multidrug transporter membrane 4e-05
PRK03695248 PRK03695, PRK03695, vitamin B12-transporter ATPase 4e-05
cd03233202 cd03233, ABCG_PDR_domain1, First domain of the ple 4e-05
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein ( 5e-05
cd03234226 cd03234, ABCG_White, White pigment protein homolog 5e-05
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding sub 5e-05
PRK13645289 PRK13645, cbiO, cobalt transporter ATP-binding sub 5e-05
PRK13638271 PRK13638, cbiO, cobalt transporter ATP-binding sub 6e-05
COG4598256 COG4598, HisP, ABC-type histidine transport system 6e-05
cd03238176 cd03238, ABC_UvrA, ATP-binding cassette domain of 6e-05
PRK14263261 PRK14263, PRK14263, phosphate ABC transporter ATP- 7e-05
cd03236255 cd03236, ABC_RNaseL_inhibitor_domain1, The ATP-bin 7e-05
PRK15093330 PRK15093, PRK15093, antimicrobial peptide ABC tran 8e-05
PRK10419268 PRK10419, nikE, nickel transporter ATP-binding pro 9e-05
TIGR03719 552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot 9e-05
PRK11308327 PRK11308, dppF, dipeptide transporter ATP-binding 9e-05
PRK10636638 PRK10636, PRK10636, putative ABC transporter ATP-b 9e-05
PRK09452 375 PRK09452, potA, putrescine/spermidine ABC transpor 1e-04
PRK14243264 PRK14243, PRK14243, phosphate transporter ATP-bind 1e-04
PRK09493240 PRK09493, glnQ, glutamine ABC transporter ATP-bind 1e-04
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 1e-04
COG4152300 COG4152, COG4152, ABC-type uncharacterized transpo 1e-04
PRK10261623 PRK10261, PRK10261, glutathione transporter ATP-bi 1e-04
TIGR03719552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot 1e-04
COG4170330 COG4170, SapD, ABC-type antimicrobial peptide tran 1e-04
PRK13409590 PRK13409, PRK13409, putative ATPase RIL; Provision 1e-04
PLN03211 659 PLN03211, PLN03211, ABC transporter G-25; Provisio 1e-04
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 2e-04
COG4107258 COG4107, PhnK, ABC-type phosphonate transport syst 2e-04
COG4138248 COG4138, BtuD, ABC-type cobalamin transport system 2e-04
PRK13409590 PRK13409, PRK13409, putative ATPase RIL; Provision 2e-04
PRK13409590 PRK13409, PRK13409, putative ATPase RIL; Provision 2e-04
PRK11288501 PRK11288, araG, L-arabinose transporter ATP-bindin 2e-04
TIGR02324224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase sys 3e-04
cd03227162 cd03227, ABC_Class2, ATP-binding cassette domain o 3e-04
PRK11614237 PRK11614, livF, leucine/isoleucine/valine transpor 4e-04
PRK11831269 PRK11831, PRK11831, putative ABC transporter ATP-b 4e-04
PRK11288 501 PRK11288, araG, L-arabinose transporter ATP-bindin 4e-04
PRK10418254 PRK10418, nikD, nickel transporter ATP-binding pro 4e-04
PRK13547272 PRK13547, hmuV, hemin importer ATP-binding subunit 4e-04
PRK13549506 PRK13549, PRK13549, xylose transporter ATP-binding 5e-04
PRK09700 510 PRK09700, PRK09700, D-allose transporter ATP-bindi 5e-04
TIGR02770230 TIGR02770, nickel_nikD, nickel import ATP-binding 5e-04
TIGR01978243 TIGR01978, sufC, FeS assembly ATPase SufC 5e-04
COG1129500 COG1129, MglA, ABC-type sugar transport system, AT 6e-04
PRK11701258 PRK11701, phnK, phosphonate C-P lyase system prote 6e-04
cd03216163 cd03216, ABC_Carb_Monos_I, First domain of the ATP 7e-04
COG4778235 COG4778, PhnL, ABC-type phosphonate transport syst 9e-04
PRK11308327 PRK11308, dppF, dipeptide transporter ATP-binding 0.001
PRK10636638 PRK10636, PRK10636, putative ABC transporter ATP-b 0.001
COG4778235 COG4778, PhnL, ABC-type phosphonate transport syst 0.001
PRK11300255 PRK11300, livG, leucine/isoleucine/valine transpor 0.001
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 0.002
PRK13649280 PRK13649, cbiO, cobalt transporter ATP-binding sub 0.002
PRK15064530 PRK15064, PRK15064, ABC transporter ATP-binding pr 0.002
PLN03211659 PLN03211, PLN03211, ABC transporter G-25; Provisio 0.002
PRK11288501 PRK11288, araG, L-arabinose transporter ATP-bindin 0.002
PRK13540200 PRK13540, PRK13540, cytochrome c biogenesis protei 0.002
PRK13543214 PRK13543, PRK13543, cytochrome c biogenesis protei 0.002
PRK09473330 PRK09473, oppD, oligopeptide transporter ATP-bindi 0.002
PRK11819556 PRK11819, PRK11819, putative ABC transporter ATP-b 0.002
PRK15056272 PRK15056, PRK15056, manganese/iron transporter ATP 0.003
PRK11288501 PRK11288, araG, L-arabinose transporter ATP-bindin 0.003
PRK14265274 PRK14265, PRK14265, phosphate ABC transporter ATP- 0.004
PRK10982 491 PRK10982, PRK10982, galactose/methyl galaxtoside t 0.004
PRK13409 590 PRK13409, PRK13409, putative ATPase RIL; Provision 0.004
PRK13546264 PRK13546, PRK13546, teichoic acids export protein 0.004
>gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional Back     alignment and domain information
 Score =  812 bits (2099), Expect = 0.0
 Identities = 492/1516 (32%), Positives = 785/1516 (51%), Gaps = 123/1516 (8%)

Query: 13   WTCEGEFDLGSF--C-IQSTIIDVINLV--FFCVFYLSLLVGSFR-KNHNYGRIRRECVS 66
            W  + +   G++  C   S +I++ +LV    C++ + L+    + +             
Sbjct: 18   WAKKVDNAFGAYTPCATDSLVINISHLVLLGLCLYRIWLIKKDHKVQRFCLRSKWYNYFL 77

Query: 67   IVVSACCAVVGIAYLGYCLWNLIAKNDSSMS--WLVS-TVRGLIWVSLAISLLVKRSKWI 123
             +++A C    +  L   +  L     +S+    +VS  V  L W S+ + + V+   +I
Sbjct: 78   ALLAAYCTAEPLFRLVMGISVLNLDGQTSLPPFEIVSLIVEALTWCSMLVMIGVETKIYI 137

Query: 124  RMLITLWWMSFSLLVL------ALNIEILARTY---TINVVYILPLPVNLL---LLFSAF 171
            R     W++ F+++ +       LN+ +  + Y    +  +YI  +   +L   LL   F
Sbjct: 138  REFR--WYVRFAVIYVLVGDAVMLNLVLSVKEYYSSFVLYLYISEVAAQVLFGILLLVYF 195

Query: 172  RNFSHFT--SPNREDKSLS---EPLLAEKNQTELGKAGLLRKLTFSWINPLLSLGYSKPL 226
             N   +   +P   +       E L   +       A +  ++ F W+ PL+ LGY +PL
Sbjct: 196  PNLDPYPGYTPIGSESVDDYEYEELPGGEQICPERHANIFSRIFFGWMTPLMQLGYKRPL 255

Query: 227  ALEDIPSLVPEDEASFAYQKFAYAWDSLVRENNSNNNGNLVRKVITNVYLKENIFIA-IC 285
              +D+  L   D+    Y+ F   WD    E        L+R +  N  L    ++    
Sbjct: 256  TEKDVWKLDTWDQTETLYRSFQKCWD----EELKKPKPWLLRAL--NNSLGGRFWLGGFF 309

Query: 286  ALLRTIAVVVGPLLLYAFVNYSNRGEENLQEGLS-----IVGCLIITKVVESFTQRHCFF 340
             +   ++  VGPLLL       N   E++Q G       I    I   VV        +F
Sbjct: 310  KIGNDLSQFVGPLLL-------NLLLESMQNGEPAWIGYIYAFSIFVGVVLGVLCEAQYF 362

Query: 341  GS-RRSGMRMRSALMVAVYQKQLKLSSLGRKKHSTGEIVNYIAVDAYRMGEFPFWFHLTW 399
             +  R G R+RS L+ AV++K L+L+  GRKK ++G+I N +  DA  + +     H  W
Sbjct: 363  QNVMRVGFRLRSTLVAAVFRKSLRLTHEGRKKFTSGKITNLMTTDAEALQQICQQLHTLW 422

Query: 400  SLALQLFLAIGVLFGVVGLGALPG-LVLFLICGLLNVPFAKILQKCQSEFMIAQDERLRS 458
            S   ++ +A+ +L+  +G+ +L G L+L L+  +     +K +QK   E +   D+R+  
Sbjct: 423  SAPFRIIIAMVLLYQQLGVASLIGSLMLVLMFPIQTFIISK-MQKLTKEGLQRTDKRIGL 481

Query: 459  TSEILNNMKIIKLQSWEEKFKSLIESRREKEFKWLSEAQLRKAYGTVIYWMSPTIISSVI 518
             +E+L  M  +K  +WE  F+S +++ R+ E  W  +AQL  A+ + I    P +++ V 
Sbjct: 482  MNEVLAAMDTVKCYAWENSFQSKVQTVRDDELSWFRKAQLLSAFNSFILNSIPVLVTVVS 541

Query: 519  F-----LGCALTGSAPLNASTIFTVLATLRSMGEPVRMIPEALSIMIQVKVSFDRINAFL 573
            F     LG  LT   P  A T  ++ A LR    P+ M+P  ++  +   VS  R+   L
Sbjct: 542  FGVFTLLGGDLT---PARAFTSLSLFAVLRF---PLFMLPNLITQAVNANVSLKRLEELL 595

Query: 574  LDHELNNDDVRRI-----SLQKSDRSVKIQEGNFSWDPELAIPTLRGVNLDIKWAQKIAV 628
            L  E       R+      L+    ++ I+ G FSWD +   PTL  +NLD+     +A+
Sbjct: 596  LAEE-------RVLLPNPPLEPGLPAISIKNGYFSWDSKAERPTLSNINLDVPVGSLVAI 648

Query: 629  CGSVGAGKSSLLYAILGEIPKIS-GTVNLYGSIAYVSQTSWIQSGSIRDNILYGKPMDKA 687
             GS G GK+SL+ A+LGE+P  S  +V + G++AYV Q SWI + ++RDNIL+G P D  
Sbjct: 649  VGSTGEGKTSLISAMLGELPPRSDASVVIRGTVAYVPQVSWIFNATVRDNILFGSPFDPE 708

Query: 688  RYDKAIKACALDKDINNFDHGDLTEIGQRGLNLSGGQKQRIQLARAVYNDADIYLFDDPF 747
            RY++AI   AL  D++    GDLTEIG+RG+N+SGGQKQR+ +ARAVY+++D+Y+FDDP 
Sbjct: 709  RYERAIDVTALQHDLDLLPGGDLTEIGERGVNISGGQKQRVSMARAVYSNSDVYIFDDPL 768

Query: 748  SAVDAHTAATLFNECVMAALEKKTVILVTHQVEFLSEVDRILVLEGGQITQSGNYQELLL 807
            SA+DAH    +F++C+   L  KT +LVT+Q+ FLS+VDRI+++  G I + G Y+EL  
Sbjct: 769  SALDAHVGRQVFDKCIKDELRGKTRVLVTNQLHFLSQVDRIILVHEGMIKEEGTYEELSN 828

Query: 808  AGTAFEQLV-NAHRDAITGLGPLDNAGQGGAEKVEKGRTARP---EEPNGIYPRKESSEG 863
             G  F++L+ NA        G ++   +   E+ +   +++P      N +  +K+SS  
Sbjct: 829  NGPLFQKLMENA--------GKMEEYVEENGEEEDDQTSSKPVANGNANNL--KKDSSSK 878

Query: 864  EISVKGLTQLTEDEEMEIGDVGWKPFMDYLNVSKG----MSLLCLGVLAQSGFVGLQAAA 919
            + S +G + L + EE E G V WK    Y N   G    M L    VL +      + ++
Sbjct: 879  KKSKEGKSVLIKQEERETGVVSWKVLERYKNALGGAWVVMILFLCYVLTEV----FRVSS 934

Query: 920  TYWLAYAIQ--IPKITS-GILIGVYAGVSTASAVFVYFRSFFAAHLGLKASKAFFSGFTN 976
            + WL+       PK         +YA +S    +     S++     L A+K        
Sbjct: 935  STWLSEWTDQGTPKTHGPLFYNLIYALLSFGQVLVTLLNSYWLIMSSLYAAKRLHDAMLG 994

Query: 977  SIFKAPMLFFDSTPVGRILTRLSSDLSILDFDI-PFSIVFVAASGTELL---AIIGIM-T 1031
            SI +APM FF + P+GRI+ R + DL  +D ++  F  +F+     +LL    +IGI+ T
Sbjct: 995  SILRAPMSFFHTNPLGRIINRFAKDLGDIDRNVAVFVNMFLG-QIFQLLSTFVLIGIVST 1053

Query: 1032 FVTWQVLVVAIFAMVAVRFVQRYYIATARELIRINGTTKAPVMNYTAETSQGVVTIRAFN 1091
               W ++ + +    A      YY +TARE+ R++  T++PV     E   G+ TIRA+ 
Sbjct: 1054 ISLWAIMPLLVLFYGAYL----YYQSTAREVKRLDSITRSPVYAQFGEALNGLSTIRAYK 1109

Query: 1092 MVDRFFQNYLKLVDIDASLFFHTNGVMEWLILRVEALQNLTLFTAALFLVL-----IPRG 1146
              DR  +   + +D +            WL +R+E L  L ++  A F V+       + 
Sbjct: 1110 AYDRMAEINGRSMDNNIRFTLVNMSSNRWLAIRLETLGGLMIWLTASFAVMQNGRAENQA 1169

Query: 1147 YVAPGLVGLSLSYAFTLTGTQVFLSRWYCYLANYIISVERIKQFMHIPPEPPAIVEDKRP 1206
              A   +GL LSYA  +T     + R      N + +VER+  ++ +P E P ++E+ RP
Sbjct: 1170 AFAS-TMGLLLSYALNITSLLTAVLRLASLAENSLNAVERVGTYIDLPSEAPLVIENNRP 1228

Query: 1207 PSSWPFKGRIELRQLKIRYRPNAPLVLKGITCTFSEGTRVGVVGRTGSGKTTLISALFRL 1266
            P  WP  G I+   + +RYRP  P VL G++   S   +VG+VGRTG+GK+++++ALFR+
Sbjct: 1229 PPGWPSSGSIKFEDVVLRYRPELPPVLHGLSFEISPSEKVGIVGRTGAGKSSMLNALFRI 1288

Query: 1267 VEPAGGSILIDGVDICSMGLKDLRVKLSIIPQEPTLFRGSVRTNLDPLGLYSDDEIWKAL 1326
            VE   G ILIDG DI   GL DLR  L IIPQ P LF G+VR NLDP   ++D ++W++L
Sbjct: 1289 VELERGRILIDGCDISKFGLMDLRKVLGIIPQAPVLFSGTVRFNLDPFNEHNDADLWESL 1348

Query: 1327 EKCQLKTTISSLPNKLDSSVSDEGENWSAGQRQLFCLGRVLLKRNRILVLDEANASIDSA 1386
            E+  LK  I      LD+ VS+ GEN+S GQRQL  L R LL+R++ILVLDEA A++D  
Sbjct: 1349 ERAHLKDVIRRNSLGLDAEVSEAGENFSVGQRQLLSLARALLRRSKILVLDEATAAVDVR 1408

Query: 1387 TDAILQRIIRQEFSNCTVITVAHRVPTVIDSDMVMVLSYGKLLEYDEPSKL-METNSSFS 1445
            TDA++Q+ IR+EF +CT++ +AHR+ T+ID D ++VL  G+++E+D P  L     S+FS
Sbjct: 1409 TDALIQKTIREEFKSCTMLIIAHRLNTIIDCDRILVLDAGRVVEFDTPENLLSNEGSAFS 1468

Query: 1446 KLV-------AEYWSS 1454
            K+V       A+Y  S
Sbjct: 1469 KMVQSTGAANAQYLRS 1484


Length = 1622

>gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) Back     alignment and domain information
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein Back     alignment and domain information
>gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213269 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 of NFT1, subfamily C Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|213255 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 of the sulfonylurea receptor SUR Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|213258 cd03291, ABCC_CFTR1, ATP-binding cassette domain of the cystic fibrosis transmembrane regulator, subfamily C Back     alignment and domain information
>gnl|CDD|213256 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 of CFTR,subfamily C Back     alignment and domain information
>gnl|CDD|213257 cd03290, ABCC_SUR1_N, ATP-binding cassette domain of the sulfonylurea receptor, subfamily C Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins Back     alignment and domain information
>gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|182733 PRK10790, PRK10790, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|163508 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C Back     alignment and domain information
>gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins Back     alignment and domain information
>gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C Back     alignment and domain information
>gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C Back     alignment and domain information
>gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein Back     alignment and domain information
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C Back     alignment and domain information
>gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system Back     alignment and domain information
>gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters Back     alignment and domain information
>gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C Back     alignment and domain information
>gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C Back     alignment and domain information
>gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|163508 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters Back     alignment and domain information
>gnl|CDD|216049 pfam00664, ABC_membrane, ABC transporter transmembrane region Back     alignment and domain information
>gnl|CDD|216049 pfam00664, ABC_membrane, ABC transporter transmembrane region Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system Back     alignment and domain information
>gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C Back     alignment and domain information
>gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter Back     alignment and domain information
>gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter Back     alignment and domain information
>gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213269 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 of NFT1, subfamily C Back     alignment and domain information
>gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters Back     alignment and domain information
>gnl|CDD|234152 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter Back     alignment and domain information
>gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system Back     alignment and domain information
>gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents Back     alignment and domain information
>gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter Back     alignment and domain information
>gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system Back     alignment and domain information
>gnl|CDD|182733 PRK10790, PRK10790, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) Back     alignment and domain information
>gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter Back     alignment and domain information
>gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226646 COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|237456 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter Back     alignment and domain information
>gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|237649 PRK14254, PRK14254, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213255 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 of the sulfonylurea receptor SUR Back     alignment and domain information
>gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter Back     alignment and domain information
>gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system Back     alignment and domain information
>gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|188317 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|236523 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>gnl|CDD|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system Back     alignment and domain information
>gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter Back     alignment and domain information
>gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|224057 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system Back     alignment and domain information
>gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system Back     alignment and domain information
>gnl|CDD|172735 PRK14247, PRK14247, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|162242 TIGR01187, potA, spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter Back     alignment and domain information
>gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F Back     alignment and domain information
>gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|106587 PRK13644, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213256 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 of CFTR,subfamily C Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter Back     alignment and domain information
>gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184582 PRK14236, PRK14236, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily Back     alignment and domain information
>gnl|CDD|184202 PRK13642, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system Back     alignment and domain information
>gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213258 cd03291, ABCC_CFTR1, ATP-binding cassette domain of the cystic fibrosis transmembrane regulator, subfamily C Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|184590 PRK14249, PRK14249, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213182 cd03215, ABC_Carb_Monos_II, Second domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236554 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters Back     alignment and domain information
>gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|236554 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|185016 PRK15056, PRK15056, manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184596 PRK14267, PRK14267, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter Back     alignment and domain information
>gnl|CDD|172733 PRK14245, PRK14245, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>gnl|CDD|226963 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|172739 PRK14251, PRK14251, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182893 PRK11000, PRK11000, maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172732 PRK14244, PRK14244, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184588 PRK14243, PRK14243, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|172732 PRK14244, PRK14244, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE Back     alignment and domain information
>gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|172757 PRK14269, PRK14269, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>gnl|CDD|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system Back     alignment and domain information
>gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|184198 PRK13638, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236863 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172730 PRK14242, PRK14242, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237651 PRK14266, PRK14266, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184594 PRK14264, PRK14264, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226628 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226635 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|236947 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172741 PRK14253, PRK14253, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|226646 COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter Back     alignment and domain information
>gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter Back     alignment and domain information
>gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172761 PRK14273, PRK14273, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|172744 PRK14256, PRK14256, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226968 COG4615, PvdE, ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>gnl|CDD|130262 TIGR01194, cyc_pep_trnsptr, cyclic peptide transporter Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|172739 PRK14251, PRK14251, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184594 PRK14264, PRK14264, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|182692 PRK10744, pstB, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|172740 PRK14252, PRK14252, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172760 PRK14272, PRK14272, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|172745 PRK14257, PRK14257, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237454 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226961 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|172751 PRK14263, PRK14263, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter Back     alignment and domain information
>gnl|CDD|237646 PRK14237, PRK14237, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213190 cd03223, ABCD_peroxisomal_ALDP, ATP-binding cassette domain of peroxisomal transporter, subfamily D Back     alignment and domain information
>gnl|CDD|213190 cd03223, ABCD_peroxisomal_ALDP, ATP-binding cassette domain of peroxisomal transporter, subfamily D Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|172759 PRK14271, PRK14271, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183055 PRK11247, ssuB, aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213257 cd03290, ABCC_SUR1_N, ATP-binding cassette domain of the sulfonylurea receptor, subfamily C Back     alignment and domain information
>gnl|CDD|184596 PRK14267, PRK14267, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|172749 PRK14261, PRK14261, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182221 PRK10070, PRK10070, glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>gnl|CDD|106587 PRK13644, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184590 PRK14249, PRK14249, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>gnl|CDD|226637 COG4167, SapF, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|226963 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237453 PRK13633, PRK13633, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|162242 TIGR01187, potA, spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|184593 PRK14258, PRK14258, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182980 PRK11124, artP, arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|182182 PRK09984, PRK09984, phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>gnl|CDD|172748 PRK14260, PRK14260, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172735 PRK14247, PRK14247, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|237651 PRK14266, PRK14266, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172747 PRK14259, PRK14259, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|172749 PRK14261, PRK14261, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182221 PRK10070, PRK10070, glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213204 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-binding cassette domain 2 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|182993 PRK11144, modC, molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182716 PRK10771, thiQ, thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system Back     alignment and domain information
>gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system Back     alignment and domain information
>gnl|CDD|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184584 PRK14238, PRK14238, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237645 PRK14235, PRK14235, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182692 PRK10744, pstB, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|237649 PRK14254, PRK14254, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|172730 PRK14242, PRK14242, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237646 PRK14237, PRK14237, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein Back     alignment and domain information
>gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172741 PRK14253, PRK14253, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172760 PRK14272, PRK14272, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182716 PRK10771, thiQ, thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|237647 PRK14248, PRK14248, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182569 PRK10584, PRK10584, putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236863 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter Back     alignment and domain information
>gnl|CDD|183055 PRK11247, ssuB, aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237650 PRK14265, PRK14265, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|233206 TIGR00954, 3a01203, Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system Back     alignment and domain information
>gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>gnl|CDD|172740 PRK14252, PRK14252, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>gnl|CDD|237652 PRK14275, PRK14275, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226968 COG4615, PvdE, ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter Back     alignment and domain information
>gnl|CDD|172757 PRK14269, PRK14269, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>gnl|CDD|236689 PRK10419, nikE, nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213198 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biogenesis ATP-binding export protein Back     alignment and domain information
>gnl|CDD|213198 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biogenesis ATP-binding export protein Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|226628 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|184593 PRK14258, PRK14258, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237652 PRK14275, PRK14275, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|181939 PRK09544, znuC, high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|183231 PRK11614, livF, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172756 PRK14268, PRK14268, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237451 PRK13631, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein Back     alignment and domain information
>gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237451 PRK13631, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>gnl|CDD|172747 PRK14259, PRK14259, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237645 PRK14235, PRK14235, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>gnl|CDD|184202 PRK13642, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>gnl|CDD|172745 PRK14257, PRK14257, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|185067 PRK15112, PRK15112, antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>gnl|CDD|185037 PRK15079, PRK15079, oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>gnl|CDD|185037 PRK15079, PRK15079, oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter Back     alignment and domain information
>gnl|CDD|213182 cd03215, ABC_Carb_Monos_II, Second domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|184584 PRK14238, PRK14238, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237456 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>gnl|CDD|184587 PRK14241, PRK14241, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE Back     alignment and domain information
>gnl|CDD|172744 PRK14256, PRK14256, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|236997 PRK11831, PRK11831, putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>gnl|CDD|213189 cd03222, ABC_RNaseL_inhibitor, ATP-binding cassette domain of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA Back     alignment and domain information
>gnl|CDD|172761 PRK14273, PRK14273, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>gnl|CDD|237453 PRK13633, PRK13633, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|172756 PRK14268, PRK14268, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184125 PRK13538, PRK13538, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>gnl|CDD|237894 PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter Back     alignment and domain information
>gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD Back     alignment and domain information
>gnl|CDD|226620 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|182336 PRK10253, PRK10253, iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|188208 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|182829 PRK10908, PRK10908, cell division protein FtsE; Provisional Back     alignment and domain information
>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|226637 COG4167, SapF, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|226592 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|215558 PLN03073, PLN03073, ABC transporter F family; Provisional Back     alignment and domain information
>gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172733 PRK14245, PRK14245, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130262 TIGR01194, cyc_pep_trnsptr, cyclic peptide transporter Back     alignment and domain information
>gnl|CDD|237454 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>gnl|CDD|224057 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|172759 PRK14271, PRK14271, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>gnl|CDD|172748 PRK14260, PRK14260, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|185067 PRK15112, PRK15112, antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|226620 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|215558 PLN03073, PLN03073, ABC transporter F family; Provisional Back     alignment and domain information
>gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F Back     alignment and domain information
>gnl|CDD|184582 PRK14236, PRK14236, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|237647 PRK14248, PRK14248, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236707 PRK10522, PRK10522, multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>gnl|CDD|184204 PRK13645, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|213204 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-binding cassette domain 2 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|233665 TIGR01978, sufC, FeS assembly ATPase SufC Back     alignment and domain information
>gnl|CDD|226635 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236755 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182880 PRK10982, PRK10982, galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184125 PRK13538, PRK13538, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|234200 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|234152 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|184587 PRK14241, PRK14241, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>gnl|CDD|188208 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|226622 COG4138, BtuD, ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA Back     alignment and domain information
>gnl|CDD|234200 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>gnl|CDD|225265 COG2401, COG2401, ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|181939 PRK09544, znuC, high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family Back     alignment and domain information
>gnl|CDD|182906 PRK11022, dppD, dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|182829 PRK10908, PRK10908, cell division protein FtsE; Provisional Back     alignment and domain information
>gnl|CDD|236707 PRK10522, PRK10522, multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>gnl|CDD|235150 PRK03695, PRK03695, vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily Back     alignment and domain information
>gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184204 PRK13645, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184198 PRK13638, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226961 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213205 cd03238, ABC_UvrA, ATP-binding cassette domain of the excision repair protein UvrA Back     alignment and domain information
>gnl|CDD|172751 PRK14263, PRK14263, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213203 cd03236, ABC_RNaseL_inhibitor_domain1, The ATP-binding cassette domain 1 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|185049 PRK15093, PRK15093, antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236689 PRK10419, nikE, nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family Back     alignment and domain information
>gnl|CDD|236898 PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236729 PRK10636, PRK10636, putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236523 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>gnl|CDD|184588 PRK14243, PRK14243, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family Back     alignment and domain information
>gnl|CDD|226639 COG4170, SapD, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional Back     alignment and domain information
>gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226592 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226622 COG4138, BtuD, ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional Back     alignment and domain information
>gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>gnl|CDD|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins Back     alignment and domain information
>gnl|CDD|183231 PRK11614, livF, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236997 PRK11831, PRK11831, putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236688 PRK10418, nikD, nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>gnl|CDD|184132 PRK13547, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD Back     alignment and domain information
>gnl|CDD|233665 TIGR01978, sufC, FeS assembly ATPase SufC Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|183280 PRK11701, phnK, phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|227118 COG4778, PhnL, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|236898 PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236729 PRK10636, PRK10636, putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|227118 COG4778, PhnL, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|183080 PRK11300, livG, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237894 PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184127 PRK13540, PRK13540, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|184129 PRK13543, PRK13543, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|181888 PRK09473, oppD, oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>gnl|CDD|236992 PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|185016 PRK15056, PRK15056, manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237650 PRK14265, PRK14265, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182880 PRK10982, PRK10982, galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional Back     alignment and domain information
>gnl|CDD|184131 PRK13546, PRK13546, teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1467
KOG00541381 consensus Multidrug resistance-associated protein/ 100.0
PLN03130 1622 ABC transporter C family member; Provisional 100.0
PLN032321495 ABC transporter C family member; Provisional 100.0
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 100.0
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 100.0
PTZ002431560 ABC transporter; Provisional 100.0
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 100.0
PTZ002651466 multidrug resistance protein (mdr1); Provisional 100.0
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 100.0
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 100.0
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 100.0
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 100.0
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 100.0
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 100.0
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 100.0
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 100.0
PRK10790592 putative multidrug transporter membrane\ATP-bindin 100.0
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 100.0
KOG0055 1228 consensus Multidrug/pheromone exporter, ABC superf 100.0
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 100.0
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 100.0
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 100.0
COG4988559 CydD ABC-type transport system involved in cytochr 100.0
COG4987573 CydC ABC-type transport system involved in cytochr 100.0
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 100.0
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 100.0
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 100.0
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 100.0
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 100.0
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 100.0
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 100.0
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 100.0
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 100.0
PRK10789569 putative multidrug transporter membrane\ATP-bindin 100.0
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 100.0
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 100.0
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 100.0
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 100.0
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 100.0
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 100.0
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 100.0
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 100.0
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 100.0
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 100.0
COG1123539 ATPase components of various ABC-type transport sy 100.0
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 100.0
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 100.0
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 100.0
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 100.0
PRK10790592 putative multidrug transporter membrane\ATP-bindin 100.0
PRK10261623 glutathione transporter ATP-binding protein; Provi 100.0
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 100.0
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 100.0
COG4988559 CydD ABC-type transport system involved in cytochr 100.0
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 100.0
PRK10789569 putative multidrug transporter membrane\ATP-bindin 100.0
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 100.0
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 100.0
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 100.0
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 100.0
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 100.0
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 100.0
PRK09700510 D-allose transporter ATP-binding protein; Provisio 100.0
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 100.0
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 100.0
PRK15064530 ABC transporter ATP-binding protein; Provisional 100.0
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 100.0
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 100.0
PRK10762501 D-ribose transporter ATP binding protein; Provisio 100.0
PRK11288501 araG L-arabinose transporter ATP-binding protein; 100.0
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 100.0
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 100.0
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 100.0
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 100.0
PRK10938490 putative molybdenum transport ATP-binding protein 100.0
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 100.0
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 100.0
COG4987573 CydC ABC-type transport system involved in cytochr 100.0
PLN03232 1495 ABC transporter C family member; Provisional 100.0
PRK10522547 multidrug transporter membrane component/ATP-bindi 100.0
PRK11819556 putative ABC transporter ATP-binding protein; Revi 100.0
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 100.0
COG4172534 ABC-type uncharacterized transport system, duplica 100.0
PLN031301622 ABC transporter C family member; Provisional 100.0
PRK10636638 putative ABC transporter ATP-binding protein; Prov 100.0
PTZ002431560 ABC transporter; Provisional 100.0
COG4618580 ArpD ABC-type protease/lipase transport system, AT 100.0
PRK11147635 ABC transporter ATPase component; Reviewed 100.0
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 100.0
COG4618580 ArpD ABC-type protease/lipase transport system, AT 100.0
PLN03140 1470 ABC transporter G family member; Provisional 100.0
PLN03073718 ABC transporter F family; Provisional 100.0
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 100.0
COG0488530 Uup ATPase components of ABC transporters with dup 100.0
PRK10522547 multidrug transporter membrane component/ATP-bindi 100.0
PRK13409590 putative ATPase RIL; Provisional 100.0
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 100.0
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 100.0
KOG0054 1381 consensus Multidrug resistance-associated protein/ 100.0
COG1129500 MglA ABC-type sugar transport system, ATPase compo 100.0
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 100.0
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 100.0
COG3845501 ABC-type uncharacterized transport systems, ATPase 100.0
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 100.0
KOG0927614 consensus Predicted transporter (ABC superfamily) 100.0
COG1126240 GlnQ ABC-type polar amino acid transport system, A 100.0
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 100.0
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 100.0
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 100.0
COG1126240 GlnQ ABC-type polar amino acid transport system, A 100.0
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 100.0
COG1117253 PstB ABC-type phosphate transport system, ATPase c 100.0
KOG0062582 consensus ATPase component of ABC transporters wit 100.0
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 100.0
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 100.0
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 100.0
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 100.0
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 100.0
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 100.0
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 100.0
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 100.0
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 100.0
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 100.0
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 100.0
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 100.0
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 100.0
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 100.0
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 100.0
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 100.0
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 100.0
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 100.0
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 100.0
COG1127263 Ttg2A ABC-type transport system involved in resist 100.0
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 100.0
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 100.0
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 100.0
COG2884223 FtsE Predicted ATPase involved in cell division [C 100.0
COG3638258 ABC-type phosphate/phosphonate transport system, A 100.0
COG1136226 SalX ABC-type antimicrobial peptide transport syst 100.0
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 100.0
PRK11153343 metN DL-methionine transporter ATP-binding subunit 100.0
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 100.0
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 100.0
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 100.0
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 100.0
COG1127263 Ttg2A ABC-type transport system involved in resist 100.0
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 100.0
COG1117253 PstB ABC-type phosphate transport system, ATPase c 100.0
PRK11650 356 ugpC glycerol-3-phosphate transporter ATP-binding 100.0
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 100.0
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14242253 phosphate transporter ATP-binding protein; Provisi 100.0
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 100.0
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 100.0
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 100.0
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 100.0
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 100.0
COG4178604 ABC-type uncharacterized transport system, permeas 100.0
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 100.0
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 100.0
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 100.0
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 100.0
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 100.0
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 100.0
PRK14235267 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 100.0
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 100.0
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 100.0
TIGR01186 363 proV glycine betaine/L-proline transport ATP bindi 100.0
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 100.0
COG4615546 PvdE ABC-type siderophore export system, fused ATP 100.0
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG1136226 SalX ABC-type antimicrobial peptide transport syst 100.0
COG3842352 PotA ABC-type spermidine/putrescine transport syst 100.0
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 100.0
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 100.0
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 100.0
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 100.0
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 100.0
PRK14237267 phosphate transporter ATP-binding protein; Provisi 100.0
PRK10619257 histidine/lysine/arginine/ornithine transporter su 100.0
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 100.0
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 100.0
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 100.0
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 100.0
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 100.0
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 100.0
PRK14239252 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 100.0
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 100.0
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 100.0
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 100.0
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 100.0
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 100.0
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 100.0
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 100.0
PRK14240250 phosphate transporter ATP-binding protein; Provisi 100.0
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 100.0
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK09536 402 btuD corrinoid ABC transporter ATPase; Reviewed 100.0
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 100.0
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 100.0
COG4615546 PvdE ABC-type siderophore export system, fused ATP 100.0
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 100.0
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 100.0
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 100.0
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 100.0
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 100.0
PRK13537306 nodulation ABC transporter NodI; Provisional 100.0
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14236272 phosphate transporter ATP-binding protein; Provisi 100.0
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 100.0
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, 100.0
PRK14238271 phosphate transporter ATP-binding protein; Provisi 100.0
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 100.0
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 100.0
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 100.0
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 100.0
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 100.0
cd03246173 ABCC_Protease_Secretion This family represents the 100.0
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 100.0
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 100.0
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 100.0
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 100.0
PRK11000 369 maltose/maltodextrin transporter ATP-binding prote 100.0
PRK09452 375 potA putrescine/spermidine ABC transporter ATPase 100.0
COG3842352 PotA ABC-type spermidine/putrescine transport syst 100.0
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 100.0
COG3638258 ABC-type phosphate/phosphonate transport system, A 100.0
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 100.0
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 100.0
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 100.0
PRK14243264 phosphate transporter ATP-binding protein; Provisi 100.0
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 100.0
PRK10253265 iron-enterobactin transporter ATP-binding protein; 100.0
PRK09473330 oppD oligopeptide transporter ATP-binding componen 100.0
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 100.0
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 100.0
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 100.0
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10070 400 glycine betaine transporter ATP-binding subunit; P 100.0
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 100.0
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 100.0
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 100.0
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 100.0
COG2884223 FtsE Predicted ATPase involved in cell division [C 100.0
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 100.0
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 100.0
cd03299235 ABC_ModC_like Archeal protein closely related to M 100.0
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 100.0
PRK14241258 phosphate transporter ATP-binding protein; Provisi 100.0
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 100.0
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 100.0
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 100.0
PRK10908222 cell division protein FtsE; Provisional 100.0
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 100.0
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 100.0
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 100.0
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 100.0
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 100.0
PRK11607 377 potG putrescine transporter ATP-binding subunit; P 100.0
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 100.0
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 100.0
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 100.0
PRK13536340 nodulation factor exporter subunit NodI; Provision 100.0
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 100.0
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 100.0
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 100.0
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 100.0
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 100.0
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 100.0
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 100.0
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 100.0
cd03269210 ABC_putative_ATPase This subfamily is involved in 100.0
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 100.0
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 100.0
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 100.0
PRK09984262 phosphonate/organophosphate ester transporter subu 100.0
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 100.0
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 100.0
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 100.0
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 100.0
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 100.0
PRK11144 352 modC molybdate transporter ATP-binding protein; Pr 100.0
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 100.0
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 100.0
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 100.0
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 100.0
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 100.0
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 100.0
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 100.0
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 100.0
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 100.0
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 100.0
COG0410237 LivF ABC-type branched-chain amino acid transport 100.0
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 100.0
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 100.0
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 100.0
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 100.0
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 100.0
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 100.0
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 100.0
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 100.0
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 100.0
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 100.0
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 100.0
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 100.0
PRK11153343 metN DL-methionine transporter ATP-binding subunit 100.0
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 100.0
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 100.0
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 100.0
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 100.0
COG4178604 ABC-type uncharacterized transport system, permeas 100.0
PRK13537306 nodulation ABC transporter NodI; Provisional 100.0
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 100.0
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 100.0
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 100.0
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 100.0
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 100.0
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 100.0
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 100.0
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 100.0
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 100.0
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 100.0
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR02142 354 modC_ABC molybdenum ABC transporter, ATP-binding p 100.0
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 100.0
PRK14242253 phosphate transporter ATP-binding protein; Provisi 100.0
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 100.0
PRK11607377 potG putrescine transporter ATP-binding subunit; P 100.0
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 100.0
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 100.0
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 100.0
cd03215182 ABC_Carb_Monos_II This family represents domain II 100.0
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 100.0
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 100.0
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 100.0
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 100.0
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 100.0
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 100.0
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 100.0
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 100.0
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 100.0
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 100.0
cd03234226 ABCG_White The White subfamily represents ABC tran 100.0
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 100.0
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 100.0
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 100.0
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 100.0
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 100.0
PRK13536340 nodulation factor exporter subunit NodI; Provision 100.0
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 100.0
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 100.0
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 100.0
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 100.0
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 100.0
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 100.0
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 100.0
cd03269210 ABC_putative_ATPase This subfamily is involved in 100.0
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 100.0
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 100.0
PRK10619257 histidine/lysine/arginine/ornithine transporter su 100.0
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 100.0
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 100.0
COG4619223 ABC-type uncharacterized transport system, ATPase 100.0
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 100.0
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 100.0
COG1123 539 ATPase components of various ABC-type transport sy 100.0
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 100.0
PRK00635 1809 excinuclease ABC subunit A; Provisional 100.0
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 100.0
PRK14235267 phosphate transporter ATP-binding protein; Provisi 100.0
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 100.0
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 100.0
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10070400 glycine betaine transporter ATP-binding subunit; P 100.0
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 100.0
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 100.0
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 100.0
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 100.0
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK03695248 vitamin B12-transporter ATPase; Provisional 100.0
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 100.0
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 100.0
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 100.0
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 100.0
PRK09580248 sufC cysteine desulfurase ATPase component; Review 100.0
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 100.0
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 100.0
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 100.0
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 100.0
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 100.0
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 100.0
PRK14237267 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 100.0
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 100.0
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 100.0
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 100.0
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 100.0
PRK10253265 iron-enterobactin transporter ATP-binding protein; 100.0
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 100.0
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 100.0
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 100.0
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 100.0
PRK14240250 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14239252 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03216163 ABC_Carb_Monos_I This family represents the domain 100.0
PRK09984262 phosphonate/organophosphate ester transporter subu 100.0
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 100.0
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 100.0
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 100.0
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 100.0
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 100.0
COG4175386 ProV ABC-type proline/glycine betaine transport sy 100.0
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 100.0
PRK10908222 cell division protein FtsE; Provisional 100.0
PRK14238271 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14243264 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 100.0
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 100.0
COG0410237 LivF ABC-type branched-chain amino acid transport 100.0
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 100.0
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 100.0
PRK14236272 phosphate transporter ATP-binding protein; Provisi 100.0
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 100.0
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
Probab=100.00  E-value=1.9e-267  Score=2540.36  Aligned_cols=1248  Identities=46%  Similarity=0.756  Sum_probs=1156.7

Q ss_pred             CCCCccCCh--hHHHHHHhHHHHHHhhccCCCCCCCCCCCCccCcHHHHHHHHHHHHHHHHHhhcCCCCCchHHHHHHHH
Q 000481          197 QTELGKAGL--LRKLTFSWINPLLSLGYSKPLALEDIPSLVPEDEASFAYQKFAYAWDSLVRENNSNNNGNLVRKVITNV  274 (1467)
Q Consensus       197 ~~p~~~a~~--~s~~~f~W~~~l~~~g~~~~L~~~Dl~~l~~~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~l~~~l~~~  274 (1467)
                      ++|.+.++.  +|++||||++|++++|||++|+.+|+|+++++|+++.+.++|++.|+++.++.   ++.|+++++++++
T Consensus       122 ~~~~~~~~~~~~S~~~f~W~~~l~~~g~k~~L~~~Dl~~l~~~d~s~~l~~~~~~~w~~~~~~~---~~~psl~~al~~~  198 (1381)
T KOG0054|consen  122 PNPLPEASAGFLSRLTFSWMTPLLRKGYKKPLELKDLWSLSPEDSSETLVKRLESLWEKELGRS---GKKPSLLRALLRT  198 (1381)
T ss_pred             CCcccccchhHHHHHHHHHHHHHHHhhccCCCChhhcccCChhhhhhHHHHHHHHHHHHHhccc---cCCcHHHHHHHHH
Confidence            344445555  99999999999999999999999999999999999999999999999886432   2568899999999


Q ss_pred             HhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000481          275 YLKENIFIAICALLRTIAVVVGPLLLYAFVNYSNRGEENLQEGLSIVGCLIITKVVESFTQRHCFFGSRRSGMRMRSALM  354 (1467)
Q Consensus       275 ~~~~~~~~~~~~l~~~~~~~~~P~ll~~~i~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~ir~~L~  354 (1467)
                      |++.+++.+++.++.+...+++|.+++.+++|.++++.+.+.|+.++++++++.++++++.++|++..+++|+|+|+++.
T Consensus       199 f~~~~~~~~~~~~~~~~~~~~~P~lL~~li~~~~~~~~~~~~g~~~a~~lf~~~~l~~l~~~~~~~~~~~~g~r~R~al~  278 (1381)
T KOG0054|consen  199 FGRTFLLSGIFLFLRDLAGFVGPLLLKKLILFFSEKRLPLNNGYLLAVLLFLASLLQSLLLHQYFFVSFRVGMRLRSALI  278 (1381)
T ss_pred             HHHHHHHHHHHHHHHHHHccccHHHHHHHHHHhcCCCcccchhHHHHHHHHHHHHHHHHHHhHHHHHHHhhhhhHHHHHH
Confidence            99999999999999999999999999999999987766778899999999999999999999999999999999999999


Q ss_pred             HHHHHHHHcCCccccCCCCHHHHHHHHHhHHHHHhcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000481          355 VAVYQKQLKLSSLGRKKHSTGEIVNYIAVDAYRMGEFPFWFHLTWSLALQLFLAIGVLFGVVGLGALPGLVLFLICGLLN  434 (1467)
Q Consensus       355 ~~i~~k~l~l~~~~~~~~~~G~ivnl~s~Dv~~i~~~~~~~~~~~~~~l~i~~~~~~L~~~lg~~~l~gl~~~~~~~~~~  434 (1467)
                      ++||+|+|+++..+++++++|+|+|+|++|++++.+++.++|.+|++|+|+++++++||..+|+++++|++++++++|+|
T Consensus       279 ~~IY~K~L~ls~~~~~~~t~G~ivNlms~D~~ri~~~~~~~h~~w~~Plqi~~~l~lLy~~LG~sa~~G~~~~il~~p~n  358 (1381)
T KOG0054|consen  279 SAIYRKALRLSNSARGETTVGEIVNLMSVDAQRLSDAACFLHLLWSAPLQIILALYLLYGLLGPSALAGVAVMVLLIPLN  358 (1381)
T ss_pred             HHHHHhhhcCchhhccCCCcchhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhChHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHhccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000481          435 VPFAKILQKCQSEFMIAQDERLRSTSEILNNMKIIKLQSWEEKFKSLIESRREKEFKWLSEAQLRKAYGTVIYWMSPTII  514 (1467)
Q Consensus       435 ~~~~~~~~~~~~~~~~~~d~r~~~~~E~L~gIr~IK~~~~E~~f~~~i~~~R~~E~~~l~~~~~~~~~~~~~~~~~~~~~  514 (1467)
                      .+++++++++|++.|+.+|+|++.|+|+|+|||+||+|+||+.|.++|++.|++|++++|+..+..++..++++++|+++
T Consensus       359 ~~~a~~~~~~q~~~m~~~D~Rik~~nEiL~~IkviK~yaWE~~F~~~I~~~R~~El~~lrk~~~~~~~~~~~~~~~p~lv  438 (1381)
T KOG0054|consen  359 SFLAKKIAKFQKRLMKRKDERIKLMNEILNGIKVIKLYAWEKPFLKKIEDLRQKELKLLRKSAYLSALNSFLNFFSPVLV  438 (1381)
T ss_pred             HHHHHHHHHHHHHHhhhhhHHHHHHHHHHhhhHhhhhHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhCCCCCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCcccccccccCCCCc
Q 000481          515 SSVIFLGCALTGSAPLNASTIFTVLATLRSMGEPVRMIPEALSIMIQVKVSFDRINAFLLDHELNNDDVRRISLQKSDRS  594 (1467)
Q Consensus       515 ~~~~f~~~~l~~~~~Lt~~~~ft~l~l~~~l~~pl~~l~~~i~~~~~a~vs~~Ri~~fL~~~e~~~~~~~~~~~~~~~~~  594 (1467)
                      ++++|++|++..++.+|++++|+++++|++|+.|+.++|+.++.+.|+.||++|+++||..+|.+++...+.+..+.+.+
T Consensus       439 ~~~tF~~~v~~~~~~lt~~~aF~slalfniLr~pl~~~P~~i~~~vqa~VS~~Ri~~fl~~~e~~~~~~~~~~~~~~~~~  518 (1381)
T KOG0054|consen  439 SVVTFVVFVLLLGNLLTASTAFTSLALFNILRFPLFMLPSVISQLVQAKVSLKRLKEFLLSEELDPDSVERSPDEAGENA  518 (1381)
T ss_pred             HHHHHHHHhhccCccccHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCcccCccccccCCCCCCCce
Confidence            99999999964458899999999999999999999999999999999999999999999999987665443334445668


Q ss_pred             EEEEeEEEEeCCCCCCCcccceeEEecCCcEEEEeCCCCCChHHHHHHHhCCCCCCCcEEEEcCeEEEEccCCcCCCCCH
Q 000481          595 VKIQEGNFSWDPELAIPTLRGVNLDIKWAQKIAVCGSVGAGKSSLLYAILGEIPKISGTVNLYGSIAYVSQTSWIQSGSI  674 (1467)
Q Consensus       595 I~~~~~sf~~~~~~~~~~L~~i~l~i~~G~~~~ivG~~GsGKSTLl~~l~g~~~~~~G~i~~~g~i~yv~Q~~~l~~~ti  674 (1467)
                      |+++|++|+|+++++.++|+||||+|++|+++||||++||||||||++|+||+++.+|+|.++|.+|||||+|||||+||
T Consensus       519 i~i~~~sfsW~~~~~~~tL~dIn~~i~~G~lvaVvG~vGsGKSSLL~AiLGEm~~~sG~v~v~gsiaYv~Q~pWI~ngTv  598 (1381)
T KOG0054|consen  519 IEIKNGSFSWDSESPEPTLKDINFEIKKGQLVAVVGPVGSGKSSLLSAILGEMPKLSGSVAVNGSVAYVPQQPWIQNGTV  598 (1381)
T ss_pred             EEEeeeeEecCCCCCcccccceeEEecCCCEEEEECCCCCCHHHHHHHHhcCcccccceEEEcCeEEEeccccHhhCCcH
Confidence            99999999999865667999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhcCCCCCHHHHHHHHHHhcchHHHhcCCCCCCccccCCCCccChHHHHHHHHHHHHhcCCCEEEEeCCCCccCHHH
Q 000481          675 RDNILYGKPMDKARYDKAIKACALDKDINNFDHGDLTEIGQRGLNLSGGQKQRIQLARAVYNDADIYLFDDPFSAVDAHT  754 (1467)
Q Consensus       675 ~eNi~~g~~~~~~~~~~~~~~~~l~~~~~~l~~g~~t~ig~~g~~LSGGQkqRv~lARal~~~~~illLDep~salD~~~  754 (1467)
                      ||||+||.|+|+++|++++++|+|++|++.||.||+|+|||||.||||||||||+||||+|+|+||||||||+||||+|+
T Consensus       599 reNILFG~~~d~~rY~~Vi~aC~L~~Dle~Lp~GD~TeIGErGinLSGGQKqRIsLARAVY~~adIYLLDDplSAVDahv  678 (1381)
T KOG0054|consen  599 RENILFGSPYDEERYDKVIKACALKKDLEILPFGDLTEIGERGINLSGGQKQRISLARAVYQDADIYLLDDPLSAVDAHV  678 (1381)
T ss_pred             HHhhhcCccccHHHHHHHHHHccCHhHHhhcCCCCcceecCCccCCcHhHHHHHHHHHHHhccCCEEEEcCcchhhhHhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhcCCcEEEEEccCcchhhcCCEEEEEeCCeEeEecChHHHHhcCchHHHHHHHhhhhccCCCCCCCCCC
Q 000481          755 AATLFNECVMAALEKKTVILVTHQVEFLSEVDRILVLEGGQITQSGNYQELLLAGTAFEQLVNAHRDAITGLGPLDNAGQ  834 (1467)
Q Consensus       755 ~~~i~~~~~~~~~~~~tvilvtH~~~~l~~~d~i~~l~~G~i~~~G~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  834 (1467)
                      ++|||++|+++.+++||+|+|||+++++++||+|++|+||+|.+.|+|+|+++.+..+.++..+...........+ .  
T Consensus       679 g~~if~~ci~~~L~~KT~ILVTHql~~L~~ad~Iivl~~G~I~~~Gty~el~~~~~~~~~l~~~~~~~~~~~~~~~-~--  755 (1381)
T KOG0054|consen  679 GKHIFEECIRGLLRGKTVILVTHQLQFLPHADQIIVLKDGKIVESGTYEELLKSGGDFAELAHEEESEQEEEASEK-D--  755 (1381)
T ss_pred             hHHHHHHHHHhhhcCCEEEEEeCchhhhhhCCEEEEecCCeEecccCHHHHHhcchhHHHHhhccchhhccccccc-c--
Confidence            9999999999999999999999999999999999999999999999999999999888887432221111100000 0  


Q ss_pred             CCcccccccCCCCCCCCCCCCCCCCCCcc-cccccccCCcchHHHhhcCcccHHHHHHHHHhhchhHHHHHHHHHHHHHH
Q 000481          835 GGAEKVEKGRTARPEEPNGIYPRKESSEG-EISVKGLTQLTEDEEMEIGDVGWKPFMDYLNVSKGMSLLCLGVLAQSGFV  913 (1467)
Q Consensus       835 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~e~~~~g~v~~~~y~~y~~~~~g~~~~~~~~~~~~~~~  913 (1467)
                        .+..+..   ...+.......+...+. ....+...++.++|+++.|.|+|++|+.|+++.+|+..+.+.+++.++.+
T Consensus       756 --~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ee~~~G~v~~~vY~~Y~~a~~g~~~~~~~~~~~v~~~  830 (1381)
T KOG0054|consen  756 --LESGESS---RESESRSLESLSSEEEKSKDEKEEEDKLVQEEERETGKVSWSVYKKYIKAAGGFLLVLLILLLFVLTQ  830 (1381)
T ss_pred             --ccccccc---cchhhhhhhhhcccccccccccchhhHHHHHHHHhcCEeeHHHHHHHHHhcccHHHHHHHHHHHHHHH
Confidence              0000000   00000000000000000 00111124566788889999999999999999788888887888888999


Q ss_pred             HhhhhhhHHHHhhcccCc------cchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccccccc
Q 000481          914 GLQAAATYWLAYAIQIPK------ITSGILIGVYAGVSTASAVFVYFRSFFAAHLGLKASKAFFSGFTNSIFKAPMLFFD  987 (1467)
Q Consensus       914 ~~~~~~~~wl~~~~~~~~------~~~~~~~~~y~~l~~~~~~~~~~~~~~~~~~~~~~s~~l~~~l~~~il~~p~~ffd  987 (1467)
                      ++..+++||+++|++...      .+..+|+++|++++++.+++.+++++.+...+.++|+++|++|+++++|+||+|||
T Consensus       831 ~~~~~~~~WLs~W~~~~~~~~~~~~~~~~~~~vY~~l~~~~~~~~~~rs~~~~~~~l~aS~~Lh~~ml~~Ilrapm~FFd  910 (1381)
T KOG0054|consen  831 VLQIASNYWLSYWTDDGEDNGTTTVSTSFYLGVYALLGVASSLLTLLRSFLFAKGGLKASRKLHDKLLNSILRAPMSFFD  910 (1381)
T ss_pred             HHHHHHHHHHHHhcCCcccccccCCCcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCcchhcC
Confidence            999999999999997642      35678999999999999999999999999999999999999999999999999999


Q ss_pred             cccchhHHHHHhhhhhHhhhhhhHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Q 000481          988 STPVGRILTRLSSDLSILDFDIPFSIVFVAASGTELLAIIGIMTFVTWQVLVVAIFAMVAVRFVQRYYIATARELIRING 1067 (1467)
Q Consensus       988 ~~~~G~ilnR~s~D~~~id~~l~~~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~y~~~~r~l~rl~~ 1067 (1467)
                      +||+|||+||||+|++.+|..+|..+..++.+++.++++++++++++|+++++++|+.++++++++||++++||++|+++
T Consensus       911 tTP~GRILNRFSkD~~~vD~~Lp~~~~~~~~~~~~~l~~~~vi~~~~P~fli~~~pl~v~~~~~~~~Y~~tsReLkRLes  990 (1381)
T KOG0054|consen  911 TTPTGRILNRFSKDIDTVDVLLPFTLEFFLQSLLNVLGILVVISYVTPWFLIAIIPLGVIYYFVQRYYLATSRELKRLES  990 (1381)
T ss_pred             CCCccchhhhcccchHHHHHhhHHHHHHHHHHHHHHHHHHHHhhHHhHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccchhHhHHHHHhchhHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccCc
Q 000481         1068 TTKAPVMNYTAETSQGVVTIRAFNMVDRFFQNYLKLVDIDASLFFHTNGVMEWLILRVEALQNLTLFTAALFLVLIPRGY 1147 (1467)
Q Consensus      1068 ~~~sp~~~~~~Etl~G~~tIraf~~~~~f~~~~~~~~d~~~~~~~~~~~~~~wl~~rl~~~~~~~~~~~~~~~~~~~~~~ 1147 (1467)
                      .+|||+++||+||++|+.|||||+++++|.+++.+++|.+++++|...+++||+++|+|++++++++++++++++...+.
T Consensus       991 itRSPi~sh~~Etl~GlsTIRAf~~~~rf~~~~~~~~D~~~~~~f~~~~a~RWla~Rle~ig~~~v~~~al~~vl~~~~~ 1070 (1381)
T KOG0054|consen  991 ITRSPIYSHFSETLQGLSTIRAFGKEERFIQENDELIDENSRAFFLSISANRWLAVRLELLGNLVVLIAALFAVLLPSGL 1070 (1381)
T ss_pred             cccchHHHhHHHHhcCcceeeeccccHHHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999888776655


Q ss_pred             ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHhhcCCCCCCCCcCCCCCCCCCCCcceEEEEEEEEEeCC
Q 000481         1148 VAPGLVGLSLSYAFTLTGTQVFLSRWYCYLANYIISVERIKQFMHIPPEPPAIVEDKRPPSSWPFKGRIELRQLKIRYRP 1227 (1467)
Q Consensus      1148 ~~~g~~g~~l~~~~~l~~~~~~~~~~~~~le~~~~sveRi~~~~~~~~e~~~~~~~~~~~~~wp~~g~I~f~nvs~~Y~~ 1227 (1467)
                      .+||.+|++++|++++++.++|++|+.+++|++|+||||+.||.++|+|+|+..+..+||++||++|+|+|+|+++||+|
T Consensus      1071 ~~~g~vGLslsyal~lt~~l~~~vR~~~elEn~m~SVERv~eY~~~~~E~p~~~~~~~pp~~WP~~G~I~f~~~~~RYrp 1150 (1381)
T KOG0054|consen 1071 ISPGLVGLSLSYALQLTGLLQWLVRQSSELENNMVSVERVLEYTDIPSEAPLEIEESRPPPSWPSKGEIEFEDLSLRYRP 1150 (1381)
T ss_pred             CCcchHHHHHHHHHHHHHHHHHHHHHHHHHHhcchhhhHHHHHhcCCCCCCCCCcCCCCCCCCCCCCeEEEEEeEEEeCC
Confidence            78999999999999999999999999999999999999999999999997777766669999999999999999999999


Q ss_pred             CCCcceeceeEEeeCCcEEEEEcCCCCcHHHHHHHHhcccCCCcceEEECCeeCCCCCHHHHhhccEEeccCCcccccch
Q 000481         1228 NAPLVLKGITCTFSEGTRVGVVGRTGSGKTTLISALFRLVEPAGGSILIDGVDICSMGLKDLRVKLSIIPQEPTLFRGSV 1307 (1467)
Q Consensus      1228 ~~~~vLk~is~~I~~GekVgIVGrTGsGKSTL~~~L~rl~~~~~G~I~IDG~dI~~i~l~~LR~~i~iIpQdp~LF~gTI 1307 (1467)
                      +.|+|||||||+|+||||||||||||||||||+++|||+.||.+|+|.|||+||+++++|+||++++||||||+||+||+
T Consensus      1151 ~lp~VLk~is~~I~p~eKVGIVGRTGaGKSSL~~aLFRl~e~~~G~I~IDgvdI~~igL~dLRsrlsIIPQdPvLFsGTv 1230 (1381)
T KOG0054|consen 1151 NLPLVLKGISFTIKPGEKVGIVGRTGAGKSSLILALFRLVEPAEGEILIDGVDISKIGLHDLRSRLSIIPQDPVLFSGTV 1230 (1381)
T ss_pred             CCcchhcCceEEEcCCceEEEeCCCCCCHHHHHHHHHHhcCccCCeEEEcCeecccccHHHHHhcCeeeCCCCceecCcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhcCCCCCCCHHHHHHHHHHcCCchHHhhCCCCcccccccCCCCCChhHHHHHHHHHHhccCCCEEEEeCCCCCCCHHH
Q 000481         1308 RTNLDPLGLYSDDEIWKALEKCQLKTTISSLPNKLDSSVSDEGENWSAGQRQLFCLGRVLLKRNRILVLDEANASIDSAT 1387 (1467)
Q Consensus      1308 R~NLdp~~~~sd~ei~~aL~~~~l~~~i~~lp~gLdt~v~e~G~nLS~GQrQrl~LARAlLr~~~ILiLDEaTs~lD~~T 1387 (1467)
                      |+||||+++|+|+|||+|||+|+|+++|+++|+|||++|.|+|+|||.||||++||||||||++||||||||||++|++|
T Consensus      1231 R~NLDPf~e~sD~~IW~ALe~~~Lk~~v~~~p~~Ld~~v~egG~N~SvGQRQLlCLARALLr~skILvLDEATAsVD~~T 1310 (1381)
T KOG0054|consen 1231 RFNLDPFDEYSDDEIWEALERCQLKDVVSSLPGGLDSEVSEGGENFSVGQRQLLCLARALLRKSKILVLDEATASVDPET 1310 (1381)
T ss_pred             ccccCcccccCHHHHHHHHHHhChHHHHhhCCcCCCceecCCCccCChHHHHHHHHHHHHhccCCEEEEecccccCChHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHcCCcEEEEEccCchhhcccCEEEEEeCCEEEEecChhHHhc-cCChhHHHHHHHHHhc
Q 000481         1388 DAILQRIIRQEFSNCTVITVAHRVPTVIDSDMVMVLSYGKLLEYDEPSKLME-TNSSFSKLVAEYWSSC 1455 (1467)
Q Consensus      1388 e~~Iq~~i~~~~~~~TvI~IAHRl~ti~~~DrIlVl~~G~ivE~g~p~~Ll~-~~~~f~~lv~~~~~~~ 1455 (1467)
                      |..||++||++|+|||||+||||++||+|||||+|||+|+|+|+|+|++|++ ++|.|++++.++...+
T Consensus      1311 D~lIQ~tIR~~F~dcTVltIAHRl~TVmd~DrVlVld~G~v~EfdsP~~Ll~~~~S~f~~~l~~~~~~~ 1379 (1381)
T KOG0054|consen 1311 DALIQKTIREEFKDCTVLTIAHRLNTVMDSDRVLVLDAGRVVEFDSPAELLSDKDSLFSSLLKEAALSS 1379 (1381)
T ss_pred             HHHHHHHHHHHhcCCeEEEEeeccchhhhcCeEEEeeCCeEeecCChHHHHhCCcchHHHHHHHHHHhh
Confidence            9999999999999999999999999999999999999999999999999998 7899999998887654



>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1467
4f4c_A1321 The Crystal Structure Of The Multi-Drug Transporter 2e-58
4f4c_A 1321 The Crystal Structure Of The Multi-Drug Transporter 3e-25
2cbz_A237 Structure Of The Human Multidrug Resistance Protein 4e-57
2cbz_A237 Structure Of The Human Multidrug Resistance Protein 2e-09
1q3h_A286 Mouse Cftr Nbd1 With Amp.Pnp Length = 286 1e-45
1q3h_A286 Mouse Cftr Nbd1 With Amp.Pnp Length = 286 3e-04
1r0z_A286 Phosphorylated Cystic Fibrosis Transmembrane Conduc 2e-45
1r0z_A286 Phosphorylated Cystic Fibrosis Transmembrane Conduc 2e-04
1xmi_A291 Crystal Structure Of Human F508a Nbd1 Domain With A 2e-45
1xmi_A291 Crystal Structure Of Human F508a Nbd1 Domain With A 5e-05
1xfa_A283 Structure Of Nbd1 From Murine Cftr- F508r Mutant Le 2e-45
1xfa_A283 Structure Of Nbd1 From Murine Cftr- F508r Mutant Le 5e-04
1xf9_A283 Structure Of Nbd1 From Murine Cftr- F508s Mutant Le 3e-45
1xf9_A283 Structure Of Nbd1 From Murine Cftr- F508s Mutant Le 5e-04
2pzg_A241 Minimal Human Cftr First Nucleotide Binding Domain 8e-45
2pzg_A241 Minimal Human Cftr First Nucleotide Binding Domain 2e-04
2pze_A229 Minimal Human Cftr First Nucleotide Binding Domain 9e-45
2pze_A229 Minimal Human Cftr First Nucleotide Binding Domain 2e-04
2bbs_A290 Human Deltaf508 Nbd1 With Three Solubilizing Mutati 2e-44
2bbs_A290 Human Deltaf508 Nbd1 With Three Solubilizing Mutati 1e-05
2bbt_A290 Human Deltaf508 Nbd1 With Two Solublizing Mutations 3e-44
2bbt_A290 Human Deltaf508 Nbd1 With Two Solublizing Mutations 1e-05
3si7_A285 The Crystal Structure Of The Nbd1 Domain Of The Mou 5e-44
3si7_A285 The Crystal Structure Of The Nbd1 Domain Of The Mou 2e-04
2bbo_A291 Human Nbd1 With Phe508 Length = 291 2e-43
2bbo_A291 Human Nbd1 With Phe508 Length = 291 4e-04
2pzf_A228 Minimal Human Cftr First Nucleotide Binding Domain 5e-43
2pzf_A228 Minimal Human Cftr First Nucleotide Binding Domain 1e-04
1xmj_A290 Crystal Structure Of Human Deltaf508 Human Nbd1 Dom 1e-41
1xmj_A290 Crystal Structure Of Human Deltaf508 Human Nbd1 Dom 2e-04
4ayt_A595 Structure Of The Human Mitochondrial Abc Transporte 5e-34
4ayw_A619 Structure Of The Human Mitochondrial Abc Transporte 2e-33
3gd7_A 390 Crystal Structure Of Human Nbd2 Complexed With N6- 3e-33
3qf4_B598 Crystal Structure Of A Heterodimeric Abc Transporte 4e-30
3qf4_A587 Crystal Structure Of A Heterodimeric Abc Transporte 7e-30
3g5u_A1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 3e-28
3g60_A1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 3e-28
2hyd_A578 Multidrug Abc Transporter Sav1866 Length = 578 9e-28
2hyd_A578 Multidrug Abc Transporter Sav1866 Length = 578 5e-24
1mv5_A243 Crystal Structure Of Lmra Atp-Binding Domain Length 1e-26
3b5x_A582 Crystal Structure Of Msba From Vibrio Cholerae Leng 5e-25
3b5y_A582 Crystal Structure Of Msba From Salmonella Typhimuri 2e-24
3b5y_A582 Crystal Structure Of Msba From Salmonella Typhimuri 1e-17
3b5w_A582 Crystal Structure Of Eschericia Coli Msba Length = 3e-24
3b5w_A582 Crystal Structure Of Eschericia Coli Msba Length = 8e-18
2ghi_A260 Crystal Structure Of Plasmodium Yoelii Multidrug Re 4e-23
3nh6_A306 Nucleotide Binding Domain Of Human Abcb6 (Apo Struc 8e-21
3b5j_A243 Crystal Structures Of The S504a Mutant Of An Isolat 2e-20
2pmk_A243 Crystal Structures Of An Isolated Abc-Atpase In Com 3e-20
1mt0_A241 Atp-Binding Domain Of Haemolysin B From Escherichia 4e-20
2ff7_A247 The Abc-Atpase Of The Abc-Transporter Hlyb In The A 4e-20
2ffb_A247 The Crystal Structure Of The Hlyb-Nbd E631q Mutant 9e-20
2ixf_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 9e-20
1xef_A241 Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DI 7e-19
2ffa_A247 Crystal Structure Of Abc-Atpase H662a Of The Abc-Tr 7e-19
2ixe_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 2e-18
2ixg_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 6e-18
1jj7_A260 Crystal Structure Of The C-Terminal Atpase Domain O 1e-17
1jj7_A260 Crystal Structure Of The C-Terminal Atpase Domain O 3e-17
1z47_A355 Structure Of The Atpase Subunit Cysa Of The Putativ 4e-14
3d31_A348 Modbc From Methanosarcina Acetivorans Length = 348 9e-14
2nq2_C253 An Inward-Facing Conformation Of A Putative Metal-C 3e-13
2it1_A362 Structure Of Ph0203 Protein From Pyrococcus Horikos 8e-13
4hlu_D268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 1e-12
3c41_J242 Abc Protein Artp In Complex With Amp-PnpMG2+ Length 4e-12
2olj_A263 Abc Protein Artp In Complex With AdpMG2+ Length = 2 4e-12
1q12_A381 Crystal Structure Of The Atp-bound E. Coli Malk Len 1e-11
1q1b_A381 Crystal Structure Of E. Coli Malk In The Nucleotide 1e-11
2r6g_A381 The Crystal Structure Of The E. Coli Maltose Transp 2e-11
1v43_A372 Crystal Structure Of Atpase Subunit Of Abc Sugar Tr 1e-10
1vci_A373 Crystal Structure Of The Atp-binding Cassette Of Mu 1e-10
2yz2_A266 Crystal Structure Of The Abc Transporter In The Cob 1e-10
4hlu_A268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 3e-10
1b0u_A262 Atp-Binding Subunit Of The Histidine Permease From 3e-10
2yyz_A359 Crystal Structure Of Sugar Abc Transporter, Atp-Bin 5e-10
2yyz_A 359 Crystal Structure Of Sugar Abc Transporter, Atp-Bin 4e-04
2d62_A375 Crystal Structure Of Multiple Sugar Binding Transpo 7e-09
1l2t_A235 Dimeric Structure Of Mj0796, A Bacterial Abc Transp 7e-09
2onk_A240 Abc Transporter Modbc In Complex With Its Binding P 8e-09
2onk_A240 Abc Transporter Modbc In Complex With Its Binding P 3e-05
3gfo_A275 Structure Of Cbio1 From Clostridium Perfringens: Pa 1e-08
3gfo_A275 Structure Of Cbio1 From Clostridium Perfringens: Pa 1e-05
1oxs_C353 Crystal Structure Of Glcv, The Abc-Atpase Of The Gl 2e-08
3tif_A235 Dimeric Structure Of A Post-Hydrolysis State Of The 2e-08
1g29_1372 Malk Length = 372 3e-08
1oxx_K353 Crystal Structure Of Glcv, The Abc-Atpase Of The Gl 8e-08
2ihy_A279 Structure Of The Staphylococcus Aureus Putative Atp 8e-08
3fvq_A359 Crystal Structure Of The Nucleotide Binding Domain 8e-08
1f3o_A235 Crystal Structure Of Mj0796 Atp-Binding Cassette Le 2e-07
1g6h_A257 Crystal Structure Of The Adp Conformation Of Mj1267 2e-07
1yqt_A538 Rnase-L Inhibitor Length = 538 3e-07
1yqt_A538 Rnase-L Inhibitor Length = 538 6e-05
2pcj_A224 Crystal Structure Of Abc Transporter (Aq_297) From 4e-07
1gaj_A257 Crystal Structure Of A Nucleotide-Free Atp-Binding 4e-07
1g9x_A257 Characterization Of The Twinning Structure Of Mj126 6e-07
2iwh_A986 Structure Of Yeast Elongation Factor 3 In Complex W 8e-07
3j15_B593 Model Of Ribosome-Bound Archaeal Pelota And Abce1 L 9e-07
3bk7_A607 Structure Of The Complete Abce1RNAASE-L Inhibitor P 9e-07
2ix8_A976 Model For Eef3 Bound To An 80s Ribosome Length = 97 2e-06
2iw3_A986 Elongation Factor 3 In Complex With Adp Length = 98 2e-06
3dhw_C343 Crystal Structure Of Methionine Importer Metni Leng 3e-06
3dhw_C343 Crystal Structure Of Methionine Importer Metni Leng 4e-06
4g1u_C266 X-Ray Structure Of The Bacterial Heme Transporter H 3e-06
3tui_C366 Inward Facing Conformations Of The Metni Methionine 8e-06
3tui_C366 Inward Facing Conformations Of The Metni Methionine 2e-05
4fwi_B334 Crystal Structure Of The Nucleotide-binding Domain 1e-05
3tuj_C366 Inward Facing Conformations Of The Metni Methionine 2e-05
3tuj_C366 Inward Facing Conformations Of The Metni Methionine 4e-05
1vpl_A256 Crystal Structure Of Abc Transporter Atp-binding Pr 2e-05
2pjz_A263 The Crystal Structure Of Putative Cobalt Transport 2e-04
3uwx_A972 Crystal Structure Of Uvra-Uvrb Complex Length = 972 2e-04
3ux8_A670 Crystal Structure Of Uvra Length = 670 3e-04
2r6f_A972 Crystal Structure Of Bacillus Stearothermophilus Uv 3e-04
1ji0_A240 Crystal Structure Analysis Of The Abc Transporter F 4e-04
1sgw_A214 Putative Abc Transporter (Atp-Binding Protein) From 8e-04
>pdb|4F4C|A Chain A, The Crystal Structure Of The Multi-Drug Transporter Length = 1321 Back     alignment and structure

Iteration: 1

Score = 225 bits (573), Expect = 2e-58, Method: Compositional matrix adjust. Identities = 225/931 (24%), Positives = 416/931 (44%), Gaps = 112/931 (12%) Query: 595 VKIQEGNFSWDPELAIPTLRGVNLDIKWAQKIAVCGSVGAGKSSLLYAILGEIPKISGTV 654 + ++ +F++ +P LRG+NL + Q +A+ GS G GKS+++ +L + G + Sbjct: 416 ITVENVHFTYPSRPDVPILRGMNLRVNAGQTVALVGSSGCGKSTIISLLLRYYDVLKGKI 475 Query: 655 NLYG-------------SIAYVSQTSWIQSGSIRDNILYGKPMDKARYDKAIKACAL--- 698 + G ++A VSQ + + +I +NI GK + ++ + AC + Sbjct: 476 TIDGVDVRDINLEFLRKNVAVVSQEPALFNCTIEENISLGK--EGITREEMVAACKMANA 533 Query: 699 DKDINNFDHGDLTEIGQRGLNLSGGQKQRIQLARAVYNDADIYLFDDPFSAVDAHTAATL 758 +K I +G T +G RG LSGGQKQRI +ARA+ + I L D+ SA+DA + + Sbjct: 534 EKFIKTLPNGYNTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDAESEG-I 592 Query: 759 FNECVMAALEKKTVILVTHQVEFLSEVDRILVLEGGQITQSGNYQELLLAGTAFEQLVNA 818 + + A + +T I++ H++ + D I+ + GQ+ + G+++ L+ + LV A Sbjct: 593 VQQALDKAAKGRTTIIIAHRLSTIRNADLIISCKNGQVVEVGDHRALMAQQGLYYDLVTA 652 Query: 819 HRDAITGLGPLDNAGQGGAEK---------VEKGRTARPEEPNGIYPRKESSEGEISVKG 869 T +D+A +G + +G + + E + I R SS ++ Sbjct: 653 Q----TFTDAVDSAAEGKFSRENSVARQTSEHEGLSRQASEMDDIMNRVRSS----TIGS 704 Query: 870 LTQ--LTEDEEMEIGDVGWKPFMDYLNVSKGMSLLCLGVL------AQSGFVGLQAAATY 921 +T + +++E IG L + +L A S F+G+ A Sbjct: 705 ITNGPVIDEKEERIGKDALSRLKQELEENNAQKTNLFEILYHARPHALSLFIGMSTATIG 764 Query: 922 WLAYAIQIPKITSGILIGVYAG------------------VSTASAVFVYFRSFFAAHLG 963 Y TS + V+AG ++ A + + +FF +G Sbjct: 765 GFIYPTYSVFFTS--FMNVFAGNPADFLSQGHFWALMFLVLAAAQGICSFLMTFF---MG 819 Query: 964 LKASKAFFSGFTNSIFK----APMLFFDS--TPVGRILTRLSSDLSILDFDIPFSIVFVA 1017 + AS++ N +F+ + FFDS G+I TRL++D+ L I F V Sbjct: 820 I-ASESLTRDLRNKLFRNVLSQHIGFFDSPQNASGKISTRLATDVPNLRTAIDFRFSTVI 878 Query: 1018 ASGTELLAIIGIMTFVTWQV--LVVAIFAMVAVRFVQRYYIATARELIRINGTTKAPVMN 1075 + ++A IG+ F WQ+ L++AI +VA R T + + + + A Sbjct: 879 TTLVSMVAGIGLAFFYGWQMALLIIAILPIVAFGQYLRGRRFTGKNV--KSASEFADSGK 936 Query: 1076 YTAETSQGVVTIRAFNMVDRFFQNYLKLVDIDASLFFHTNGVMEWLIL--------RVEA 1127 E + V T++A D F++N+ + +DI H + E I V Sbjct: 937 IAIEAIENVRTVQALAREDTFYENFCEKLDIP-----HKEAIKEAFIQGLSYGCASSVLY 991 Query: 1128 LQNXXXXXXXXXXVLIPRGYVAPGLVGLSLSYAFTL-TGTQVFLSRWYCYLANYI----I 1182 L N ++ + P V L + YA T+ T T F + ++ A I Sbjct: 992 LLNTCAYRMGLALIITDPPTMQPMRV-LRVMYAITISTSTLGFATSYFPEYAKATFAGGI 1050 Query: 1183 SVERIKQFMHIPPEPPAIVEDKRPPSSWPFKGRIELRQLKIRYRPNAP--LVLKGITCTF 1240 +++ I + ++ +K+ G++ + ++ Y P P +LKG++ + Sbjct: 1051 IFGMLRKISKI--DSLSLAGEKK-----KLYGKVIFKNVRFAY-PERPEIEILKGLSFSV 1102 Query: 1241 SEXXXXXXXXXXXXXXXXLISALFRLVEPAGGSILIDGVDICSMGLKDLRVKLSIIPQEP 1300 +++ L R + GG I IDG +I ++ + R +++I+ QEP Sbjct: 1103 EPGQTLALVGPSGCGKSTVVALLERFYDTLGGEIFIDGSEIKTLNPEHTRSQIAIVSQEP 1162 Query: 1301 TLFRGSVRTN----LDPLGLYSDDEIWKALEKCQLKTTISSLPNKLDSSVSDEGENWSAG 1356 TLF S+ N LDP + + ++ +A + I+ LP ++ V D G S G Sbjct: 1163 TLFDCSIAENIIYGLDPSSV-TMAQVEEAARLANIHNFIAELPEGFETRVGDRGTQLSGG 1221 Query: 1357 QRQLFCLGRVLLKRNRILVLDEANASIDSATDAILQRIIRQEFSNCTVITVAHRVPTVID 1416 Q+Q + R L++ +IL+LDEA +++D+ ++ ++Q + + T I +AHR+ TV++ Sbjct: 1222 QKQRIAIARALVRNPKILLLDEATSALDTESEKVVQEALDRAREGRTCIVIAHRLNTVMN 1281 Query: 1417 SDMVMVLSYGKLLEYDEPSKLMETNSSFSKL 1447 +D + V+S G ++E ++LM ++ KL Sbjct: 1282 ADCIAVVSNGTIIEKGTHTQLMSEKGAYYKL 1312
>pdb|4F4C|A Chain A, The Crystal Structure Of The Multi-Drug Transporter Length = 1321 Back     alignment and structure
>pdb|2CBZ|A Chain A, Structure Of The Human Multidrug Resistance Protein 1 Nucleotide Binding Domain 1 Length = 237 Back     alignment and structure
>pdb|2CBZ|A Chain A, Structure Of The Human Multidrug Resistance Protein 1 Nucleotide Binding Domain 1 Length = 237 Back     alignment and structure
>pdb|1Q3H|A Chain A, Mouse Cftr Nbd1 With Amp.Pnp Length = 286 Back     alignment and structure
>pdb|1Q3H|A Chain A, Mouse Cftr Nbd1 With Amp.Pnp Length = 286 Back     alignment and structure
>pdb|1R0Z|A Chain A, Phosphorylated Cystic Fibrosis Transmembrane Conductance Regulator (Cftr) Nucleotide-Binding Domain One (Nbd1) With Atp Length = 286 Back     alignment and structure
>pdb|1R0Z|A Chain A, Phosphorylated Cystic Fibrosis Transmembrane Conductance Regulator (Cftr) Nucleotide-Binding Domain One (Nbd1) With Atp Length = 286 Back     alignment and structure
>pdb|1XMI|A Chain A, Crystal Structure Of Human F508a Nbd1 Domain With Atp Length = 291 Back     alignment and structure
>pdb|1XMI|A Chain A, Crystal Structure Of Human F508a Nbd1 Domain With Atp Length = 291 Back     alignment and structure
>pdb|1XFA|A Chain A, Structure Of Nbd1 From Murine Cftr- F508r Mutant Length = 283 Back     alignment and structure
>pdb|1XFA|A Chain A, Structure Of Nbd1 From Murine Cftr- F508r Mutant Length = 283 Back     alignment and structure
>pdb|1XF9|A Chain A, Structure Of Nbd1 From Murine Cftr- F508s Mutant Length = 283 Back     alignment and structure
>pdb|1XF9|A Chain A, Structure Of Nbd1 From Murine Cftr- F508s Mutant Length = 283 Back     alignment and structure
>pdb|2PZG|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Monomer Length = 241 Back     alignment and structure
>pdb|2PZG|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Monomer Length = 241 Back     alignment and structure
>pdb|2PZE|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Head-To-Tail Dimer Length = 229 Back     alignment and structure
>pdb|2PZE|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Head-To-Tail Dimer Length = 229 Back     alignment and structure
>pdb|2BBS|A Chain A, Human Deltaf508 Nbd1 With Three Solubilizing Mutations Length = 290 Back     alignment and structure
>pdb|2BBS|A Chain A, Human Deltaf508 Nbd1 With Three Solubilizing Mutations Length = 290 Back     alignment and structure
>pdb|2BBT|A Chain A, Human Deltaf508 Nbd1 With Two Solublizing Mutations. Length = 290 Back     alignment and structure
>pdb|2BBT|A Chain A, Human Deltaf508 Nbd1 With Two Solublizing Mutations. Length = 290 Back     alignment and structure
>pdb|3SI7|A Chain A, The Crystal Structure Of The Nbd1 Domain Of The Mouse Cftr Protein, Deltaf508 Mutant Length = 285 Back     alignment and structure
>pdb|3SI7|A Chain A, The Crystal Structure Of The Nbd1 Domain Of The Mouse Cftr Protein, Deltaf508 Mutant Length = 285 Back     alignment and structure
>pdb|2BBO|A Chain A, Human Nbd1 With Phe508 Length = 291 Back     alignment and structure
>pdb|2BBO|A Chain A, Human Nbd1 With Phe508 Length = 291 Back     alignment and structure
>pdb|2PZF|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Head-To-Tail Dimer With Delta F508 Length = 228 Back     alignment and structure
>pdb|2PZF|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Head-To-Tail Dimer With Delta F508 Length = 228 Back     alignment and structure
>pdb|1XMJ|A Chain A, Crystal Structure Of Human Deltaf508 Human Nbd1 Domain With Atp Length = 290 Back     alignment and structure
>pdb|1XMJ|A Chain A, Crystal Structure Of Human Deltaf508 Human Nbd1 Domain With Atp Length = 290 Back     alignment and structure
>pdb|4AYT|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 Length = 595 Back     alignment and structure
>pdb|4AYW|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 (plate Form) Length = 619 Back     alignment and structure
>pdb|3GD7|A Chain A, Crystal Structure Of Human Nbd2 Complexed With N6- Phenylethyl-Atp (P-Atp) Length = 390 Back     alignment and structure
>pdb|3QF4|B Chain B, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 598 Back     alignment and structure
>pdb|3QF4|A Chain A, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 587 Back     alignment and structure
>pdb|3G5U|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3G60|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|2HYD|A Chain A, Multidrug Abc Transporter Sav1866 Length = 578 Back     alignment and structure
>pdb|2HYD|A Chain A, Multidrug Abc Transporter Sav1866 Length = 578 Back     alignment and structure
>pdb|1MV5|A Chain A, Crystal Structure Of Lmra Atp-Binding Domain Length = 243 Back     alignment and structure
>pdb|3B5X|A Chain A, Crystal Structure Of Msba From Vibrio Cholerae Length = 582 Back     alignment and structure
>pdb|3B5Y|A Chain A, Crystal Structure Of Msba From Salmonella Typhimurium With Amppnp Length = 582 Back     alignment and structure
>pdb|3B5Y|A Chain A, Crystal Structure Of Msba From Salmonella Typhimurium With Amppnp Length = 582 Back     alignment and structure
>pdb|3B5W|A Chain A, Crystal Structure Of Eschericia Coli Msba Length = 582 Back     alignment and structure
>pdb|3B5W|A Chain A, Crystal Structure Of Eschericia Coli Msba Length = 582 Back     alignment and structure
>pdb|2GHI|A Chain A, Crystal Structure Of Plasmodium Yoelii Multidrug Resistance Protein 2 Length = 260 Back     alignment and structure
>pdb|3NH6|A Chain A, Nucleotide Binding Domain Of Human Abcb6 (Apo Structure) Length = 306 Back     alignment and structure
>pdb|3B5J|A Chain A, Crystal Structures Of The S504a Mutant Of An Isolated Abc-atpase In Complex With Tnp-adp Length = 243 Back     alignment and structure
>pdb|2PMK|A Chain A, Crystal Structures Of An Isolated Abc-Atpase In Complex With Tnp-Adp Length = 243 Back     alignment and structure
>pdb|1MT0|A Chain A, Atp-Binding Domain Of Haemolysin B From Escherichia Coli Length = 241 Back     alignment and structure
>pdb|2FF7|A Chain A, The Abc-Atpase Of The Abc-Transporter Hlyb In The Adp Bound State Length = 247 Back     alignment and structure
>pdb|2FFB|A Chain A, The Crystal Structure Of The Hlyb-Nbd E631q Mutant In Complex With Adp Length = 247 Back     alignment and structure
>pdb|2IXF|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (D645q, Q678h Mutant) Length = 271 Back     alignment and structure
>pdb|1XEF|A Chain A, Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DIMER OF HLYB-Nbd Length = 241 Back     alignment and structure
>pdb|2FFA|A Chain A, Crystal Structure Of Abc-Atpase H662a Of The Abc-Transporter Hlyb In Complex With Adp Length = 247 Back     alignment and structure
>pdb|2IXE|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (d645n Mutant) Length = 271 Back     alignment and structure
>pdb|2IXG|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (S621a, G622v, D645n Mutant) Length = 271 Back     alignment and structure
>pdb|1JJ7|A Chain A, Crystal Structure Of The C-Terminal Atpase Domain Of Human Tap1 Length = 260 Back     alignment and structure
>pdb|1JJ7|A Chain A, Crystal Structure Of The C-Terminal Atpase Domain Of Human Tap1 Length = 260 Back     alignment and structure
>pdb|1Z47|A Chain A, Structure Of The Atpase Subunit Cysa Of The Putative Sulfate Atp-Binding Cassette (Abc) Transporter From Alicyclobacillus Acidocaldarius Length = 355 Back     alignment and structure
>pdb|3D31|A Chain A, Modbc From Methanosarcina Acetivorans Length = 348 Back     alignment and structure
>pdb|2NQ2|C Chain C, An Inward-Facing Conformation Of A Putative Metal-Chelate Type Abc Transporter. Length = 253 Back     alignment and structure
>pdb|2IT1|A Chain A, Structure Of Ph0203 Protein From Pyrococcus Horikoshii Length = 362 Back     alignment and structure
>pdb|4HLU|D Chain D, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|3C41|J Chain J, Abc Protein Artp In Complex With Amp-PnpMG2+ Length = 242 Back     alignment and structure
>pdb|2OLJ|A Chain A, Abc Protein Artp In Complex With AdpMG2+ Length = 263 Back     alignment and structure
>pdb|1Q12|A Chain A, Crystal Structure Of The Atp-bound E. Coli Malk Length = 381 Back     alignment and structure
>pdb|1Q1B|A Chain A, Crystal Structure Of E. Coli Malk In The Nucleotide-Free Form Length = 381 Back     alignment and structure
>pdb|2R6G|A Chain A, The Crystal Structure Of The E. Coli Maltose Transporter Length = 381 Back     alignment and structure
>pdb|1V43|A Chain A, Crystal Structure Of Atpase Subunit Of Abc Sugar Transporter Length = 372 Back     alignment and structure
>pdb|1VCI|A Chain A, Crystal Structure Of The Atp-binding Cassette Of Multisugar Transporter From Pyrococcus Horikoshii Ot3 Complexed With Atp Length = 373 Back     alignment and structure
>pdb|2YZ2|A Chain A, Crystal Structure Of The Abc Transporter In The Cobalt Transport System Length = 266 Back     alignment and structure
>pdb|4HLU|A Chain A, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|1B0U|A Chain A, Atp-Binding Subunit Of The Histidine Permease From Salmonella Typhimurium Length = 262 Back     alignment and structure
>pdb|2YYZ|A Chain A, Crystal Structure Of Sugar Abc Transporter, Atp-Binding Protein Length = 359 Back     alignment and structure
>pdb|2YYZ|A Chain A, Crystal Structure Of Sugar Abc Transporter, Atp-Binding Protein Length = 359 Back     alignment and structure
>pdb|2D62|A Chain A, Crystal Structure Of Multiple Sugar Binding Transport Atp- Binding Protein Length = 375 Back     alignment and structure
>pdb|1L2T|A Chain A, Dimeric Structure Of Mj0796, A Bacterial Abc Transporter Cassette Length = 235 Back     alignment and structure
>pdb|2ONK|A Chain A, Abc Transporter Modbc In Complex With Its Binding Protein Moda Length = 240 Back     alignment and structure
>pdb|2ONK|A Chain A, Abc Transporter Modbc In Complex With Its Binding Protein Moda Length = 240 Back     alignment and structure
>pdb|3GFO|A Chain A, Structure Of Cbio1 From Clostridium Perfringens: Part Of The Abc Transporter Complex Cbionq Length = 275 Back     alignment and structure
>pdb|3GFO|A Chain A, Structure Of Cbio1 From Clostridium Perfringens: Part Of The Abc Transporter Complex Cbionq Length = 275 Back     alignment and structure
>pdb|1OXS|C Chain C, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 Back     alignment and structure
>pdb|3TIF|A Chain A, Dimeric Structure Of A Post-Hydrolysis State Of The Atp-Binding Cassette Mj0796 Bound To Adp And Pi Length = 235 Back     alignment and structure
>pdb|1G29|1 Chain 1, Malk Length = 372 Back     alignment and structure
>pdb|1OXX|K Chain K, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 Back     alignment and structure
>pdb|2IHY|A Chain A, Structure Of The Staphylococcus Aureus Putative Atpase Subunit Of An Atp-Binding Cassette (Abc) Transporter Length = 279 Back     alignment and structure
>pdb|3FVQ|A Chain A, Crystal Structure Of The Nucleotide Binding Domain Fbpc Complexed With Atp Length = 359 Back     alignment and structure
>pdb|1F3O|A Chain A, Crystal Structure Of Mj0796 Atp-Binding Cassette Length = 235 Back     alignment and structure
>pdb|1G6H|A Chain A, Crystal Structure Of The Adp Conformation Of Mj1267, An Atp- Binding Cassette Of An Abc Transporter Length = 257 Back     alignment and structure
>pdb|1YQT|A Chain A, Rnase-L Inhibitor Length = 538 Back     alignment and structure
>pdb|1YQT|A Chain A, Rnase-L Inhibitor Length = 538 Back     alignment and structure
>pdb|2PCJ|A Chain A, Crystal Structure Of Abc Transporter (Aq_297) From Aquifex Aeolicus Vf5 Length = 224 Back     alignment and structure
>pdb|1GAJ|A Chain A, Crystal Structure Of A Nucleotide-Free Atp-Binding Cassette From An Abc Transporter Length = 257 Back     alignment and structure
>pdb|1G9X|A Chain A, Characterization Of The Twinning Structure Of Mj1267, An Atp-Binding Cassette Of An Abc Transporter Length = 257 Back     alignment and structure
>pdb|2IWH|A Chain A, Structure Of Yeast Elongation Factor 3 In Complex With Adpnp Length = 986 Back     alignment and structure
>pdb|3J15|B Chain B, Model Of Ribosome-Bound Archaeal Pelota And Abce1 Length = 593 Back     alignment and structure
>pdb|3BK7|A Chain A, Structure Of The Complete Abce1RNAASE-L Inhibitor Protein From Pyrococcus Abysii Length = 607 Back     alignment and structure
>pdb|2IX8|A Chain A, Model For Eef3 Bound To An 80s Ribosome Length = 976 Back     alignment and structure
>pdb|2IW3|A Chain A, Elongation Factor 3 In Complex With Adp Length = 986 Back     alignment and structure
>pdb|3DHW|C Chain C, Crystal Structure Of Methionine Importer Metni Length = 343 Back     alignment and structure
>pdb|3DHW|C Chain C, Crystal Structure Of Methionine Importer Metni Length = 343 Back     alignment and structure
>pdb|4G1U|C Chain C, X-Ray Structure Of The Bacterial Heme Transporter Hmuuv From Yersinia Pestis Length = 266 Back     alignment and structure
>pdb|3TUI|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Cy5 Native Crystal Form Length = 366 Back     alignment and structure
>pdb|3TUI|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Cy5 Native Crystal Form Length = 366 Back     alignment and structure
>pdb|4FWI|B Chain B, Crystal Structure Of The Nucleotide-binding Domain Of A Dipeptide Abc Transporter Length = 334 Back     alignment and structure
>pdb|3TUJ|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Dm Crystal Form Length = 366 Back     alignment and structure
>pdb|3TUJ|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Dm Crystal Form Length = 366 Back     alignment and structure
>pdb|1VPL|A Chain A, Crystal Structure Of Abc Transporter Atp-binding Protein (tm0544) From Thermotoga Maritima At 2.10 A Resolution Length = 256 Back     alignment and structure
>pdb|2PJZ|A Chain A, The Crystal Structure Of Putative Cobalt Transport Atp- Binding Protein (cbio-2), St1066 Length = 263 Back     alignment and structure
>pdb|3UWX|A Chain A, Crystal Structure Of Uvra-Uvrb Complex Length = 972 Back     alignment and structure
>pdb|3UX8|A Chain A, Crystal Structure Of Uvra Length = 670 Back     alignment and structure
>pdb|2R6F|A Chain A, Crystal Structure Of Bacillus Stearothermophilus Uvra Length = 972 Back     alignment and structure
>pdb|1JI0|A Chain A, Crystal Structure Analysis Of The Abc Transporter From Thermotoga Maritima Length = 240 Back     alignment and structure
>pdb|1SGW|A Chain A, Putative Abc Transporter (Atp-Binding Protein) From Pyrococcus Furiosus Pfu-867808-001 Length = 214 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1467
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 1e-142
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 2e-27
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 1e-131
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 2e-34
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 1e-127
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 3e-30
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 1e-126
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 8e-30
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 1e-116
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 3e-60
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 5e-45
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 4e-73
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 9e-49
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 3e-72
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 2e-51
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 2e-71
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 1e-51
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 3e-66
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 1e-42
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 3e-66
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 3e-38
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 1e-61
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 4e-43
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 9e-58
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 1e-38
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 7e-55
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 1e-41
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 1e-54
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 2e-39
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 6e-52
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 4e-38
2ghi_A260 Transport protein; multidrug resistance protein, M 8e-52
2ghi_A260 Transport protein; multidrug resistance protein, M 1e-41
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 1e-28
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 1e-20
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 3e-28
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 2e-20
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 3e-27
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 1e-16
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 3e-24
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 5e-18
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 1e-17
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 1e-14
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 1e-23
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 1e-17
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 2e-23
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 2e-18
1sgw_A214 Putative ABC transporter; structural genomics, P p 1e-22
1sgw_A214 Putative ABC transporter; structural genomics, P p 5e-18
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 7e-22
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 6e-19
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 1e-17
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 3e-13
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 1e-21
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 6e-18
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 1e-17
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 5e-14
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 1e-21
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 5e-18
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 6e-16
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 3e-14
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 6e-18
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 4e-17
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 1e-17
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 7e-11
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 2e-09
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 3e-07
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 4e-06
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 3e-17
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 5e-09
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 5e-17
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 3e-07
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 3e-16
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 9e-09
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 1e-15
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 1e-05
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 2e-15
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 4e-14
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 4e-15
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 1e-14
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 5e-15
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 4e-07
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 1e-14
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 7e-04
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 2e-14
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 2e-07
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 2e-13
1ji0_A240 ABC transporter; ATP binding protein, structural g 1e-12
1ji0_A240 ABC transporter; ATP binding protein, structural g 7e-10
1b0u_A262 Histidine permease; ABC transporter, transport pro 1e-12
1b0u_A262 Histidine permease; ABC transporter, transport pro 8e-09
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 1e-12
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 3e-12
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 3e-12
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 8e-12
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 6e-09
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 6e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-08
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 2e-07
1g6h_A257 High-affinity branched-chain amino acid transport 3e-06
1g6h_A257 High-affinity branched-chain amino acid transport 6e-04
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 3e-05
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 6e-05
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Length = 390 Back     alignment and structure
 Score =  440 bits (1134), Expect = e-142
 Identities = 91/255 (35%), Positives = 143/255 (56%), Gaps = 4/255 (1%)

Query: 1199 AIVE--DKRPPSSWPFKGRIELRQLKIRYRPNAPLVLKGITCTFSEGTRVGVVGRTGSGK 1256
            +++E    +    WP  G++ ++ L  +Y      +L+ I+ + S G RVG++GRTGSGK
Sbjct: 1    SLIENSHVKKDDIWPSGGQMTVKDLTAKYTEGGNAILENISFSISPGQRVGLLGRTGSGK 60

Query: 1257 TTLISALFRLVEPAGGSILIDGVDICSMGLKDLRVKLSIIPQEPTLFRGSVRTNLDPLGL 1316
            +TL+SA  RL+   G  I IDGV   S+ L+  R    +IPQ+  +F G+ R NLDP   
Sbjct: 61   STLLSAFLRLLNTEG-EIQIDGVSWDSITLEQWRKAFGVIPQKVFIFSGTFRKNLDPNAA 119

Query: 1317 YSDDEIWKALEKCQLKTTISSLPNKLDSSVSDEGENWSAGQRQLFCLGRVLLKRNRILVL 1376
            +SD EIWK  ++  L++ I   P KLD  + D G   S G +QL CL R +L + +IL+L
Sbjct: 120  HSDQEIWKVADEVGLRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVLSKAKILLL 179

Query: 1377 DEANASIDSATDAILQRIIRQEFSNCTVITVAHRVPTVIDSDMVMVLSYGKLLEYDEPSK 1436
            DE +A +D  T  I++R ++Q F++CTVI    R+  +++ D  +V+   K+ +YD   +
Sbjct: 180  DEPSAHLDPVTYQIIRRTLKQAFADCTVILCEARIEAMLECDQFLVIEENKVRQYDSILE 239

Query: 1437 LME-TNSSFSKLVAE 1450
            L       F      
Sbjct: 240  LYHYPADRFVAGFIG 254


>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Length = 390 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 598 Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 598 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 587 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 587 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Length = 359 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Length = 359 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Length = 224 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Length = 224 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Length = 353 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Length = 353 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Length = 235 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Length = 235 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Length = 362 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Length = 262 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Length = 262 Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Length = 359 Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Length = 372 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Length = 372 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Length = 263 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Length = 263 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Length = 381 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Length = 339 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Length = 148 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1467
d2hyda1255 c.37.1.12 (A:324-578) Putative multidrug export AT 2e-68
d2hyda1255 c.37.1.12 (A:324-578) Putative multidrug export AT 2e-59
d1r0wa_281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 5e-65
d1r0wa_281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 2e-53
d3b60a1253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 5e-64
d3b60a1253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 1e-56
d1jj7a_251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 4e-59
d1jj7a_251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 3e-53
d2pmka1241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 7e-58
d2pmka1241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 8e-50
d1mv5a_242 c.37.1.12 (A:) Multidrug resistance ABC transporte 2e-56
d1mv5a_242 c.37.1.12 (A:) Multidrug resistance ABC transporte 7e-50
d3dhwc1240 c.37.1.12 (C:1-240) Methionine import ATP-binding 2e-31
d3dhwc1240 c.37.1.12 (C:1-240) Methionine import ATP-binding 4e-27
d1l2ta_230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 1e-30
d1l2ta_230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 7e-29
d1v43a3239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 1e-29
d1v43a3239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 1e-29
d1ji0a_240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 1e-28
d1ji0a_240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 1e-22
d1b0ua_258 c.37.1.12 (A:) ATP-binding subunit of the histidin 2e-28
d1b0ua_258 c.37.1.12 (A:) ATP-binding subunit of the histidin 1e-26
d1g6ha_254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 5e-28
d1g6ha_254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 6e-24
d1l7vc_231 c.37.1.12 (C:) ABC transporter involved in vitamin 5e-27
d1l7vc_231 c.37.1.12 (C:) ABC transporter involved in vitamin 7e-25
d2awna2232 c.37.1.12 (A:4-235) Maltose transport protein MalK 6e-26
d2awna2232 c.37.1.12 (A:4-235) Maltose transport protein MalK 2e-24
d1g2912240 c.37.1.12 (1:1-240) Maltose transport protein MalK 7e-26
d1g2912240 c.37.1.12 (1:1-240) Maltose transport protein MalK 1e-24
d1vpla_238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 1e-25
d1vpla_238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 8e-25
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 4e-25
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 8e-25
d3d31a2229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 8e-25
d3d31a2229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 7e-24
d1oxxk2242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 9e-24
d1oxxk2242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 2e-23
d2onka1240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 4e-21
d2onka1240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 8e-20
d1ye8a1178 c.37.1.11 (A:1-178) Hypothetical kinase-like prote 3e-16
d1ye8a1178 c.37.1.11 (A:1-178) Hypothetical kinase-like prote 7e-16
d2i3ba1189 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 4e-14
g1f2t.1292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 7e-09
g1ii8.1369 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 3e-08
g1ii8.1369 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 0.003
d3b60a2319 f.37.1.1 (A:10-328) Multidrug resistance ABC trans 3e-07
d2hyda2323 f.37.1.1 (A:1-323) Putative multidrug export ATP-b 6e-05
d2hyda2323 f.37.1.1 (A:1-323) Putative multidrug export ATP-b 0.002
d1w1wa_427 c.37.1.12 (A:) Smc head domain {Baker's yeast (Sac 0.002
d2qm8a1323 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylo 0.002
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Putative multidrug export ATP-binding/permease protein SAV1866
species: Staphylococcus aureus [TaxId: 1280]
 Score =  228 bits (584), Expect = 2e-68
 Identities = 69/238 (28%), Positives = 126/238 (52%), Gaps = 1/238 (0%)

Query: 1213 KGRIELRQLKIRYRPNAPLVLKGITCTFSEGTRVGVVGRTGSGKTTLISALFRLVEPAGG 1272
            +GRI++  +  +Y  N   +LK I  +  +G  V  VG +G GK+TLI+ + R  +   G
Sbjct: 14   QGRIDIDHVSFQYNDNEAPILKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSG 73

Query: 1273 SILIDGVDICSMGLKDLRVKLSIIPQEPTLFRGSVRTNL-DPLGLYSDDEIWKALEKCQL 1331
             ILIDG +I       LR ++ ++ Q+  LF  +V+ N+       +D+E+ +A +    
Sbjct: 74   QILIDGHNIKDFLTGSLRNQIGLVQQDNILFSDTVKENILLGRPTATDEEVVEAAKMANA 133

Query: 1332 KTTISSLPNKLDSSVSDEGENWSAGQRQLFCLGRVLLKRNRILVLDEANASIDSATDAIL 1391
               I +LP   D+ V + G   S GQ+Q   + R+ L    IL+LDEA +++D  +++I+
Sbjct: 134  HDFIMNLPQGYDTEVGERGVKLSGGQKQRLSIARIFLNNPPILILDEATSALDLESESII 193

Query: 1392 QRIIRQEFSNCTVITVAHRVPTVIDSDMVMVLSYGKLLEYDEPSKLMETNSSFSKLVA 1449
            Q  +     + T + VAHR+ T+  +D ++V+  G ++E     +L+    ++  L +
Sbjct: 194  QEALDVLSKDRTTLIVAHRLSTITHADKIVVIENGHIVETGTHRELIAKQGAYEHLYS 251


>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 Back     information, alignment and structure
>d3b60a2 f.37.1.1 (A:10-328) Multidrug resistance ABC transporter MsbA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 319 Back     information, alignment and structure
>d2hyda2 f.37.1.1 (A:1-323) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 323 Back     information, alignment and structure
>d2hyda2 f.37.1.1 (A:1-323) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 323 Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 427 Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Length = 323 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1467
d2hyda1255 Putative multidrug export ATP-binding/permease pro 100.0
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 100.0
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 100.0
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 100.0
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 100.0
d2hyda1255 Putative multidrug export ATP-binding/permease pro 100.0
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 100.0
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 100.0
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 100.0
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 100.0
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 100.0
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 100.0
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 100.0
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 100.0
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 100.0
d2awna2232 Maltose transport protein MalK, N-terminal domain 100.0
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1g2912240 Maltose transport protein MalK, N-terminal domain 100.0
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 100.0
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 100.0
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 100.0
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 100.0
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 100.0
d2awna2232 Maltose transport protein MalK, N-terminal domain 100.0
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 100.0
d1g2912240 Maltose transport protein MalK, N-terminal domain 100.0
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 100.0
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 100.0
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 100.0
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 100.0
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 100.0
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 99.97
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 99.97
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 99.96
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 99.94
d3b60a2319 Multidrug resistance ABC transporter MsbA, N-termi 99.9
d3b60a2319 Multidrug resistance ABC transporter MsbA, N-termi 99.89
d2hyda2323 Putative multidrug export ATP-binding/permease pro 99.87
d2hyda2323 Putative multidrug export ATP-binding/permease pro 99.85
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.57
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.48
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 99.27
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.17
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.16
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 99.1
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.91
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 98.73
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 98.56
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 98.48
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 98.24
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 97.99
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 96.05
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 96.0
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 95.99
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 95.85
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 95.74
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 95.3
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 94.57
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 94.39
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 94.36
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 94.23
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 94.17
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 93.87
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 93.69
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 93.2
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 93.2
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 93.12
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 92.68
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 92.27
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 92.11
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 92.1
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 91.94
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 91.9
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 91.89
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 91.66
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 91.65
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 91.64
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 91.45
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 91.22
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 91.14
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 91.1
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 90.99
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 90.97
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 90.92
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 90.86
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 90.86
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 90.81
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 90.68
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 90.68
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 90.67
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 90.65
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 90.63
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 90.47
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 90.16
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 90.1
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 89.95
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 89.82
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 89.8
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 89.77
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 89.76
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 89.75
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 89.59
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 89.39
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 89.35
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 89.13
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 88.97
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 88.88
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 88.84
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 88.78
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 88.67
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 88.05
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 88.04
d1nrjb_209 Signal recognition particle receptor beta-subunit 87.89
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 87.87
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 87.85
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 87.83
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 87.82
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 87.15
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 87.11
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 87.08
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 87.05
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 87.01
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 86.96
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 86.96
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 86.96
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 86.56
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 86.48
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 86.28
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 86.16
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 86.09
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 86.02
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 86.01
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 85.99
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 85.96
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 85.86
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 85.84
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 85.76
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 85.52
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 85.32
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 85.07
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 84.94
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 84.77
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 84.7
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 84.42
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 84.42
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 84.41
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 84.38
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 84.35
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 84.33
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 84.33
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 84.27
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 84.2
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 84.19
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 84.11
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 84.0
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 83.95
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 83.67
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 83.59
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 83.54
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 83.49
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 83.48
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 83.45
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 83.45
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 83.4
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 83.26
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 83.26
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 83.19
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 83.03
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 83.02
d2fh5b1207 Signal recognition particle receptor beta-subunit 82.96
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 82.92
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 82.68
d1okkd2207 GTPase domain of the signal recognition particle r 82.57
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 82.56
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 82.53
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 82.47
d1nrjb_209 Signal recognition particle receptor beta-subunit 82.4
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 82.39
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 82.38
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 82.37
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 82.11
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 81.79
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 81.78
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 81.65
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 81.58
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 81.58
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 81.52
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 81.49
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 81.35
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 81.33
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 81.17
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 81.07
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 80.94
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 80.93
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 80.91
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 80.9
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 80.71
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 80.56
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 80.56
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 80.47
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 80.35
d1j8yf2211 GTPase domain of the signal sequence recognition p 80.32
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 80.11
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 80.04
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Putative multidrug export ATP-binding/permease protein SAV1866
species: Staphylococcus aureus [TaxId: 1280]
Probab=100.00  E-value=0  Score=495.78  Aligned_cols=239  Identities=29%  Similarity=0.502  Sum_probs=230.1

Q ss_pred             CCCCEEEEEEEEEEECCCCCCCEECEEEEEECCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHH
Q ss_conf             97640899987888579999620000389618959999949999588999988414679863699979517999978885
Q 000481         1211 PFKGRIELRQLKIRYRPNAPLVLKGITCTFSEGTRVGVVGRTGSGKTTLISALFRLVEPAGGSILIDGVDICSMGLKDLR 1290 (1467)
Q Consensus      1211 p~~g~I~f~nvs~~Y~~~~~~vLk~isl~I~~GekvgIVGrTGSGKSTL~~~L~rl~~~~~G~I~IDG~dI~~i~l~~LR 1290 (1467)
                      ..+|.|+|+||+|+|+++.+++|+||||+|++||++||||+||||||||+++|.|+++|++|+|.+||.|+++++.+.+|
T Consensus        12 ~~~g~I~~~nvsf~Y~~~~~~vL~~isl~i~~Ge~vaivG~sGsGKSTLl~ll~gl~~p~~G~I~i~g~~i~~~~~~~lr   91 (255)
T d2hyda1          12 IKQGRIDIDHVSFQYNDNEAPILKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIKDFLTGSLR   91 (255)
T ss_dssp             CCSCCEEEEEEEECSCSSSCCSEEEEEEEECTTCEEEEECSTTSSHHHHHTTTTTSSCCSEEEEEETTEEGGGSCHHHHH
T ss_pred             CCCCEEEEEEEEEEECCCCCCCEECEEEEECCCCEEEEECCCCCCHHHHHHHHHHCCCCCCCCCCCCCEECCCCCHHHHH
T ss_conf             77887999988999599997606443899839989999889998099999999712786300015399875307888863


Q ss_pred             HCCEEECCCCCCCCCCHHHHCCCC-CCCCHHHHHHHHHHCCCCHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             215786267754665567714999-9999999999999838814773077876542346888889069999999998606
Q 000481         1291 VKLSIIPQEPTLFRGSVRTNLDPL-GLYSDDEIWKALEKCQLKTTISSLPNKLDSSVSDEGENWSAGQRQLFCLGRVLLK 1369 (1467)
Q Consensus      1291 ~~isiIpQdp~LF~gTIR~NLdp~-~~~sd~ei~~aL~~~~L~~~v~~lp~gLdt~v~e~G~nLS~GQrQll~LARALLr 1369 (1467)
                      +++++|||+|.+|+||||+||... ...+|+++++|++.+++.+++..+|+|+||.++++|.+||||||||+|||||+++
T Consensus        92 ~~i~~v~Q~~~lf~~Ti~eNi~~g~~~~~~~~~~~al~~~~l~~~i~~lp~gl~t~i~~~g~~LSgGq~QRi~iARal~~  171 (255)
T d2hyda1          92 NQIGLVQQDNILFSDTVKENILLGRPTATDEEVVEAAKMANAHDFIMNLPQGYDTEVGERGVKLSGGQKQRLSIARIFLN  171 (255)
T ss_dssp             HTEEEECSSCCCCSSBHHHHHGGGCSSCCHHHHHHHHHHTTCHHHHHTSTTGGGCBCCGGGTTSCHHHHHHHHHHHHHHH
T ss_pred             HEEEEEECCCCCCCCCHHHHHHCCCCCCCHHHHHHHHHHHCCHHHHHHCCCCCCCHHCCCCCCCCHHHHHHHHHHHHHHC
T ss_conf             41456510156899879999851586799999999999969799997362420103338889849999999999999855


Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCHHHCCCCEEEEEECCEEEEECCHHHHHCCCCHHHHHHH
Q ss_conf             99889995788899999799999999977499379997249100112498999959889782492378403980699999
Q 000481         1370 RNRILVLDEANASIDSATDAILQRIIRQEFSNCTVITVAHRVPTVIDSDMVMVLSYGKLLEYDEPSKLMETNSSFSKLVA 1449 (1467)
Q Consensus      1370 ~~~ILiLDEaTs~lD~~Td~~Iq~~ir~~f~~~TvI~IAHRl~ti~~~DrIlVld~G~i~E~g~p~~Ll~~~~~f~~l~~ 1449 (1467)
                      +|+|||||||||++|++|+..|.+.|++..+++|+|+|+||++++..||||+||++|+|+|.|+|++|+++++.|++|++
T Consensus       172 ~p~ililDEpts~LD~~t~~~i~~~l~~l~~~~TvI~itH~~~~~~~~D~ii~l~~G~iv~~G~~~eLl~~~~~y~~l~~  251 (255)
T d2hyda1         172 NPPILILDEATSALDLESESIIQEALDVLSKDRTTLIVAHRLSTITHADKIVVIENGHIVETGTHRELIAKQGAYEHLYS  251 (255)
T ss_dssp             CCSEEEEESTTTTCCHHHHHHHHHHHHHHTTTSEEEEECSSGGGTTTCSEEEEEETTEEEEEECHHHHHHTTSHHHHHHT
T ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHCCEEEEEECCEEEEECCHHHHHHCCCHHHHHHH
T ss_conf             99899983765447977999999999987538889999689999985999999989999998899999868849999999



>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3b60a2 f.37.1.1 (A:10-328) Multidrug resistance ABC transporter MsbA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3b60a2 f.37.1.1 (A:10-328) Multidrug resistance ABC transporter MsbA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hyda2 f.37.1.1 (A:1-323) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2hyda2 f.37.1.1 (A:1-323) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure