Citrus Sinensis ID: 000499


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------1450------1460
MAAVAHADSKRKYSWWWDSHISPKNSKWLQENLTDMDVKVKQMIKLIEEDADSFARRAEMYYKKRPELMKLVEEFYRAYRALAERYDHATGALRQAHRTMAEAFPNQVPFALGDDSPAGTEADPRTPELAPARAIFYPDELQNDSLGLSSSHLLALKKNGAFTDDSDTVTSRRGLKQLNDFLGSGEKVTHGKFGEGRARKGLNFHDAEENEQLQHNESYDIKARVPSESERMGKAEMEILTLKNALAKLEAEKEAGLLQYRQSLERLSNLESEVSHAREDSKGLSEQASIAEAEVQTLKEALARLETEREANIRQYQQCLDKLSNMEKNISRAEADAVELSDRASKAEIEAQTLKLDLARIEAEKEAAVVKYEECSRMISALEDKLLHSEEDSKRINKVADKAESEVERLKQALGKLTEEKEALALQYQQCLEAISILEHKLARAEEEAQRLHSELDNGFAKLKGAEEKCLLLERSNQTLHSELESMVQKMGSQSQELTEKQKELGRLWTCIQEERLRFVEAETAFQTLQHLHSQSQDELRSLAAELQNRAQILKDMGTRNQSLQEEVEKVKEENKGLNELNLSSAESIKNLQDEILSLRETIGKLEAEVELRVDQRNALQQEIYCLKEELNELNKKHQAMVEQVESVSLNPENFGLSVKELQDENSKLKEVYERDRCEKVALLEKLEIMEKLLEKNAVLENSLSDLNVELEGVRDKVKALEEVCQNLLAEKSTLVAEKNSLFSQLQDVNENLKKLSDENNFLVNSLFDANAEVEGLRAKSKSLEDSCLLLDNEKSCLITERVNLVSQLDIARKGLKDLEKSYAELEGRYLGLEEEKESTLQKVEELQFSLDAEKQQHASFVQLSETRLAGMESQISFLQEEGLCRKKAYEEELDKALDAQIEIFITQKYIQDLKEKNFSLLFECQKLLQESSLSEKLIHKLENENCEQQEEMRSLVDQIKVLRVQLYQLLEILEIDADHGCETKMEQDQSHQTLLDQVTGKLKEMQISVLKALEQNHQVVIENSILVALLGQLKLEAENLATERNALAEEFRIQSEQFVVLQREFPKLTEINEELRVEVAERNHTEEVLKTEMRSLHMLLSELQGAQQSLQDQNCKVLDEKKSLMKKVLDLQEEKHSLEEENCVMFVETISQSNLSHIFKDVISEKLVKIADLSENLDKLGCINNELEEKVRLKDGKLEDVQMQNSLLKQSLEKSENELVAIGCVRDQLNCEIANGKDLLSRKEKELFVAEQILCSLQNERTELHMKVEDLTCKYDEAKIIQEDQGKQIRKLTEDYDCQIKETRCIHELNMKLEAELGKLLEELEGTRYREESLYHELEKERKHAGLWETQATELFSELQISSVCEVLRNEKAHELSRACENLEDRSNSNDIEINQLKEKANALECENGGLKAHLAASIPAVISLKDSIRSLENHTLLHKADNDEVKVMSIVQVPISYY
ccccccccccccccHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHccccccHHccHHccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccHHHHcccccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
ccHHccccccccccEHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEEEcc
maavahadskrkyswwwdshispknskWLQENLTDMDVKVKQMIKLIEEDADSFARRAEMYYKKRPELMKLVEEFYRAYRALAERYDHATGALRQAHRTMAeafpnqvpfalgddspagteadprtpelaparaifypdelqndslglssSHLLALkkngaftddsdtvtsRRGLKQLNDflgsgekvthgkfgegrarkglnfhdaeeneqlqhnesydikarvpsesermgKAEMEILTLKNALAKLEAEKEAGLLQYRQSLERLsnlesevsharedskglseQASIAEAEVQTLKEALARLETEREANIRQYQQCLDKLSNMEKNISRAEADAVELSDRASKAEIEAQTLKLDLARIEAEKEAAVVKYEECSRMISALEDKLLHSEEDSKRINKVADKAESEVERLKQALGKLTEEKEALALQYQQCLEAISILEHKLARAEEEAQRLHSELDNGFAKLKGAEEKCLLLERSNQTLHSELESMVQKMGSQSQELTEKQKELGRLWTCIQEERLRFVEAETAFQTLQHLHSQSQDELRSLAAELQNRAQILKDMGTRNQSLQEEVEKVKEENkglnelnlSSAESIKNLQDEILSLRETIGKLEAEVELRVDQRNALQQEIYCLKEELNELNKKHQAMVEQVESvslnpenfglSVKELQDENSKLKEVYERDRCEKVALLEKLEIMEKLLEKNAVLENSLSDLNVELEGVRDKVKALEEVCQNLLAEKSTLVAEKNSLFSQLQDVNENLKKLSDENNFLVNSLFDANAEVEGLRAKSKSLEDSCLLLDNEKSCLITERVNLVSQLDIARKGLKDLEKSYAELEGRYLGLEEEKESTLQKVEELQFSLDAEKQQHASFVQLSETRLAGMESQISFLQEEGLCRKKAYEEELDKALDAQIEIFITQKYIQDLKEKNFSLLFECQKLLQESSLSEKLIHKLENENCEQQEEMRSLVDQIKVLRVQLYQLLEILEIdadhgcetkmeqDQSHQTLLDQVTGKLKEMQISVLKALEQNHQVVIENSILVALLGQLKLEAENLATERNALAEEFRIQSEQFVVLQREFPKLTEINEELRVEVAERNHTEEVLKTEMRSLHMLLSELQGAQQSLQDQNCKVLDEKKSLMKKVLDLQEEKHSLEEENCVMFVETISQSNLSHIFKDVISEKLVKIADLSENldklgcinneleekvrlkdgkleDVQMQNSLLKQSLEKSENELVAIGCVRDqlnceiangkdLLSRKEKELFVAEQILCSLQNERTELHMKVEDLTCKYDEAKIIQEDQGKQIRKLTEDYDCQIKETRCIHELNMKLEAELGKLLEELEGTRYREESLYHELEKERKHAGLWETQATELFSELQISSVCEVLRNEKAHELSRACENledrsnsndIEINQLKEKANALECENGGLKAHLAASIPAVISLKDSIRSLenhtllhkadndevKVMSIVQVPISYY
maavahadskrkyswwwdshispknskwlQENLTDMDVKVKQMIKLIEEDADSFARRAEMyykkrpelMKLVEEFYRAYRALAERYDHATGALRQAHRTMAEAFPNQVPFALGDDSPAGTEADPRTPELAPARAIFYPDELQNDSLGLSSSHLLALKKNGaftddsdtvtsrRGLKqlndflgsgekvthgkfgegraRKGLNFHDAEeneqlqhnesydikarvpSESERMGKAEMEILTLKNALAKLEAEKEAGLLQYRQSLERLSNLESEVSharedskglseqasIAEAEVQTLKEALARLETEREANIRQYQQCLDKLSNMEKNISRAEADAVELSDRASKAEIEAQTLKLDLARIEAEKEAAVVKYEECSRMISALEdkllhseedskRINKVADKAESEVERLKQALGKLTEEKEALALQYQQCLEAISILEHKLARAEEEAQRLHSELDNGFAKLKGAEEKCLLLERSNQTLHSELESMVQKMGSQSQELTEKQKELGRLWTCIQEERLRFVEAETAFQTLQHLHSQSQDELRSLAAELQNRAQILKDMGTRNQSLQEEVEKVKeenkglnelnlssaesIKNLQDEILSLRETIGKLEAEVELRVDQRNALQQEIYCLKEELNELNKKHQAMVEQVESVSLNPENFGLSVKELQDEnsklkevyerdrcEKVALLEKLEIMEKLLEKNAVLENSLSDLNVELEGVRDKVKALEEVCQNLLAEKSTLVAEKNSLFSQLQDVNENLKKLSDENNFLVNSLFDANAEVEGLRAKSKSLEDSCLLLDNEKSCLITERVNLVSQLDIARKGLKDLEKSYAELEGRYLGLEEEKESTLQKVEELQFSLDAEKQQHASFVQLSETRLAGMESQISFLQEEGLCRKKAYEEELDKALDAQIEIFITQKYIQDLKEKNFSLLFECQKLLQESSLSEKLIHKLENENCEQQEEMRSLVDQIKVLRVQLYQLLEILEIDADHGCETKMEQDQSHQTLLDQVTGKLKEMQISVLKALEQNHQVVIENSILVALLGQLKLEAENLATERNALAEEFRIQSEQFVVLQREFPKLTEINEELrvevaernhteEVLKTEMRSLHMLLSELQGAQQSLQDQNCKVLDEKKSLMKKVLDLQEEKHSLEEENCVMFVETISQSNLSHIFKDVISEKLVKIADLSENLDKLGCINNELeekvrlkdgkleDVQMQNSLLKQSLEKSENELVAIGCVRDQLNCEIANGKDLLSRKEKELFVAEQILCSlqnertelHMKVEDLTCKYDeakiiqedqgkqirKLTEDYDCQIKETRCIHELNMKLEAELGKLLEELEGTRYREESLYHELEKERKHAGLWETQATELFSELQISSVCEVLRNEKAHELSRAcenledrsnsnDIEINQLKEKANALECENGGLKAHLAASIPAVISLKDSIRSLENHtllhkadndevkvmSIVQVPISYY
MAAVAHADSKRKYSWWWDSHISPKNSKWLQENLTDMDVKVKQMIKLIEEDADSFARRAEMYYKKRPELMKLVEEFYRAYRALAERYDHATGALRQAHRTMAEAFPNQVPFALGDDSPAGTEADPRTPELAPARAIFYPDELQNDslglssshllalKKNGAFTDDSDTVTSRRGLKQLNDFLGSGEKVTHGKFGEGRARKGLNFHDAEENEQLQHNESYDIKARVPSESERMGKAEMEIltlknalakleaekeagllQYRQSLERLSNLESEVSHAREDSKGLSEQASIAEAEVQtlkealarletereaNIRQYQQCLDKLSNMEKNISRAEADAVELSDRASKAEIEAQTLKLDLARIeaekeaavvkyeeCSRMISALEDKLLHSEEDSKRINKVADKAESEVERLKQALGKLTEEKEALALQYQQCLEAISILEHKLARAEEEAQRLHSELDNGFAKLKGAEEKCLLLERSNQTLHSELESMVQKMGSQSQELTEKQKELGRLWTCIQEERLRFVEAETAFQTLQHLHSQSQDELRSLAAELQNRAQILKDMGTRNQSLQeevekvkeenkglnelnlSSAESIKNLQDEILSLRETIGKLEAEVELRVDQRNALQQEIYCLKEELNELNKKHQAMVEQVESVSLNPENFGLSVKELQDENSKLKEVYERDRCEKVAllekleimekllekNAVLENSLSDLNVELEGVRDKVKALEEVCQNLLAEKSTLVAEKNSLFSQLQDVNENLKKLSDENNFLVNSLFDANAEVEGLRAKSKSLEDSCLLLDNEKSCLITERVNLVSQLDIARKGLKDLEKSYAelegrylgleeekeSTLQKVEELQFSLDAEKQQHASFVQLSETRLAGMESQISFLQEEGLCRKKAYEEELDKALDAQIEIFITQKYIQDLKEKNFSLLFECqkllqesslseklIHKLENENCEQQEEMRSLVDQIKVLRVQLYQLLEILEIDADHGCETKMEQDQSHQTLLDQVTGKLKEMQISVLKALEQNHQVVIENSILVALLGQLKLEAENLATERNALAEEFRIQSEQFVVLQREFPKLTEINEELRVEVAERNHTEEVLKTEMRSLHMLLSELQGAQQSLQDQNCKVLDEKKSLMKKVLDLQEEKHSLEEENCVMFVETISQSNLSHIFKDVISEKLVKIADLSENLDKLGCINNELEEKVRLKDGKLEDVQMQNSLLKQSLEKSENELVAIGCVRDQLNCEIANGKDLLSRKEKELFVAEQILCSLQNERTELHMKVEDLTCKYDEAKIIQEDQGKQIRKLTEDYDCQIKETRCIHELNMkleaelgklleelegTRYREESLYHELEKERKHAGLWETQATELFSELQISSVCEVLRNEKAHELSRACENLEDRSNSNDIEINQLKEKANALECENGGLKAHLAASIPAVISLKDSIRSLENHTLLHKADNDEVKVMSIVQVPISYY
***********KYSWWWDSHISPKNSKWLQENLTDMDVKVKQMIKLIEEDADSFARRAEMYYKKRPELMKLVEEFYRAYRALAERYDHATGALRQAH*************************************IFY************************************************************************************************************************************************************************************************************************LKLDLARIEAEKEAAVVKYEECSRMIS*****************************************EALALQYQQCLEAISILEHKLA**************************CLL********************************LGRLWTCIQEERLRFVEAETAFQTLQ*****************************************************************ILSLRETIGKLEAEVELRVDQRNALQQEIYCLKEELN***************************************VYERDRCEKVALLEKLEIMEKLLEKNAVLENSLSDLNVELEGVRDKVKALEEVCQNLLAEKSTLVAEKNSLFSQLQDV*********ENNFLVNSLFDANAEVEGLR*****LEDSCLLLDNEKSCLITERVNLVSQLDIARKGLKDLEKSYAELEGRYLG******************************************QISFLQEEGLCRKKAYEEELDKALDAQIEIFITQKYIQDLKEKNFSLLFECQKLLQE******LI***************SLVDQIKVLRVQLYQLLEILEIDADHGCE***********LLDQVTGKLKEMQISVLKALEQNHQVVIENSILVALLGQLKLEAENLATERNALAEEFRIQSEQFVVLQREFPKLTEINEELRVEV*************************************************************ENCVMFVETISQSNLSHIFKDVISEKLVKIADLSENLDKLGCINNELEE****************************ELVAIGCVRDQLNCEIANGKDLLSRKEKELFVAEQILCSLQNERTELHMKVEDLTCKYDEAKIIQEDQGKQIRKLTEDYDCQIKETRCIHELNMKLEAELGKLLEELEGTRYREESLYHELEKERKHAGLWETQATELFSELQISSVCEVLRN********************************ALECENGGLKAHLAASIPAVISLKDSIRSLENHTLLHKADNDEVKVMSIVQVP****
**************WWWDSHIS**********************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************
************YSWWWDSHISPKNSKWLQENLTDMDVKVKQMIKLIEEDADSFARRAEMYYKKRPELMKLVEEFYRAYRALAERYDHATGALRQAHRTMAEAFPNQVPFALGDDS*********TPELAPARAIFYPDELQNDSLGLSSSHLLALKKNGAFTDDSDTVTSRRGLKQLNDFLGSGEKVTHGKFGEGRARKGLNFHDAEENEQLQHNESYDIKARVPSESERMGKAEMEILTLKNALAKLEAEKEAGLLQYRQSLERLS********************SIAEAEVQTLKEALARLETEREANIRQYQQCLDKLSNMEKNISRAEADAVELSDRASKAEIEAQTLKLDLARIEAEKEAAVVKYEECSRMISALEDKLLHSEEDSKRINKVADKAESEVERLKQALGKLTEEKEALALQYQQCLEAISILEHKLARAEEEAQRLHSELDNGFAKLKGAEEKCLLLERSNQTLHSEL******************KELGRLWTCIQEERLRFVEAETAFQTLQ*********LRSLAAELQNRAQILKDMGTRNQSLQEEVEKVKEENKGLNELNLSSAESIKNLQDEILSLRETIGKLEAEVELRVDQRNALQQEIYCLKEELNELNKKHQAMVEQVESVSLNPENFGLSVKELQDENSKLKEVYERDRCEKVALLEKLEIMEKLLEKNAVLENSLSDLNVELEGVRDKVKALEEVCQNLLAEKSTLVAEKNSLFSQLQDVNENLKKLSDENNFLVNSLFDANAEVEGLRAKSKSLEDSCLLLDNEKSCLITERVNLVSQLDIARKGLKDLEKSYAELEGRYLGLEEEKESTLQKVEELQFSLDAEKQQHASFVQLSETRLAGMESQISFLQEEGLCRKKAYEEELDKALDAQIEIFITQKYIQDLKEKNFSLLFECQKLLQESSLSEKLIHKLENENCEQQEEMRSLVDQIKVLRVQLYQLLEILEIDADHGCE**********TLLDQVTGKLKEMQISVLKALEQNHQVVIENSILVALLGQLKLEAENLATERNALAEEFRIQSEQFVVLQREFPKLTEINEELRVEVAERNHTEEVLKTEMRSLHMLLSELQGAQQSLQDQNCKVLDEKKSLMKKVLDLQEEKHSLEEENCVMFVETISQSNLSHIFKDVISEKLVKIADLSENLDKLGCINNELEEKVRLKDGKLEDVQMQNSLLKQSLEKSENELVAIGCVRDQLNCEIANGKDLLSRKEKELFVAEQILCSLQNERTELHMKVEDLTCKYDEAKIIQEDQGKQIRKLTEDYDCQIKETRCIHELNMKLEAELGKLLEELEGTRYREESLYHELEKERKHAGLWETQATELFSELQISSVCEVLRNEKAHELSRACENLEDRSNSNDIEINQLKEKANALECENGGLKAHLAASIPAVISLKDSIRSLENHTLLHKADNDEVKVMSIVQVPISYY
************YSWWWDSHISPKNSKWLQENLTDMDVKVKQMIKLIEEDADSFARRAEMYYKKRPELMKLVEEFYRAYRALAERYDHATGALRQAHRTMAEAFPNQVP****************************************************************GLKQLNDFLGSGEKVTHGKFGEGRARKGLNFHDAEENEQLQHNESYDIKARVPSESERMGKAEMEILTLKNALAKLEAEKEAGLLQYRQSLERLSNLESEVSHAREDSKGLSEQASIAEAEVQTLKEALARLETEREANIRQYQQCLDKLSNMEKNISRAEADAVELSDRASKAEIEAQTLKLDLARIEAEKEAAVVKYEECSRMISALEDKLLHSEEDSKRINKVADKAESEVERLKQALGKLTEEKEALALQYQQCLEAISILEHKLARAEEEAQRLHSELDNGFAKLKGAEEKCLLLERSNQTLHSELESMVQKMGSQSQELTEKQKELGRLWTCIQEERLRFVEAETAFQTLQHLHSQSQDELRSLAAELQNRAQILKDMGTRNQSLQEEVEKVKEENKGLNELNLSSAESIKNLQDEILSLRETIGKLEAEVELRVDQRNALQQEIYCLKEELNELNKKHQAMVEQVESVSLNPENFGLSVKELQDENSKLKEVYERDRCEKVALLEKLEIMEKLLEKNAVLENSLSDLNVELEGVRDKVKALEEVCQNLLAEKSTLVAEKNSLFSQLQDVNENLKKLSDENNFLVNSLFDANAEVEGLRAKSKSLEDSCLLLDNEKSCLITERVNLVSQLDIARKGLKDLEKSYAELEGRYLGLEEEKESTLQKVEELQFSLDAEKQQHASFVQLSETRLAGMESQISFLQEEGLCRKKAYEEELDKALDAQIEIFITQKYIQDLKEKNFSLLFECQKLLQESSLSEKLIHKLENENCEQQEEMRSLVDQIKVLRVQLYQLLEILEIDADHGCETKMEQDQSHQTLLDQVTGKLKEMQISVLKALEQNHQVVIENSILVALLGQLKLEAENLATERNALAEEFRIQSEQFVVLQREFPKLTEINEELRVEVAERNHTEEVLKTEMRSLHMLLSELQGAQQSLQDQNCKVLDEKKSLMKKVLDLQEEKHSLEEENCVMFVETISQSNLSHIFKDVISEKLVKIADLSENLDKLGCINNELEEKVRLKDGKLEDVQMQNSLLKQSLEKSENELVAIGCVRDQLNCEIANGKDLLSRKEKELFVAEQILCSLQNERTELHMKVEDLTCKYDEAKIIQEDQGKQIRKLTEDYDCQIKETRCIHELNMKLEAELGKLLEELEGTRYREESLYHELEKERKHAGLWETQATELFSELQISSVCEVLRNEKAHELSRACENLEDRSNSNDIEINQLKEKANALECENGGLKAHLAASIPAVISLKDSIRSLENHTLLHKADNDEVKVMSIVQVPISYY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAVAHADSKRKYSWWWDSHISPKNSKWLQENLTDMDVKVKQMIKLIEEDADSFARRAEMYYKKRPELMKLVEEFYRAYRALAERYDHATGALRQAHRTMAEAFPNQVPFALGDDSPAGTEADPRTPELAPARAIFYPDELQNDSLGLSSSHLLALKKNGAFTDDSDTVTSRRGLKQLNDFLGSGEKVTHGKFGEGRARKGLNFHDAEENEQLQHNESYDIKARVPSESERxxxxxxxxxxxxxxxxxxxxxKEAGLLQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYEECSRMISALEDKLLHSEEDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLKGAEEKCLLLERSNQTLHSELESMVQKMGSQSQELTEKQKELGRLWTCIQEERLRFVEAETAFQTLQHLHSQSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNLSSAESxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPENFGLSxxxxxxxxxxxxxxxxxxxxxKVALLEKLEIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLFDANAEVEGLRAKSKSLEDSCLLLDNEKSCLITERVNLVSQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVEELQFSLDAEKQQHASFxxxxxxxxxxxxxxxxxxxxxGLCRKKAYEEELDKALDAQIEIFITQKYIQDLKEKNFSLLFExxxxxxxxxxxxxxxxxxxxxNCEQQEEMRSLVDQIKVLRVQLYQLLEILEIDADHGCETKMEQDQSHQTLLDQVTGKLKEMQISVLKALEQNHQVVIENSILVALxxxxxxxxxxxxxxxxxxxxxFRIQSEQFVVLQREFPKLTEINEELRVEVAERNHTEEVLKTEMRSLHMLLSELQGAQQSLQDQNCKVLDExxxxxxxxxxxxxxxxxxxxxNCVMFVETISQSNLSHIFKDVISEKLVKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLVAIGCVxxxxxxxxxxxxxxxxxxxxxLFVAEQILCSLQNERTELHMKVEDLTCKYDEAKIIQEDQGKQIRKLTEDYDCQIKETRCIHELxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRKHAGLWETQATELFSELQISSVCEVLRNEKAHELSRAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLAASIPAVISLKDSIRSLENHTLLHKADNDEVKVMSIVQVPISYY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1460
359479667 1823 PREDICTED: uncharacterized protein LOC10 0.982 0.786 0.631 0.0
147802454 1837 hypothetical protein VITISV_039693 [Viti 0.955 0.759 0.607 0.0
255567514 1938 ATP binding protein, putative [Ricinus c 0.883 0.665 0.618 0.0
356503558 1830 PREDICTED: uncharacterized protein LOC10 0.976 0.779 0.574 0.0
356570592 1773 PREDICTED: uncharacterized protein LOC10 0.95 0.782 0.561 0.0
357440635 1796 Centromere protein [Medicago truncatula] 0.975 0.792 0.547 0.0
356502801 1907 PREDICTED: uncharacterized protein LOC10 0.931 0.713 0.566 0.0
186478086 1733 kinase interacting (KIP1-like) protein [ 0.965 0.813 0.531 0.0
4587570 1744 Strong similarity to gi|2244833 centrome 0.975 0.816 0.529 0.0
297848532 1736 kinase interacting family protein [Arabi 0.968 0.814 0.530 0.0
>gi|359479667|ref|XP_003632326.1| PREDICTED: uncharacterized protein LOC100852899 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1693 bits (4384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 922/1461 (63%), Positives = 1135/1461 (77%), Gaps = 27/1461 (1%)

Query: 1    MAAVAHADSKRKYSWWWDSHISPKNSKWLQENLTDMDVKVKQMIKLIEEDADSFARRAEM 60
            MA+++H DS+RKYSWWWDSHISPKNSKWLQENLTDMD KVKQMIKLIEEDADSFARRAEM
Sbjct: 1    MASLSHPDSRRKYSWWWDSHISPKNSKWLQENLTDMDAKVKQMIKLIEEDADSFARRAEM 60

Query: 61   YYKKRPELMKLVEEFYRAYRALAERYDHATGALRQAHRTMAEAFPNQVPFALGDDSPAGT 120
            YYKKRPELMKLVEEFYRAYRALAERYDHATGALRQA RTMAEAFPNQVPF L DDSPAG+
Sbjct: 61   YYKKRPELMKLVEEFYRAYRALAERYDHATGALRQAQRTMAEAFPNQVPF-LTDDSPAGS 119

Query: 121  --EADPRTPELAPA-RAIFYPDELQNDSLGLSSSHLLALKKNGAFTDDSDTVTSRRGLKQ 177
              EA+P TPE+ PA RA F PDELQ D+LGLSSSH  A+K+NGAFT++ D+V+S++GLKQ
Sbjct: 120  SAEAEPHTPEMPPAVRAFFEPDELQKDALGLSSSHFHAVKRNGAFTEEPDSVSSKKGLKQ 179

Query: 178  LNDFLGSGEKVTHGKFGEGRARKGLNFHDAEENEQ-LQHNESYDIKARVPSESERMGKAE 236
            LND  GSG+     KF EGRARKGLNFHDA+E E+ +Q+ +S+                 
Sbjct: 180  LNDLFGSGDAPNIAKFAEGRARKGLNFHDADEKERNVQNTDSH---------------TA 224

Query: 237  MEILTLKNALAKLEAEKEAGLLQYRQSLERLSNLESEVSHAREDSKGLSEQASIAEAEVQ 296
             EIL LK +LA+LEAEKEAG +Q++QSLERLSNLE+EVS A+EDSKGL+E+A  AE EVQ
Sbjct: 225  TEILALKESLARLEAEKEAGRVQHQQSLERLSNLEAEVSRAQEDSKGLNERAGKAENEVQ 284

Query: 297  TLKEALARLETEREANIRQYQQCLDKLSNMEKNISRAEADAVELSDRASKAEIEAQTLKL 356
            TLKEAL +LE ERE ++ QYQQCL+++S++E+ IS ++ DA +L++RASK+E+EA  LK 
Sbjct: 285  TLKEALTKLEAERETSLLQYQQCLERISDLERTISHSQEDAGKLNERASKSEVEAAALKQ 344

Query: 357  DLARIEAEKEAAVVKYEECSRMISALEDKLLHSEEDSKRINKVADKAESEVERLKQALGK 416
            DLAR+E+EKE A+++Y++C   IS LE KL+ +E+DS+RIN+ A+KAE EVE LKQA+  
Sbjct: 345  DLARVESEKEGALLQYKQCLEKISDLESKLVQAEDDSRRINERAEKAEREVETLKQAVAS 404

Query: 417  LTEEKEALALQYQQCLEAISILEHKLARAEEEAQRLHSELDNGFAKLKGAEEKCLLLERS 476
            LTEEKEA A QYQQCLE I+ LE K++ AEEEAQRL+ E+DNG AKLKGAEE+CLLLER+
Sbjct: 405  LTEEKEAAARQYQQCLETIASLELKISCAEEEAQRLNGEIDNGVAKLKGAEEQCLLLERT 464

Query: 477  NQTLHSELESMVQKMGSQSQELTEKQKELGRLWTCIQEERLRFVEAETAFQTLQHLHSQS 536
            N +L  ELES+ QK+G+Q +ELTEKQKELGRLWT IQEERLRF+EAET FQ+LQHLHSQS
Sbjct: 465  NHSLQFELESLAQKLGAQCEELTEKQKELGRLWTSIQEERLRFMEAETTFQSLQHLHSQS 524

Query: 537  QDELRSLAAELQNRAQILKDMGTRNQSLQEEVEKVKEENKGLNELNLSSAESIKNLQDEI 596
            Q+ELRSLA ELQ++ QILKDM T NQ LQ+EV KVKEEN+GLNE NLSSA SIKN+QDEI
Sbjct: 525  QEELRSLATELQSKGQILKDMETHNQGLQDEVHKVKEENRGLNEFNLSSAVSIKNMQDEI 584

Query: 597  LSLRETIGKLEAEVELRVDQRNALQQEIYCLKEELNELNKKHQAMVEQVESVSLNPENFG 656
            LSLRETI KLE EVELRVDQRNALQQEIYCLKEELN+LNK ++AM++QVE V L PE FG
Sbjct: 585  LSLRETITKLEMEVELRVDQRNALQQEIYCLKEELNDLNKNYRAMLDQVEGVGLKPECFG 644

Query: 657  LSVKELQDENSKLKEVYERDRCEKVALLEKLEIMEKLLEKNAVLENSLSDLNVELEGVRD 716
            LSVKELQ+ENS LKE+ +R + E VALLEKLEIMEKLLEKNA+LENSLSDL+ ELEG+R+
Sbjct: 645  LSVKELQEENSNLKEICQRGKSENVALLEKLEIMEKLLEKNALLENSLSDLSAELEGLRE 704

Query: 717  KVKALEEVCQNLLAEKSTLVAEKNSLFSQLQDVNENLKKLSDENNFLVNSLFDANAEVEG 776
            KVKALEE  Q+LL EKS LVAE  +L S LQ    +L+KLS++N  + NSL DANAE+EG
Sbjct: 705  KVKALEESYQSLLGEKSILVAENATLTSHLQTKTNHLEKLSEKNMLMENSLSDANAELEG 764

Query: 777  LRAKSKSLEDSCLLLDNEKSCLITERVNLVSQLDIARKGLKDLEKSYAELEGRYLGLEEE 836
            LR +SK LEDSC LLDNEKS LI+ER  L+SQL+  ++ L+DLE+ Y ELE +Y GLE+E
Sbjct: 765  LRTRSKGLEDSCQLLDNEKSGLISERETLISQLEATQQRLEDLERRYTELEEKYFGLEKE 824

Query: 837  KESTLQKVEELQFSLDAEKQQHASFVQLSETRLAGMESQISFLQEEGLCRKKAYEEELDK 896
            KESTL KVEELQ SL+AEK + A+F QLSETRLAGM+S+I  LQ EG CRK+ +EEE +K
Sbjct: 825  KESTLCKVEELQVSLEAEKLEQANFAQLSETRLAGMKSEIHLLQVEGRCRKEEFEEEQNK 884

Query: 897  ALDAQIEIFITQKYIQDLKEKNFSLLFECQKLLQESSLSEKLIHKLENENCEQQEEMRSL 956
             +++QIEIFI QK +Q+L  KNFSLL ECQKL + S LSEKLI +LE+EN EQQ ++ SL
Sbjct: 885  VVNSQIEIFIFQKCVQELAAKNFSLLTECQKLSEVSKLSEKLISELEHENLEQQVQVNSL 944

Query: 957  VDQIKVLRVQLYQLLEILEIDADHGCETKMEQDQSHQTLLDQVTGKLKEMQISVLKALEQ 1016
            VDQ+K+LR  +Y +   L+IDA+H  E K++QD   QT+L+ +  +L+  + S+ K  ++
Sbjct: 945  VDQVKMLRTGMYHVSRALDIDAEHRAEDKIDQD---QTVLNAIICQLENTKSSLCKTQDE 1001

Query: 1017 NHQVVIENSILVALLGQLKLEAENLATERNALAEEFRIQSEQFVVLQREFPKLTEINEEL 1076
            N Q +++  +LV +L QL LEA  LATERN L EE RI+SEQF  LQ E  +L E++E+L
Sbjct: 1002 NQQSIVQKLVLVTVLEQLGLEATQLATERNTLDEECRIRSEQFSSLQSETHQLLEVSEKL 1061

Query: 1077 RVEVAERNHTEEVLKTEMRSLHMLLSELQGAQQSLQDQNCKVLDEKKSLMKKVLDLQEEK 1136
            R++V E +H EEVL  E+  L   L ELQ A  +LQ +N  +L+EK SL KK L L+EEK
Sbjct: 1062 RLKVREGDHKEEVLTAEIGILQGKLLELQEAHGNLQKENSLILEEKGSLSKKFLSLEEEK 1121

Query: 1137 HSLEEENCVMFVETISQSNLSHIFKDVISEKLVKIADLSENLDKLGCINNELEEKVRLKD 1196
              LEEEN V+F ETIS SNLS IFKD I+EK V++ +L +NL++L  +N  LEEKVR  +
Sbjct: 1122 RILEEENWVVFGETISLSNLSLIFKDFITEKSVQLKELGQNLEELHNVNYALEEKVRTME 1181

Query: 1197 GKLEDVQMQNSLLKQSLEKSENELVAIGCVRDQLNCEIANGKDLLSRKEKELFVAEQILC 1256
            GKL  V+M+N  LK SLEKSENEL  +    DQLN EI NG+D+LSRKE EL  A Q L 
Sbjct: 1182 GKLGMVEMENFHLKDSLEKSENELNTVRSFADQLNHEIENGRDILSRKETELLEAGQKLS 1241

Query: 1257 SLQNERTELHMKVEDLTCKYDEAKIIQEDQGKQIRKLTEDYDCQIKETRCIHELNMKLEA 1316
            +LQ+E+ ELH  VE +  + DE K+I+EDQ KQI KL+E+ D Q K+  C+ E+N  LEA
Sbjct: 1242 ALQDEKAELHKTVEVVKSECDEVKVIREDQEKQILKLSEENDHQKKQNGCLREVNRGLEA 1301

Query: 1317 ELGKLLEELEGTRYREESLYHELEKERKHAGLWETQATELFSELQISSVCEVLRNEKAHE 1376
            +L KL EE+E  + REE+L H+L++ R    LWETQA   FSELQIS+V E    EK HE
Sbjct: 1302 KLWKLCEEIEEAKVREETLNHDLQRGRDEVELWETQAAAFFSELQISNVREAFFEEKVHE 1361

Query: 1377 LSRACENLEDRSNSNDIEINQLKEKANALECENGGLKAHLAASIPAVISLKDSIRSLEN- 1435
            L  AC++LE+ SNS   EI  LKE+ N LE ENGGLK  LAA  P +I L+DS+ +LEN 
Sbjct: 1362 LIEACKSLENISNSRSREIELLKERVNKLEGENGGLKTQLAAYTPTIICLRDSVAALENR 1421

Query: 1436 ---HTLLHKADNDEVKVMSIV 1453
               HT LH+AD  + K   +V
Sbjct: 1422 TLSHTNLHQADTKDKKDAKLV 1442




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147802454|emb|CAN70401.1| hypothetical protein VITISV_039693 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255567514|ref|XP_002524736.1| ATP binding protein, putative [Ricinus communis] gi|223535920|gb|EEF37579.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356503558|ref|XP_003520574.1| PREDICTED: uncharacterized protein LOC100810726 [Glycine max] Back     alignment and taxonomy information
>gi|356570592|ref|XP_003553469.1| PREDICTED: uncharacterized protein LOC100787384 [Glycine max] Back     alignment and taxonomy information
>gi|357440635|ref|XP_003590595.1| Centromere protein [Medicago truncatula] gi|355479643|gb|AES60846.1| Centromere protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356502801|ref|XP_003520204.1| PREDICTED: uncharacterized protein LOC100782563 [Glycine max] Back     alignment and taxonomy information
>gi|186478086|ref|NP_171807.2| kinase interacting (KIP1-like) protein [Arabidopsis thaliana] gi|332189405|gb|AEE27526.1| kinase interacting (KIP1-like) protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|4587570|gb|AAD25801.1|AC006550_9 Strong similarity to gi|2244833 centromere protein homolog from Arabidopsis thaliana chromosome 4 contig gb|Z97337. ESTs gb|T20765 and gb|AA586277 come from this gene [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297848532|ref|XP_002892147.1| kinase interacting family protein [Arabidopsis lyrata subsp. lyrata] gi|297337989|gb|EFH68406.1| kinase interacting family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms


Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
AT1G03080
unknown protein; FUNCTIONS IN- molecular_function unknown; INVOLVED IN- biological_process unknown; LOCATED IN- plasma membrane; EXPRESSED IN- 22 plant structures; EXPRESSED DURING- 13 growth stages; CONTAINS InterPro DOMAIN/s- Prefoldin (InterPro-IPR009053), KIP1-like (InterPro-IPR011684); BEST Arabidopsis thaliana protein match is- kinase interacting family protein (TAIR-AT3G22790.1); Has 169162 Blast hits to 69460 proteins in 2232 species- Archae - 2114; Bacteria - 24914; Metazoa - 82448; Fungi - 11850; Plants - 6375; Viruses - 760; Other Eukaryotes - 40701 (source- NCBI BLink). (1733 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
AT1G08030
unknown protein; unknown protein; FUNCTIONS IN- molecular_function unknown; INVOLVED IN- biolog [...] (327 aa)
       0.821
NTMC2T6.1
NTMC2T6.1; NTMC2T6.1; LOCATED IN- plasma membrane, vacuole; EXPRESSED IN- 23 plant structures; [...] (751 aa)
       0.534
SEC
SEC (secret agent); transferase, transferring glycosyl groups; Has O-linked N-acetyl glucosamin [...] (977 aa)
       0.460
ATHB-12
ATHB-12 (ARABIDOPSIS THALIANA HOMEOBOX 12); transcription activator/ transcription factor; Enco [...] (235 aa)
       0.436
LACS8
long-chain-fatty-acid--CoA ligase family protein / long-chain acyl-CoA synthetase family protei [...] (720 aa)
       0.419
HAB1
HAB1 (HOMOLOGY TO ABI1); catalytic/ protein serine/threonine phosphatase; mutant has ABA hypers [...] (511 aa)
       0.414
CHR11
CHR11 (CHROMATIN-REMODELING PROTEIN 11); ATP binding / DNA binding / DNA-dependent ATPase/ heli [...] (1055 aa)
       0.404

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1460
pfam0776574 pfam07765, KIP1, KIP1-like protein 2e-42
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-19
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-15
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-15
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-13
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-12
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-12
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 4e-12
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-11
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-11
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-11
PRK02224880 PRK02224, PRK02224, chromosome segregation protein 3e-11
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-11
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 7e-11
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 9e-11
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-10
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-10
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-10
PRK02224880 PRK02224, PRK02224, chromosome segregation protein 8e-10
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 4e-09
pfam121281198 pfam12128, DUF3584, Protein of unknown function (D 4e-09
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 7e-09
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 1e-08
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 2e-08
PRK048631486 PRK04863, mukB, cell division protein MukB; Provis 2e-08
TIGR006061311 TIGR00606, rad50, rad50 2e-08
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 4e-08
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 9e-08
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-07
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 2e-07
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 5e-07
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 8e-07
PRK03918880 PRK03918, PRK03918, chromosome segregation protein 9e-07
PRK03918880 PRK03918, PRK03918, chromosome segregation protein 1e-06
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 2e-06
TIGR026801353 TIGR02680, TIGR02680, TIGR02680 family protein 3e-06
PLN02939977 PLN02939, PLN02939, transferase, transferring glyc 5e-06
TIGR006061311 TIGR00606, rad50, rad50 6e-06
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 1e-05
COG4372499 COG4372, COG4372, Uncharacterized protein conserve 2e-05
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 4e-05
TIGR006181042 TIGR00618, sbcc, exonuclease SbcC 5e-05
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 1e-04
pfam05557722 pfam05557, MAD, Mitotic checkpoint protein 1e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-04
COG4372499 COG4372, COG4372, Uncharacterized protein conserve 2e-04
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 2e-04
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-04
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 3e-04
PLN02939977 PLN02939, PLN02939, transferase, transferring glyc 3e-04
TIGR04211198 TIGR04211, SH3_and_anchor, SH3 domain protein 3e-04
pfam07888546 pfam07888, CALCOCO1, Calcium binding and coiled-co 4e-04
PRK04778569 PRK04778, PRK04778, septation ring formation regul 4e-04
COG4942420 COG4942, COG4942, Membrane-bound metallopeptidase 4e-04
COG30961480 COG3096, MukB, Uncharacterized protein involved in 4e-04
pfam09787509 pfam09787, Golgin_A5, Golgin subfamily A member 5 5e-04
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 6e-04
COG4372499 COG4372, COG4372, Uncharacterized protein conserve 6e-04
PRK05771646 PRK05771, PRK05771, V-type ATP synthase subunit I; 7e-04
pfam06160559 pfam06160, EzrA, Septation ring formation regulato 8e-04
pfam01496707 pfam01496, V_ATPase_I, V-type ATPase 116kDa subuni 9e-04
COG4372499 COG4372, COG4372, Uncharacterized protein conserve 0.001
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.002
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 0.002
TIGR04211198 TIGR04211, SH3_and_anchor, SH3 domain protein 0.002
PRK05771646 PRK05771, PRK05771, V-type ATP synthase subunit I; 0.002
PRK109291109 PRK10929, PRK10929, putative mechanosensitive chan 0.002
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.003
TIGR026801353 TIGR02680, TIGR02680, TIGR02680 family protein 0.003
TIGR026801353 TIGR02680, TIGR02680, TIGR02680 family protein 0.003
pfam01576859 pfam01576, Myosin_tail_1, Myosin tail 0.003
TIGR03185650 TIGR03185, DNA_S_dndD, DNA sulfur modification pro 0.003
>gnl|CDD|116379 pfam07765, KIP1, KIP1-like protein Back     alignment and domain information
 Score =  149 bits (377), Expect = 2e-42
 Identities = 65/74 (87%), Positives = 71/74 (95%)

Query: 14 SWWWDSHISPKNSKWLQENLTDMDVKVKQMIKLIEEDADSFARRAEMYYKKRPELMKLVE 73
          SWWWDSHISPKNSKWL+ENL +MD KVK+M+KLIEEDADSFA+RAEMYYKKRPEL+ LVE
Sbjct: 1  SWWWDSHISPKNSKWLEENLQEMDSKVKEMLKLIEEDADSFAKRAEMYYKKRPELIALVE 60

Query: 74 EFYRAYRALAERYD 87
          EFYRAYRALAERYD
Sbjct: 61 EFYRAYRALAERYD 74


This is a family of sequences found exclusively in plants. They are similar to kinase interacting protein 1 (KIP1), which has been found to interact with the kinase domain of PRK1, a receptor-like kinase. This particular region contains two coiled-coils, which are described as motifs involved in protein-protein interactions. It has also been suggested that the protein's coiled- coils allow it to dimerise in vivo. Length = 74

>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional Back     alignment and domain information
>gnl|CDD|129694 TIGR00606, rad50, rad50 Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein Back     alignment and domain information
>gnl|CDD|215507 PLN02939, PLN02939, transferase, transferring glycosyl groups Back     alignment and domain information
>gnl|CDD|129694 TIGR00606, rad50, rad50 Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|218636 pfam05557, MAD, Mitotic checkpoint protein Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|215507 PLN02939, PLN02939, transferase, transferring glycosyl groups Back     alignment and domain information
>gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein Back     alignment and domain information
>gnl|CDD|116500 pfam07888, CALCOCO1, Calcium binding and coiled-coil domain (CALCOCO1) like Back     alignment and domain information
>gnl|CDD|179877 PRK04778, PRK04778, septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|225638 COG3096, MukB, Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|220402 pfam09787, Golgin_A5, Golgin subfamily A member 5 Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>gnl|CDD|235600 PRK05771, PRK05771, V-type ATP synthase subunit I; Validated Back     alignment and domain information
>gnl|CDD|114855 pfam06160, EzrA, Septation ring formation regulator, EzrA Back     alignment and domain information
>gnl|CDD|216531 pfam01496, V_ATPase_I, V-type ATPase 116kDa subunit family Back     alignment and domain information
>gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein Back     alignment and domain information
>gnl|CDD|235600 PRK05771, PRK05771, V-type ATP synthase subunit I; Validated Back     alignment and domain information
>gnl|CDD|236798 PRK10929, PRK10929, putative mechanosensitive channel protein; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein Back     alignment and domain information
>gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein Back     alignment and domain information
>gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail Back     alignment and domain information
>gnl|CDD|234141 TIGR03185, DNA_S_dndD, DNA sulfur modification protein DndD Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1460
PF0776574 KIP1: KIP1-like protein; InterPro: IPR011684 This 100.0
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 99.94
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 99.93
KOG01611930 consensus Myosin class II heavy chain [Cytoskeleto 99.92
KOG01611930 consensus Myosin class II heavy chain [Cytoskeleto 99.9
TIGR006061311 rad50 rad50. This family is based on the phylogeno 99.73
TIGR021681179 SMC_prok_B chromosome segregation protein SMC, com 99.72
TIGR021691164 SMC_prok_A chromosome segregation protein SMC, pri 99.7
TIGR021681179 SMC_prok_B chromosome segregation protein SMC, com 99.69
TIGR006061311 rad50 rad50. This family is based on the phylogeno 99.69
TIGR021691164 SMC_prok_A chromosome segregation protein SMC, pri 99.66
PRK02224880 chromosome segregation protein; Provisional 99.57
PRK02224880 chromosome segregation protein; Provisional 99.52
COG11961163 Smc Chromosome segregation ATPases [Cell division 99.48
PF10174775 Cast: RIM-binding protein of the cytomatrix active 99.45
PRK03918880 chromosome segregation protein; Provisional 99.39
COG11961163 Smc Chromosome segregation ATPases [Cell division 99.39
PRK03918880 chromosome segregation protein; Provisional 99.34
PF10174775 Cast: RIM-binding protein of the cytomatrix active 99.27
PF01576859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 99.05
PRK01156895 chromosome segregation protein; Provisional 98.9
KOG06121317 consensus Rho-associated, coiled-coil containing p 98.82
PF01576859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 98.81
PF121281201 DUF3584: Protein of unknown function (DUF3584); In 98.75
PF05701522 WEMBL: Weak chloroplast movement under blue light; 98.75
KOG46431195 consensus Uncharacterized coiled-coil protein [Fun 98.72
KOG09961293 consensus Structural maintenance of chromosome pro 98.68
PRK01156895 chromosome segregation protein; Provisional 98.66
KOG46431195 consensus Uncharacterized coiled-coil protein [Fun 98.65
KOG09961293 consensus Structural maintenance of chromosome pro 98.62
PF05483786 SCP-1: Synaptonemal complex protein 1 (SCP-1); Int 98.61
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 98.58
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 98.57
PF05701522 WEMBL: Weak chloroplast movement under blue light; 98.57
KOG09761265 consensus Rho/Rac1-interacting serine/threonine ki 98.57
KOG09331174 consensus Structural maintenance of chromosome pro 98.41
PF15070617 GOLGA2L5: Putative golgin subfamily A member 2-lik 98.39
PF05557722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 98.38
PRK048631486 mukB cell division protein MukB; Provisional 98.33
PF05557722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 98.31
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 98.2
KOG02501074 consensus DNA repair protein RAD18 (SMC family pro 98.15
PF121281201 DUF3584: Protein of unknown function (DUF3584); In 98.14
KOG06121317 consensus Rho-associated, coiled-coil containing p 98.12
PF05622713 HOOK: HOOK protein; InterPro: IPR008636 This famil 98.11
KOG02501074 consensus DNA repair protein RAD18 (SMC family pro 98.07
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 98.03
KOG0977546 consensus Nuclear envelope protein lamin, intermed 98.03
PF05911769 DUF869: Plant protein of unknown function (DUF869) 98.03
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 98.0
PF09730717 BicD: Microtubule-associated protein Bicaudal-D; I 97.97
PF00038312 Filament: Intermediate filament protein; InterPro: 97.97
PF00038312 Filament: Intermediate filament protein; InterPro: 97.95
COG0419908 SbcC ATPase involved in DNA repair [DNA replicatio 97.9
PRK04778569 septation ring formation regulator EzrA; Provision 97.84
PRK048631486 mukB cell division protein MukB; Provisional 97.83
KOG09711243 consensus Microtubule-associated protein dynactin 97.8
KOG09761265 consensus Rho/Rac1-interacting serine/threonine ki 97.78
PF05622713 HOOK: HOOK protein; InterPro: IPR008636 This famil 97.76
PRK04778569 septation ring formation regulator EzrA; Provision 97.75
KOG09711243 consensus Microtubule-associated protein dynactin 97.73
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.71
KOG4593716 consensus Mitotic checkpoint protein MAD1 [Cell cy 97.63
KOG09621294 consensus DNA repair protein RAD50, ABC-type ATPas 97.6
PF09787511 Golgin_A5: Golgin subfamily A member 5; InterPro: 97.59
KOG0963629 consensus Transcription factor/CCAAT displacement 97.58
PF05483786 SCP-1: Synaptonemal complex protein 1 (SCP-1); Int 97.56
KOG09331174 consensus Structural maintenance of chromosome pro 97.52
KOG0980980 consensus Actin-binding protein SLA2/Huntingtin-in 97.51
PF09730717 BicD: Microtubule-associated protein Bicaudal-D; I 97.51
COG0419908 SbcC ATPase involved in DNA repair [DNA replicatio 97.5
PHA02562562 46 endonuclease subunit; Provisional 97.44
KOG0977546 consensus Nuclear envelope protein lamin, intermed 97.22
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 97.16
PHA02562562 46 endonuclease subunit; Provisional 97.16
KOG09641200 consensus Structural maintenance of chromosome pro 97.05
PF05911769 DUF869: Plant protein of unknown function (DUF869) 96.99
PF14662193 CCDC155: Coiled-coil region of CCDC155 96.98
PF07111739 HCR: Alpha helical coiled-coil rod protein (HCR); 96.92
KOG4673961 consensus Transcription factor TMF, TATA element m 96.7
PF14662193 CCDC155: Coiled-coil region of CCDC155 96.67
PRK11637428 AmiB activator; Provisional 96.66
KOG0995581 consensus Centromere-associated protein HEC1 [Cell 96.63
KOG0962 1294 consensus DNA repair protein RAD50, ABC-type ATPas 96.62
KOG0946970 consensus ER-Golgi vesicle-tethering protein p115 96.61
KOG0946970 consensus ER-Golgi vesicle-tethering protein p115 96.56
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 96.45
PF15070617 GOLGA2L5: Putative golgin subfamily A member 2-lik 96.36
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 96.32
COG5185622 HEC1 Protein involved in chromosome segregation, i 96.1
KOG4593716 consensus Mitotic checkpoint protein MAD1 [Cell cy 96.08
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 96.07
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 96.04
PRK11637428 AmiB activator; Provisional 95.97
KOG1003205 consensus Actin filament-coating protein tropomyos 95.97
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 95.92
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 95.92
KOG0995581 consensus Centromere-associated protein HEC1 [Cell 95.89
PF09728309 Taxilin: Myosin-like coiled-coil protein; InterPro 95.73
PF09728309 Taxilin: Myosin-like coiled-coil protein; InterPro 95.65
PF13851201 GAS: Growth-arrest specific micro-tubule binding 95.39
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 95.38
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 95.26
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 95.25
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 95.25
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 95.13
PLN02939977 transferase, transferring glycosyl groups 95.09
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 95.05
COG4372499 Uncharacterized protein conserved in bacteria with 94.88
PLN02939977 transferase, transferring glycosyl groups 94.82
KOG0963629 consensus Transcription factor/CCAAT displacement 94.79
PRK112811113 hypothetical protein; Provisional 94.69
TIGR026801353 conserved hypothetical protein TIGR02680. Members 94.63
KOG10291118 consensus Endocytic adaptor protein intersectin [S 94.59
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 94.56
KOG0999772 consensus Microtubule-associated protein Bicaudal- 94.49
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 94.49
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 94.4
PF14915305 CCDC144C: CCDC144C protein coiled-coil region 94.39
KOG1003205 consensus Actin filament-coating protein tropomyos 94.26
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 94.13
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 94.11
PF13851201 GAS: Growth-arrest specific micro-tubule binding 93.97
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 93.47
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 93.18
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 93.08
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 93.02
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 92.94
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 92.88
KOG00181141 consensus Structural maintenance of chromosome pro 92.6
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 92.56
PRK09039343 hypothetical protein; Validated 92.43
COG4372499 Uncharacterized protein conserved in bacteria with 92.38
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 92.3
KOG00181141 consensus Structural maintenance of chromosome pro 92.2
PF07111739 HCR: Alpha helical coiled-coil rod protein (HCR); 92.07
PF10267395 Tmemb_cc2: Predicted transmembrane and coiled-coil 92.01
PF15397258 DUF4618: Domain of unknown function (DUF4618) 91.93
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 91.78
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 91.66
COG5185622 HEC1 Protein involved in chromosome segregation, i 91.51
PF09787511 Golgin_A5: Golgin subfamily A member 5; InterPro: 91.08
PF135141111 AAA_27: AAA domain 90.91
PF05010207 TACC: Transforming acidic coiled-coil-containing p 90.85
COG3883265 Uncharacterized protein conserved in bacteria [Fun 90.44
KOG4673961 consensus Transcription factor TMF, TATA element m 90.32
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 90.24
PRK09039343 hypothetical protein; Validated 89.24
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 89.12
KOG1853333 consensus LIS1-interacting protein NUDE [Cytoskele 88.89
KOG4302660 consensus Microtubule-associated protein essential 88.46
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 87.81
PF15397258 DUF4618: Domain of unknown function (DUF4618) 87.6
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 87.14
PF14073178 Cep57_CLD: Centrosome localisation domain of Cep57 86.93
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 86.51
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 86.25
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 86.22
TIGR00634563 recN DNA repair protein RecN. All proteins in this 86.18
KOG0982502 consensus Centrosomal protein Nuf [Cell cycle cont 86.11
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 86.1
PF15254 861 CCDC14: Coiled-coil domain-containing protein 14 86.04
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 85.97
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 85.77
PF15066527 CAGE1: Cancer-associated gene protein 1 family 85.33
KOG10291118 consensus Endocytic adaptor protein intersectin [S 84.98
PF05010207 TACC: Transforming acidic coiled-coil-containing p 84.75
PRK1542279 septal ring assembly protein ZapB; Provisional 84.65
KOG1937521 consensus Uncharacterized conserved protein [Funct 84.58
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. T 84.5
KOG02431041 consensus Kinesin-like protein [Cytoskeleton] 84.49
PRK109291109 putative mechanosensitive channel protein; Provisi 84.41
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. T 84.34
TIGR00634563 recN DNA repair protein RecN. All proteins in this 83.83
PF12777344 MT: Microtubule-binding stalk of dynein motor; Int 83.67
KOG4360596 consensus Uncharacterized coiled coil protein [Fun 83.54
PF04012221 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T 82.96
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 82.9
PF06008264 Laminin_I: Laminin Domain I; InterPro: IPR009254 L 82.83
COG4477570 EzrA Negative regulator of septation ring formatio 82.38
COG307479 Uncharacterized protein conserved in bacteria [Fun 81.41
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 81.08
PF15294278 Leu_zip: Leucine zipper 80.72
PF04012221 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T 80.43
PF10481307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 80.43
>PF07765 KIP1: KIP1-like protein; InterPro: IPR011684 This is a group of sequences found exclusively in plants Back     alignment and domain information
Probab=100.00  E-value=9.7e-39  Score=290.78  Aligned_cols=74  Identities=85%  Similarity=1.444  Sum_probs=73.6

Q ss_pred             ccccccCCCCCCCchHHhhHhhHHHHHHHHHHHhhhccchHHHHHHHhhchhhHHHHHHHHHHHHHHHHHHHhh
Q 000499           14 SWWWDSHISPKNSKWLQENLTDMDVKVKQMIKLIEEDADSFARRAEMYYKKRPELMKLVEEFYRAYRALAERYD   87 (1460)
Q Consensus        14 swww~sh~~~~~s~wl~~~l~dm~~~vk~~l~li~ed~dsfakrAemyykkRpeLi~~vee~yr~yr~LAeryd   87 (1460)
                      ||||||||+|++||||+.||+|||.|||+||++|++||||||+||||||+|||+||++|+||||+||+||||||
T Consensus         1 swww~sHi~~~~skWL~~~l~dmd~kvk~mlklieedgdSfakrAEmyy~kRp~Li~~vee~yr~YrsLAerYD   74 (74)
T PF07765_consen    1 SWWWDSHISPKQSKWLQENLSDMDEKVKAMLKLIEEDGDSFAKRAEMYYKKRPELISLVEEFYRSYRSLAERYD   74 (74)
T ss_pred             ChhhhhcCCCCCCHHHHHHHHHHHHHHHHHHHHhccCcchHHHhhHHHhcccHHHHHHHHHHHHHHHHHHHhcC
Confidence            79999999999999999999999999999999999999999999999999999999999999999999999998



They are similar to kinase interacting protein 1 (KIP1), which has been found to interact with the kinase domain of PRK1, a receptor-like kinase []. This particular region contains two coiled-coils, which are described as motifs involved in protein-protein interactions []. It has also been suggested that the coiled-coils of the protein allow it to dimerise in vivo [].

>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] Back     alignment and domain information
>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure Back     alignment and domain information
>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] Back     alignment and domain information
>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed Back     alignment and domain information
>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PLN02939 transferase, transferring glycosyl groups Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>PLN02939 transferase, transferring glycosyl groups Back     alignment and domain information
>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] Back     alignment and domain information
>PRK11281 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>PF14915 CCDC144C: CCDC144C protein coiled-coil region Back     alignment and domain information
>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins Back     alignment and domain information
>PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans Back     alignment and domain information
>PF15397 DUF4618: Domain of unknown function (DUF4618) Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] Back     alignment and domain information
>KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PF15397 DUF4618: Domain of unknown function (DUF4618) Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF14073 Cep57_CLD: Centrosome localisation domain of Cep57 Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PF15254 CCDC14: Coiled-coil domain-containing protein 14 Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF15066 CAGE1: Cancer-associated gene protein 1 family Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>KOG1937 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>KOG0243 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>PRK10929 putative mechanosensitive channel protein; Provisional Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] Back     alignment and domain information
>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells Back     alignment and domain information
>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>PF15294 Leu_zip: Leucine zipper Back     alignment and domain information
>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1460
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 8e-21
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-20
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-20
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-19
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 4e-19
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-18
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-18
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-17
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-14
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-14
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-13
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-12
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-12
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-11
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-18
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-09
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-12
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 4e-11
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-10
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 6e-10
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-09
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 6e-09
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 6e-08
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-07
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 4e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-04
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 1e-06
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 8e-06
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 1e-05
2i1j_A575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 3e-05
2xs1_A704 Programmed cell death 6-interacting protein; prote 4e-05
2ycu_A995 Non muscle myosin 2C, alpha-actinin; motor protein 2e-04
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
 Score = 98.8 bits (246), Expect = 8e-21
 Identities = 56/354 (15%), Positives = 128/354 (36%), Gaps = 8/354 (2%)

Query: 248  KLEAEKEAGLLQYRQSLERLSNLESEVSHAREDSKGLSEQASIAEAEVQTLKEALARLET 307
             +       L      L +++  E E+    E+ +   E+   AEAE++ L++   +L  
Sbjct: 833  NVXHWPWMXLFFXIXPLLKVTRQEEEMQAKDEELQRTKERQQKAEAELKELEQKHTQLCE 892

Query: 308  EREANIRQYQQCLDKLSNMEKNISRAEADAVELSDRASKAEIEAQTLKLDLARIEAEKEA 367
            E+     + Q   +  +  E+   R  A   EL +   + E   +  +    +++AEK+ 
Sbjct: 893  EKNLLQEKLQAETELYAEAEEMRVRLAAKKQELEEILHEMEARIEEEEERSQQLQAEKKK 952

Query: 368  AVVKYEECSRMISALEDKLLHSEEDSKRINKVADKAESEVERLKQALGKLTEEKEALALQ 427
               +  +    +   E      + +    +    K E ++  ++    KLT+E++ L  +
Sbjct: 953  MQQQMLDLEEQLEEEEAARQKLQLEKVTADGKIKKMEDDILIMEDQNNKLTKERKLLEER 1012

Query: 428  YQQCLEAISILEHKLARAEEEAQRLHSELDNGFAKLKGAEEKCLLLERSNQTLHSELESM 487
                   ++  E K     +   +  S +     +LK  E+    LE+  + L  E   +
Sbjct: 1013 VSDLTTNLAEEEEKAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKIKRKLEGESSDL 1072

Query: 488  VQKMGSQSQELTEKQKELGRLWTCIQEERLRFVEAETAFQTLQHLHSQSQDELRSLAAEL 547
             +++     ++ E + +L +    +Q    R  +  +          + +  +  L  +L
Sbjct: 1073 HEQIAELQAQIAELKAQLAKKEEELQAALARLEDETSQKNNALKKIRELESHISDLQEDL 1132

Query: 548  QNRAQILKDMGTRNQSLQEEVEKVKEENKGLNELNLSSAESIKNLQDEILSLRE 601
            ++          + + L EE+E +K E        L         Q E+     
Sbjct: 1133 ESEKAARNKAEKQKRDLSEELEALKTE--------LEDTLDTTATQQELRGSDY 1178


>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Length = 575 Back     alignment and structure
>2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00