Citrus Sinensis ID: 000559

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420--

MPVGEVFLGAFLDILFDRLAPDNLRLFPSEDGIRAELKKWEKNLVMIQAVLEDAEEKQLSNRAVKIWLDDLRALAYDVEDILDEQQLTTRPSLSILQNLPSNLVSQINLGSKIKEVTSRLEELCDRRNVLQLENTSSGTGRAASVSTVSWQRLHTTCLATEPAVYGRDGDKAKVLDMVLSHDTNNDDVNFRVGKTTLARLVYNDLAVEDFNSRAWVCVSDDFDILRISKAILESITLSSCDFKDLNPVQVKLKQEVAGRKFLIVLDDVWSKNYGLWEVLKSPFMAGAPGSKIIVTTRDENVALTLGCPGECHNLELLSDNDCWSVFKKHAFASREFVASSRLCNSEFVRRKVVEKCKGLPLAARTLGGLLRCKQRDAEWQDILNSNIWDLSDDGEIPAVLQLSYHHLPSHLKRCFAYCAIFPKDYEFEEKEVVLLWIAEGLIPQSTDYKQLEDVGVGYFRDLLSRSIFQQVNGDVSKFVMHDLINDLARSVSGETSFRLEDVSGANNRSQRFERARHSSFISGDFDGKSKFEVFNKVEHLRTFWPIILHEGTRYITNFVLSEVLSKFKKLRVLSLRNYYITEVPNSIRLLTHLRYLNFSGTRICHIPESVGFLSHLQILLLKDCHRLKKLPTNVENLIDLLYFDISGQNLITEMPVGMNKLKCLLTLSNFVVGLNTGSGLEDLKSLKFLRGKLCISKLRNVVQDITEPILSDKEDLEVLQLEWESLYLHESSECSRVPDINVLDRLRPHGNLKELSINFYGGTKFPSWVGDPSFSSMVDLRLENCEKCTCLPALGALPSLKELTIKGLRELITIGSEIYGDDCLKPFQSLETLCFQNLGVWSHWDPIGEDGQVEKFPVLRKLSILNCPRLSERLPDHLPSLEELEVRGCEKLVVSLSGLPLLCKLELSSCKRMVCRSIDSQSIKHATLSNVSEFSRLSRHNFQKVECLKIIGCEELEHLWNEICLEELPHGLHSVASLRKLFVANCQSLVSFLEACFLSNLSELVIQNCSALISLNEVTKHNYLHLKSLQIEGCQSLMLIARRQLPSSLTKVEIRNCENLQLTHGENINNTSLSLLESLDISGCQSLMCLSRRGRLSTVLRRLKIQTCPKLKSLSSSEGQLPVAIKHLEVQNCAELTTLSSTGKLPEALQYLSIADCPQLESIAESFHDNAALVFILIGNCRKLQSVPNALHKLVSLDQMYIGNCPSLVSFPDERLPNQNLRVIEISRCEELRPLPSGVERLNSLQELDISLCIPASGLPTNLTSLSIEDLKMPLSCWGLHKLTSLRKLEIRGCPGALSFPEVSVRMRLPTTLTELNIARFPMLHCLSSRGFQNLTSLEYLSISECPRLKSFPWEGLPSSLQQLYVEDCPQLGANCKRYGPEWSKIAHIPCVMIDMNFIHDPPIHDPPYPVYFPLRIRQCIQ

cccHHHHHHHHHHHHHHHHccHHHHccHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccEEEEHHHHHHHHHHcccccccccEEEEEEcccccHHHHHHHHHHHccccccccccHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHHHHHcccccccEEEEEcccHHHHHHHccccccEEcccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHcccccccccccccHHHHcccccccccccccccccccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccccEEEcccccEEEEcHHHHHHHHHHHHccEEEEEcccccccccccccccEEEEEEEcccccccccccccccccccccccccccccccccHHHHHHHHHcccccccEEEcccccccccccccccccccccccccccccccccccccccccccEEccccccccccccHHccccccccEEEEccccccccccccccccccccccccEEEcccccccHHccccccccccEEEEcccccccccccccccccccccccEEEEEcccccccccccccccHHHHcccccccccccEEEEEEEccccccccccccccccccEEEEEccccccccccccccccccEEEEccccccEEEcccccccccccccccccEEEccccccccccccccccccccccccccEEEEEcccccccccccccccccEEEEEccccccccccccccccEEEEccccccEEEccccccccEEEEccccccccccccccccccEEEEEccccccccccccccccccccccccccccEEEEEccccccccccccccccccEEEEEccccccccccccccccccccEEEEEccccccccccccccccccEEEEcccccccccccccccccccccccEEEEccccccccccccccccccccEEEEEccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEccccccHHcccccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccEEEEcccccccccccccccccccEEEEEEcccccEEccccccccccccccEEEEEccccccccccccccccccccEEEEEccccccccccccccccccEEEEEccHHHHHHHccccccccccccccEEEEccEEEEcccccccccccccccccccccc

ccHHHHHHHHHHHHHHHHHcHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccEcccccccccccccccccccccccccccccEEcccHHHHHHHHHHHccccccEEEcccccHHHHHHHHHcccccccccEEEEEEEcccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccEEEEEEEccccccHHHHHHHHHHHHccccccEEEEEEccHHHHHHHcccccccccccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHcHHccccccccccHHHEEEHcccccHHHHHHHEHEcccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHcccccccccEEHHHHHHHHHHHHcccEEEEEEccccccccccccccEEEEEEEcccccHcccccHHHHHHHHcEEcccccccccccccHHHHHHHHHHHccEEEEEEcccccccccccccccHHHEEEEccccccccccccHcHHHHHHHHHHcccccHHHccHHHHcccccEEEEccccccHHccccccccHHHHcEccEEEEcccccccHHHHHHHHHccccEEHHcccccHHHHHHHHHcccccccEEEEEccccccccccccccccHHHHHHHcccccccEEEEEEccccccccccccccccccEEEEEEcccccccccccccccccccEEEEcccccEEEccHHHcccccccccccccEEEccccHHHHHcccccccccccccccccEEEEccccHHcccccHHcccHHHEEHcccHHHcccccccccccEEEEccccccEccccccccccEEEcccccccccccccccccccccEccccccHccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEccccccccccHHcccccccEEEEEcccccHccccHccccccccccEEEEcccccHHcccHcccccccccEEEEccccccccccccccccccccEEEEcccccHccccccccccccccEEEEccccccccccccccccccccEEEEcccccHccccccccccccccEEEEccccccccccccccEEEEcccccccccccccccccccEEEEcccccccccccccccccccccccEEEEcccccHccccHccccccccccEEEEcccccccccccccccccccEEEEcccHHHHHHHHHcccccccEccccEEEEccccccccccccccccccccEEEEHccc

MPVGEVFLGAFLDILFdrlapdnlrlfpsedGIRAELKKWEKNLVMIQAVLEDAEEKQLSNRAVKIWLDDLRALAYDVEdildeqqlttrpslsilqnlpsnlVSQINLGSKIKEVTSRLEELCDRRNvlqlentssgtgraasVSTVSWQRLHTtclatepavygrdgdkaKVLDMVLshdtnnddvnfrVGKTTLARLVYNDLavedfnsrawvcvsddfdILRISKAILESitlsscdfkdlnpvQVKLKQEVAGRKFLIVLDDVwsknyglwevlkspfmagapgskiivttrdenvaltlgcpgechnlellsdndcwsvfkkhafasrefVASSRLCNSEFVRRKVVEKCKGLPLAARTLGGLLRCKQRDAEWQDILNSniwdlsddgeipAVLQLSyhhlpshlkRCFAYCaifpkdyefeEKEVVLLWIAeglipqstdykqledvGVGYFRDLLSRSIFQQVNGDVSKFVMHDLINDLArsvsgetsfrledvsgannrsqrferarhssfisgdfdgkskFEVFNKVEHLRTFWPIILHEGTRYITNFVLSEVLSKFKKLRVLSLRNYYITEVPNSIRLLTHLRylnfsgtrichipesvgFLSHLQILLLKDCHRLKKLPTNVENLIDLLYFDISGQNLITEMPVGMNKLKCLLTLSNFVvglntgsgledlksLKFLRGKLCISKLRNVVQditepilsdkedLEVLQLEWESLYLhessecsrvpdinvldrlrphgnlkelsinfyggtkfpswvgdpsfssmvdlrlencekctclpalgalpslkeLTIKGLRELITIGseiygddclkpfqsLETLCFqnlgvwshwdpigedgqvekfpvlrklsilncprlserlpdhlpsleelevrGCEKLVVSLsglpllcklelssckrmvcrsidsqsikhatlsnvsefsrlsrhnfqkveclkiigcEELEHLWNEICleelphglhSVASLRKLFVANCQSLVSFLEACFLSNLSELVIQNCSALISLNEVTKHNYLHLKSLQIEGCQSLMLIARrqlpssltkVEIRNCEnlqlthgeninntSLSLLEsldisgcqslmclsrrgrLSTVLRRLkiqtcpklkslsssegqlpVAIKHLEVqncaelttlsstgklpealqylsiadcpqleSIAESFHDNAALVFILIGNCrklqsvpnALHKLVSLdqmyigncpslvsfpderlpnqnlrvieisrceelrplpsgveRLNSLQeldislcipasglptnltslsiedlkmplscwglhkltslrkleirgcpgalsfpevsvrmrlpttltelniarfpmlhclssrgfqnltsleylsisecprlksfpweglpsslqqlyvedcpqlganckrygpewskiahipcvmidmnfihdppihdppypvyfplrirqciq

MPVGEVFLGAFLDILFDRLAPDNLRLFPSEDGIRAELKKWEKNLVMIQAVLEDAEEKQLSNRAVKIWLDDLRALAYDVEDILDEQQLTTRPSLSILQNLPSNLVSQINLGSKIKEVTSRLEELCDRRNVLqlentssgtgraasVSTVSWQRLHTTCLatepavygrdGDKAKVLDMVLshdtnnddvnfrVGKTTLARLVYNDLAVEDFNSRAWVCVSDDFDILRISKAILESItlsscdfkdlNPVQVKLKQEVAGRKFLIVLDDVWSKNYGLWEVLKSPFMAGAPGSKIIVTTRDENVALTLGCPGECHNLELLSDNDCWSVFKKHAFASrefvassrlcnsefvrrkvvekckglplaartlggllrCKQRDAEWQDILNSNIWDLSDDGEIPAVLQLSYHHLPSHLKRCFAYCAIFPKDYEFEEKEVVLLWIAEGLIPQSTDYKQLEDVGVGYFRDLLSRSIFQQVNGDVSKFVMHDLINDLArsvsgetsfrledvsgannrsqrferarhssfisgdfdgkSKFEVFNKVEHLRTFWPIILHEGTRYITNFVLSEVLSKFKKLRVLSLRNYyitevpnsirLLTHLRYLNFSGTRICHIPESVGFLSHLQILLLKDCHRLKKLPTNVENLIDLLYFDISGQNLITEMPVGMNKLKCLLTLSNFVVGLNTgsgledlksLKFLRGKLCISKLRNVVQditepilsdkedlEVLQLEWESLYLhessecsrvpdINVLDRLRPHGNLKELSINFYGGTKFPSWVGDPSFSSMVDLRLENCEKCTCLpalgalpslkELTIKGLRELITIGSEIYGDDCLKPFQSLETLCFQNLGVWSHWDPIGEDGQVEKFPVLRKLSILNCPRLSERLPDHLPSLEELEVRGCEKLVVSLSGLPLLCKLELSSCKRMVCRSIdsqsikhatlsnvsefsrlsrhnfqkvECLKIIGCEELEHLWNEICLEELPHGLHSVASLRKLFVANCQSLVSFLEACFLSNLSELVIQNCSALISLNEVTKHNYLHLKSLQIEGCQSLMLIARRQLPSSLTKVEIRNCENLQLTHGENINNTSLSLLESLDISGCQSLMCLSRRGRLSTVLRRLKIqtcpklkslssseGQLPVAIKHLEVQNCAELTTLSSTGKLPEALQYLSIADCPQLESIAESFHDNAALVFILIGNCRKLQSVPNALHKLVSLDQMYIGNCPSLvsfpderlpnqNLRVIEISRCEELRPLPSGVERLNSLQELDISLCIPASGLPTNLTSLSIEDLKMPLSCWGLHKLTSLRKLEIrgcpgalsfpevsvrmrLPTTLTELNIARFPMLHCLSSRGFQNLTSLEYLSISECPRLKSFPWEGLPSSLQQLYVEDCPQLGANCKRYGPEWSKIAHIPCVMIDMNFIHDPPIHDPPYPVYFPLRIRQCIQ

****EVFLGAFLDILFDRLAPDNLRLFPSEDGIRAELKKWEKNLVMIQAVLEDAEEKQLSNRAVKIWLDDLRALAYDVEDILDEQQLTTRPSLSILQNLPSNLVSQINLGSKIKEVTSRLEELCDRRNVLQL**********ASVSTVSWQRLHTTCLATEPAVYGRDGDKAKVLDMVLSHDTNNDDVNFRVGKTTLARLVYNDLAVEDFNSRAWVCVSDDFDILRISKAILESITLSSCDFKDLNPVQVKLKQEVAGRKFLIVLDDVWSKNYGLWEVLKSPFMAGAPGSKIIVTTRDENVALTLGCPGECHNLELLSDNDCWSVFKKHAFASREFVASSRLCNSEFVRRKVVEKCKGLPLAARTLGGLLRCKQRDAEWQDILNSNIWDLSDDGEIPAVLQLSYHHLPSHLKRCFAYCAIFPKDYEFEEKEVVLLWIAEGLIPQSTDYKQLEDVGVGYFRDLLSRSIFQQVNGDVSKFVMHDLINDLARS******************************ISGDFDGKSKFEVFNKVEHLRTFWPIILHEGTRYITNFVLSEVLSKFKKLRVLSLRNYYITEVPNSIRLLTHLRYLNFSGTRICHIPESVGFLSHLQILLLKDCHRLKKLPTNVENLIDLLYFDISGQNLITEMPVGMNKLKCLLTLSNFVVGLNTGSGLEDLKSLKFLRGKLCISKLRNVVQDITEPILSDKEDLEVLQLEWESLYLHESSECSRVPDINVLDRLRPHGNLKELSINFYGGTKFPSWVGDPSFSSMVDLRLENCEKCTCLPALGALPSLKELTIKGLRELITIGSEIYGDDCLKPFQSLETLCFQNLGVWSHWDPIGEDGQVEKFPVLRKLSILNCPRLSERLPDHLPSLEELEVRGCEKLVVSLSGLPLLCKLELSSCKRMVCRSIDSQSIKHATLSNVSEFSRLSRHNFQKVECLKIIGCEELEHLWNEICLEELPHGLHSVASLRKLFVANCQSLVSFLEACFLSNLSELVIQNCSALISLNEVTKHNYLHLKSLQIEGCQSLMLIARRQLPSSLTKVEIRNCENLQLTHGENINNTSLSLLESLDISGCQSLMCLSRRGRLSTVLRRLKIQTCPKLK*******QLPVAIKHLEVQNCAELTTLSSTGKLPEALQYLSIADCPQLESIAESFHDNAALVFILIGNCRKLQSVPNALHKLVSLDQMYIGNCPSLVSFPDERLPNQNLRVIEISRCEELRPLPSGVERLNSLQELDISLCIPASGLPTNLTSLSIEDLKMPLSCWGLHKLTSLRKLEIRGCPGALSFPEVSVRMRLPTTLTELNIARFPMLHCLSSRGFQNLTSLEYLSISECPRLKSFPWEGLPSSLQQLYVEDCPQLGANCKRYGPEWSKIAHIPCVMIDMNFIHDPPIHDPPYPVYFPLRIRQC**

MPVGEVFLGAFLDILFDRLAPDNLRLFPSEDGIRAELKKWEKNLVMIQAVLEDAEEKQLSNRAVKIWLDDLRALAYDVEDILDEQQLTTRP****************NLGSKIKEVTSRLEELCDRRNVLQLEN************************ATEPAVYGRDGDKAKVLDMVLSHDTNNDDVNFRVGKTTLARLVYNDLAVEDFNSRAWVCVSDDFDILRISKAILESIT***********VQVKLKQEVAGRKFLIVLDDVWSKNYGLWEVLKSPFMAGAPGSKIIVTTRDENVALTLGCPGECHNLELLSDNDCWSVFKKHAFA**********CNSEFVRRKVVEKCKGLPLAARTLGGLLRCKQRDAEWQDILNSNIWDLSDDGEIPAVLQLSYHHLPSHLKRCFAYCAIFPKDYEFEEKEVVLLWIAEGLIPQSTDYKQLEDVGVGYFRDLLSRSIFQQVNGDVSKFVMHDLINDLARSVSGETSFRLEDVS******QRFERARHSSFISGDFDGKSKFEVFNKVEHLRTFWPIILHEGTRYITNFVLSEVLSKFKKLRVLSLRNYYITEVPNSIRLLTHLRYLNFSGTRICHIPESVGFLSHLQILLLKDCHRLKKLPTNVENLIDLLYFDISGQNLITEMPVGMNKLKCLLTLSNFVVGLNTGSGLEDLKSLKFLRGKLCISKLRNVVQDITEPILSDKEDLEVLQLEWESLY************INVLDRLRPHGNLKELSINFYGGTKFPSWVGDPSFSSMVDLRLENCEKCTCLPALGALPSLKELTIKGLRELITIGSEIYGDDCLKPFQSLETLCFQNLGVWSHWDPIGEDGQVEKFPVLRKLSILNCPRLSERLPDHLPSLEELEVRGCEKLVVSLSGLPLLCKLELSSCKRMVCRSIDSQSIKHATLSNVSEFSRLSRHNFQKVECLKIIGCEELEHLWNEICLEELPHGLHSVASLRKLFVANCQSLVSFLEACFLSNLSELVIQNCSALISLNEVTKHNYLHLKSLQIEGCQSLMLIARRQLPSSLTKVEIRNCENLQLT*********LSLLESLDISGCQSLMCLSRRGRLSTVLRRLKIQTCPKLKSLSSSEGQLPVAIKHLEVQNCAELTTLSSTGKLPEALQYLSIADCPQLESIAESFHDNAALVFILIGNCRKLQSVPNALHKLVSLDQMYIGNCPSLVSFPDERLPNQNLRVIEISRCEELRPLPSGVERLNSLQELDISLCIPASGLPTNLTSLSIEDLKMPLSCWGLHKLTSLRKLEIRGCPGALSFPEVSVRMRLPTTLTELNIARFPMLHCLSSRGFQNLTSLEYLSISECPRLKSFPWEGLPSSLQQLYVEDCPQLGANCKRYGPEWSKIAHIPCVMIDMNFIHDPPIHDPPYPVYFPLRIRQCI*

MPVGEVFLGAFLDILFDRLAPDNLRLFPSEDGIRAELKKWEKNLVMIQAVLEDAEEKQLSNRAVKIWLDDLRALAYDVEDILDEQQLTTRPSLSILQNLPSNLVSQINLGSKIKEVTSRLEELCDRRNVLQLEN**************SWQRLHTTCLATEPAVYGRDGDKAKVLDMVLSHDTNNDDVNFRVGKTTLARLVYNDLAVEDFNSRAWVCVSDDFDILRISKAILESITLSSCDFKDLNPVQVKLKQEVAGRKFLIVLDDVWSKNYGLWEVLKSPFMAGAPGSKIIVTTRDENVALTLGCPGECHNLELLSDNDCWSVFKKHAFASREFVASSRLCNSEFVRRKVVEKCKGLPLAARTLGGLLRCKQRDAEWQDILNSNIWDLSDDGEIPAVLQLSYHHLPSHLKRCFAYCAIFPKDYEFEEKEVVLLWIAEGLIPQSTDYKQLEDVGVGYFRDLLSRSIFQQVNGDVSKFVMHDLINDLARSVSGETSFRLEDVSGANNRSQRFERARHSSFISGDFDGKSKFEVFNKVEHLRTFWPIILHEGTRYITNFVLSEVLSKFKKLRVLSLRNYYITEVPNSIRLLTHLRYLNFSGTRICHIPESVGFLSHLQILLLKDCHRLKKLPTNVENLIDLLYFDISGQNLITEMPVGMNKLKCLLTLSNFVVGLNTGSGLEDLKSLKFLRGKLCISKLRNVVQDITEPILSDKEDLEVLQLEWESLYLHESSECSRVPDINVLDRLRPHGNLKELSINFYGGTKFPSWVGDPSFSSMVDLRLENCEKCTCLPALGALPSLKELTIKGLRELITIGSEIYGDDCLKPFQSLETLCFQNLGVWSHWDPIGEDGQVEKFPVLRKLSILNCPRLSERLPDHLPSLEELEVRGCEKLVVSLSGLPLLCKLELSSCKRMVCRSIDSQSIKHATLSNVSEFSRLSRHNFQKVECLKIIGCEELEHLWNEICLEELPHGLHSVASLRKLFVANCQSLVSFLEACFLSNLSELVIQNCSALISLNEVTKHNYLHLKSLQIEGCQSLMLIARRQLPSSLTKVEIRNCENLQLTHGENINNTSLSLLESLDISGCQSLMCLSRRGRLSTVLRRLKIQTCPKLKSLSSSEGQLPVAIKHLEVQNCAELTTLSSTGKLPEALQYLSIADCPQLESIAESFHDNAALVFILIGNCRKLQSVPNALHKLVSLDQMYIGNCPSLVSFPDERLPNQNLRVIEISRCEELRPLPSGVERLNSLQELDISLCIPASGLPTNLTSLSIEDLKMPLSCWGLHKLTSLRKLEIRGCPGALSFPEVSVRMRLPTTLTELNIARFPMLHCLSSRGFQNLTSLEYLSISECPRLKSFPWEGLPSSLQQLYVEDCPQLGANCKRYGPEWSKIAHIPCVMIDMNFIHDPPIHDPPYPVYFPLRIRQCIQ

MPVGEVFLGAFLDILFDRLAPDNLRLFPSEDGIRAELKKWEKNLVMIQAVLEDAEEKQLSNRAVKIWLDDLRALAYDVEDILDEQQLTTRPSLSILQNLPSNLVSQINLGSKIKEVTSRLEELCDRRNVLQLENT**********************LATEPAVYGRDGDKAKVLDMVLSHDTNNDDVNFRVGKTTLARLVYNDLAVEDFNSRAWVCVSDDFDILRISKAILESITLSSCDFKDLNPVQVKLKQEVAGRKFLIVLDDVWSKNYGLWEVLKSPFMAGAPGSKIIVTTRDENVALTLGCPGECHNLELLSDNDCWSVFKKHAFASREFVASSRLCNSEFVRRKVVEKCKGLPLAARTLGGLLRCKQRDAEWQDILNSNIWDLSDDGEIPAVLQLSYHHLPSHLKRCFAYCAIFPKDYEFEEKEVVLLWIAEGLIPQSTDYKQLEDVGVGYFRDLLSRSIFQQVNGDVSKFVMHDLINDLARSVSGETSFRLEDVSGANNRSQRFERARHSSFISGDFDGKSKFEVFNKVEHLRTFWPIILHEGTRYITNFVLSEVLSKFKKLRVLSLRNYYITEVPNSIRLLTHLRYLNFSGTRICHIPESVGFLSHLQILLLKDCHRLKKLPTNVENLIDLLYFDISGQNLITEMPVGMNKLKCLLTLSNFVVGLNTGSGLEDLKSLKFLRGKLCISKLRNVVQDITEPILSDKEDLEVLQLEWESLYLHESSECSRVPDINVLDRLRPHGNLKELSINFYGGTKFPSWVGDPSFSSMVDLRLENCEKCTCLPALGALPSLKELTIKGLRELITIGSEIYGDDCLKPFQSLETLCFQNLGVWSHWDPIGEDGQVEKFPVLRKLSILNCPRLSERLPDHLPSLEELEVRGCEKLVVSLSGLPLLCKLELSSCKRMVCRSIDSQSIKHATLSNVSEFSRLSRHNFQKVECLKIIGCEELEHLWNEICLEELPHGLHSVASLRKLFVANCQSLVSFLEACFLSNLSELVIQNCSALISLNEVTKHNYLHLKSLQIEGCQSLMLIARRQLPSSLTKVEIRNCENLQLTHGENINNTSLSLLESLDISGCQSLMCLSRRGRLSTVLRRLKIQTCPKLKSLSSSEGQLPVAIKHLEVQNCAELTTLSSTGKLPEALQYLSIADCPQLESIAESFHDNAALVFILIGNCRKLQSVPNALHKLVSLDQMYIGNCPSLVSFPDERLPNQNLRVIEISRCEELRPLPSGVERLNSLQELDISLCIPASGLPTNLTSLSIEDLKMPLSCWGLHKLTSLRKLEIRGCPGALSFPEVSVRMRLPTTLTELNIARFPMLHCLSSRGFQNLTSLEYLSISECPRLKSFPWEGLPSSLQQLYVEDCPQLGANCKRYGPEWSKIAHIPCVMIDMNFIHDPPIHDPPYPVYFPLRIRQCIQ

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MPVGEVFLGAFLDILFDRLAPDNLRLFPSEDGIRAExxxxxxxxxxxxxxxxxxxxxQLSNRAVKIWLDDLRALAYDVEDILDEQQLTTRPSLSILQNLPSNLVSQINLGSKxxxxxxxxxxxxxxxxxxxxxNTSSGTGRAASVSTVSWQRLHTTCLATEPAVYGRDGDKAKVLDMVLSHDTNNDDVNFRVGKTTLARLVYNDLAVEDFNSRAWVCVSDDFDILRISKAILESITLSSCDFKDLNPVQVKLKQEVAGRKFLIVLDDVWSKNYGLWEVLKSPFMAGAPGSKIIVTTRDENVALTLGCPGECHNLELLSDNDCWSVFKKHAFASREFVASSRLCNSEFVRRKVVEKCKGLPLAARTLGGLLRCKQRDAEWQDILNSNIWDLSDDGEIPAVLQLSYHHLPSHLKRCFAYCAIFPKDYEFEEKEVVLLWIAEGLIPQSTDYKQLEDVGVGYFRDLLSRSIFQQVNGDVSKFVMHDLINDLARSVSGETSFRLEDVSGANNRSQRFERARHSSFISGDFDGKSKFEVFNKVEHLRTFWPIILHEGTRYITNFVLSEVLSKFKKLRVLSLRNYYITEVPNSIRLLTHLRYLNFSGTRICHIPESVGFLSHLQILLLKDCHRLKKLPTNVENLIDLLYFDISGQNLITEMPVGMNKLKCLLTLSNFVVGLNTGSGLEDLKSLKFLRGKLCISKLRNVVQDITEPILSDKEDLEVLQLEWESLYLHESSECSRVPDINVLDRLRPHGNLKELSINFYGGTKFPSWVGDPSFSSMVDLRLENCEKCTCLPALGALPSLKELTIKGLRELITIGSEIYGDDCLKPFQSLETLCFQNLGVWSHWDPIGEDGQVEKFPVLRKLSILNCPRLSERLPDHLPSLEELEVRGCEKLVVSLSGLPLLCKLELSSCKRMVCRSIDSQSIKHATLSNVSEFSRLSRHNFQKVECLKIIGCEELEHLWNEICLEELPHGLHSVASLRKLFVANCQSLVSFLEACFLSNLSELVIQNCSALISLNEVTKHNYLHLKSLQIEGCQSLMLIARRQLPSSLTKVEIRNCENLQLTHGENINNTSLSLLESLDISGCQSLMCLSRRGRLSTVLRRLKIQTCPKLKSLSSSEGQLPVAIKHLEVQNCAELTTLSSTGKLPEALQYLSIADCPQLESIAESFHDNAALVFILIGNCRKLQSVPNALHKLVSLDQMYIGNCPSLVSFPDERLPNQNLRVIEISRCEELRPLPSGVERLNSLQELDISLCIPASGLPTNLTSLSIEDLKMPLSCWGLHKLTSLRKLEIRGCPGALSFPEVSVRMRLPTTLTELNIARFPMLHCLSSRGFQNLTSLEYLSISECPRLKSFPWEGLPSSLQQLYVEDCPQLGANCKRYGPEWSKIAHIPCVMIDMNFIHDPPIHDPPYPVYFPLRIRQCIQ

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		1422	2.2.26 [Sep-21-2011]
Q9LRR4		1054	Putative disease resistan	yes	no	0.673	0.908	0.367	1e-173
Q9LRR5		1424	Putative disease resistan	no	no	0.587	0.587	0.354	1e-133
Q7XA40		992	Putative disease resistan	N/A	no	0.655	0.939	0.331	1e-129
Q7XA42		979	Putative disease resistan	N/A	no	0.641	0.931	0.324	1e-124
Q7XA39		988	Putative disease resistan	N/A	no	0.655	0.943	0.317	1e-121
Q7XBQ9		970	Disease resistance protei	N/A	no	0.646	0.948	0.323	1e-119
Q38834		852	Disease resistance RPP13-	no	no	0.490	0.819	0.305	3e-59
Q39214		926	Disease resistance protei	no	no	0.410	0.630	0.267	6e-51
Q8W3K3		910	Putative disease resistan	no	no	0.587	0.917	0.261	2e-48
Q9M667		835	Disease resistance protei	no	no	0.402	0.685	0.274	2e-47

>sp\|Q9LRR4\|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1	Back alignment and function desciption

 Score =  610 bits (1572), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 389/1059 (36%), Positives = 592/1059 (55%), Gaps = 101/1059 (9%)

Query: 3    VGEVFLGAFLDILFDRLAPDNLRLFPSEDGIRAEL-KKWEKNLVMIQAVLEDAEEKQLSN 61
            +GE+FL AFL  LF  L  +  R F     +   L ++    L+ I AVL DAEEKQ++N
Sbjct: 4    IGEMFLAAFLQALFQTLVSEPFRSFFKRRELNENLLERLSTALLTITAVLIDAEEKQITN 63

Query: 62   RAVKIWLDDLRALAYDVEDILDE--------------------QQLTTRPSLSILQNLPS 101
              V+ W+++LR + Y  ED LD+                    +QL  R SL    +  S
Sbjct: 64   PVVEKWVNELRDVVYHAEDALDDIATEALRLNIGAESSSSNRLRQLRGRMSLGDFLDGNS 123

Query: 102  NLVSQINLGSKIKEVTSRLEELCDRRNVLQLENTSSGTGRAASVSTVSWQRLHTTCLATE 161
                  +L +++++VT RLE L  +RN+L L+  ++          +  QRL TT L  E
Sbjct: 124  E-----HLETRLEKVTIRLERLASQRNILGLKELTA---------MIPKQRLPTTSLVDE 169

Query: 162  PAVYGRDGDKAKVLDMVLSHDTNNDDVNF-------RVGKTTLARLVYNDLAVED-FNSR 213
              V+GRD DK +++  ++  +  ++ +          VGKTTL++L+YND  V   F ++
Sbjct: 170  SEVFGRDDDKDEIMRFLIPENGKDNGITVVAIVGIGGVGKTTLSQLLYNDQHVRSYFGTK 229

Query: 214  AWVCVSDDFDILRISKAILESITLSSCDFKDLNPVQVKLKQEVAGRK--FLIVLDDVWSK 271
             W  VS++FD+ +I+K + ES+T   C+F DL+ +QVKLK+ + G    FL+VLDD+W++
Sbjct: 230  VWAHVSEEFDVFKITKKVYESVTSRPCEFTDLDVLQVKLKERLTGTGLPFLLVLDDLWNE 289

Query: 272  NYGLWEVLKSPFMAGAPGSKIIVTTRDENVALTLGCPGECHNLELLSDNDCWSVFKKHAF 331
            N+  W++L+ PF+  A GS+I+VTTR + VA ++ C    HNL+ LSD DCWS+F K  F
Sbjct: 290  NFADWDLLRQPFIHAAQGSQILVTTRSQRVA-SIMCAVHVHNLQPLSDGDCWSLFMKTVF 348

Query: 332  ASREFVASSRLCNSEFVRRKVVEKCKGLPLAARTLGGLLRCKQRDAEWQDILNSNIWDL- 390
             ++E   +  + +   +  ++V KC+GLPLA +TLGG+LR + +  EW+ +L+S IWDL 
Sbjct: 349  GNQEPCLNREIGD---LAERIVHKCRGLPLAVKTLGGVLRFEGKVIEWERVLSSRIWDLP 405

Query: 391  SDDGEIPAVLQLSYHHLPSHLKRCFAYCAIFPKDYEFEEKEVVLLWIAEGLIPQSTDYKQ 450
            +D   +  VL++SY++LP+HLKRCFAYC+IFPK + FE+ +VVLLW+AEG + Q+   K 
Sbjct: 406  ADKSNLLPVLRVSYYYLPAHLKRCFAYCSIFPKGHAFEKDKVVLLWMAEGFLQQTRSSKN 465

Query: 451  LEDVGVGYFRDLLSRSIFQQVNGDVSKFVMHDLINDLARSVSGETSFRLEDVSGANNRSQ 510
            LE++G  YF +L SRS+ Q+     ++++MHD IN+LA+  SGE S + ED      + Q
Sbjct: 466  LEELGNEYFSELESRSLLQKTK---TRYIMHDFINELAQFASGEFSSKFED----GCKLQ 518

Query: 511  RFERARHSSFISGDFDGKSKFEVFNKVEHLRTFWPIILHEGTRY--ITNFVLSEVLSKFK 568
              ER R+ S++  ++    +FE   +V+ LRTF P+ L   +R   +   V  ++L    
Sbjct: 519  VSERTRYLSYLRDNYAEPMEFEALREVKFLRTFLPLSLTNSSRSCCLDQMVSEKLLPTLT 578

Query: 569  KLRVLSLRNYYITEV-PNSIRLLTHLRYLNFSGTRICHIPESVGFLSHLQILLLKDCHRL 627
            +LRVLSL +Y I  + P+  + ++H R+L+ S T +  +P+S+ ++ +LQ LLL  C  L
Sbjct: 579  RLRVLSLSHYKIARLPPDFFKNISHARFLDLSRTELEKLPKSLCYMYNLQTLLLSYCSSL 638

Query: 628  KKLPTNVENLIDLLYFDISGQNLITEMPVGMNKLKCLLTLSNFVVGLNTGSGLEDLKSLK 687
            K+LPT++ NLI+L Y D+ G  L  +MP    +LK L TL+ F V  + GS + +L  L 
Sbjct: 639  KELPTDISNLINLRYLDLIGTKL-RQMPRRFGRLKSLQTLTTFFVSASDGSRISELGGLH 697

Query: 688  FLRGKLCISKLRNVVQ--DITEPILSDKEDLEVLQLEWESLYLHESSECSRVP-----DI 740
             L GKL I +L+ VV   D  E  L+ K+ L  +   W +     SSE +  P     + 
Sbjct: 698  DLHGKLKIVELQRVVDVADAAEANLNSKKHLREIDFVWRT--GSSSSENNTNPHRTQNEA 755

Query: 741  NVLDRLRPHGNLKELSINFYGGTKFPSWVGDPSFSSMVDLRLENCEKCTCLPALGALPSL 800
             V ++LRPH ++++L+I  Y G +FP W+ DPSFS +V +RL  C+ CT LP+LG LP L
Sbjct: 756  EVFEKLRPHRHIEKLAIERYKGRRFPDWLSDPSFSRIVCIRLRECQYCTSLPSLGQLPCL 815

Query: 801  KELTIKGLRELITIGSEIY------GDDCLKPFQSLETLCFQNLGVWSHW-DPIGEDGQV 853
            KEL I G+  L +IG + Y       D   +PF+SLETL F NL  W  W D     G +
Sbjct: 816  KELHISGMVGLQSIGRKFYFSDQQLRDQDQQPFRSLETLRFDNLPDWQEWLDVRVTRGDL 875

Query: 854  EKFPVLRKLSILNCPRLSERLPDHLPSLEELEVRGCEKLVVSLSGLPLLCKLELSSCKRM 913
              FP L+KL IL CP L+  LP  LPSL  L +  C  L                     
Sbjct: 876  --FPSLKKLFILRCPELTGTLPTFLPSLISLHIYKCGLLDFQ------------PDHHEY 921

Query: 914  VCRSIDSQSIKHATLSNVSEFSRLSRHNFQKVECLKIIGCEELEHLWNEICLEELPHGLH 973
              R++ + SIK    S+     +   ++F  ++ L++  C  L        LE     L 
Sbjct: 922  SYRNLQTLSIK----SSCDTLVKFPLNHFANLDKLEVDQCTSL------YSLELSNEHLR 971

Query: 974  SVASLRKLFVANCQSLVSFLEACFLSNLSELVIQNCSAL 1012
               +LR L + +CQ+L    +   L    ++ I NC  L
Sbjct: 972  GPNALRNLRINDCQNLQLLPKLNALPQNLQVTITNCRYL 1010

Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q9LRR5\|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1	Back alignment and function description

>sp\|Q7XA40\|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2	Back alignment and function description

>sp\|Q7XA42\|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2	Back alignment and function description

>sp\|Q7XA39\|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1	Back alignment and function description

>sp\|Q7XBQ9\|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1	Back alignment and function description

>sp\|Q38834\|R13L4_ARATH Disease resistance RPP13-like protein 4 OS=Arabidopsis thaliana GN=RPP13L4 PE=2 SV=2	Back alignment and function description

>sp\|Q39214\|RPM1_ARATH Disease resistance protein RPM1 OS=Arabidopsis thaliana GN=RPM1 PE=1 SV=1	Back alignment and function description

>sp\|Q8W3K3\|DRL8_ARATH Putative disease resistance protein At1g58400 OS=Arabidopsis thaliana GN=At1g58400 PE=3 SV=1	Back alignment and function description

>sp\|Q9M667\|RPP13_ARATH Disease resistance protein RPP13 OS=Arabidopsis thaliana GN=RPP13 PE=2 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1422
284026888		1424	CC-NBS-LRR protein [Quercus suber]	0.950	0.949	0.446	0.0
225449649		1418	PREDICTED: putative disease resistance p	0.954	0.957	0.434	0.0
356554923		1399	PREDICTED: putative disease resistance R	0.938	0.953	0.407	0.0
225450003		1452	PREDICTED: putative disease resistance R	0.935	0.915	0.410	0.0
359495024		1390	PREDICTED: putative disease resistance p	0.930	0.951	0.415	0.0
225450019		1394	PREDICTED: putative disease resistance p	0.927	0.946	0.408	0.0
225450005		1490	PREDICTED: putative disease resistance p	0.951	0.908	0.397	0.0
359487424		1453	PREDICTED: putative disease resistance R	0.934	0.914	0.405	0.0
359487422		1455	PREDICTED: putative disease resistance R	0.931	0.909	0.400	0.0
359487416		1472	PREDICTED: putative disease resistance p	0.926	0.894	0.408	0.0

>gi\|284026888\|gb\|ADB66335.1\| CC-NBS-LRR protein [Quercus suber]	Back alignment and taxonomy information

 Score = 1122 bits (2903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 655/1467 (44%), Positives = 912/1467 (62%), Gaps = 115/1467 (7%)

Query: 3    VGEVFLGAFLDILFDRLAPDNLRLFPSEDGIRAELKKWEKNLVMIQAVLEDAEEKQLSNR 62
            + EVFLGA L +L D LAP  L        ++ +L+KW + L+ IQ VL+DAEEKQL++ 
Sbjct: 2    LAEVFLGAVLPVLLDMLAPQELMSLVFSGSVKKKLEKWRQTLLAIQMVLKDAEEKQLTDA 61

Query: 63   AVKIWLDDLRALAYDVEDILD-------EQQLTTRP----------SLSILQNLPSNLVS 105
             V  WL+ +R LAYD+ED+ D       +++L  +P          SL   +  PS +  
Sbjct: 62   DVNQWLEAIRELAYDLEDLFDDFAIEAMQRKLKAQPESSSPASMVRSLVPTRFTPSAVKF 121

Query: 106  QINLGSKIKEVTSRLEELCDRRNVLQLENTSSGTGRAASVSTVSWQRLHTTCLATEPAVY 165
             + +  +I+++++RL+E+ ++++ L L++          +S   W+R  +T +   P + 
Sbjct: 122  NLKMKFEIEKISNRLKEITEQKDRLGLKD--------GGMSVKIWKRPSSTSVPYGPVI- 172

Query: 166  GRDGDKAKVLDMVLSHDTNNDDVNFRV---------GKTTLARLVYNDLAVEDFNSRAWV 216
            GRD D+ K+++++L  D   DD N+ V         GKTTLARLVYND AV+ FN RAW+
Sbjct: 173  GRDEDRKKIIELILK-DEQTDDSNYHVISIVGMAGVGKTTLARLVYNDDAVKHFNPRAWI 231

Query: 217  CVSDDFDILRISKAILESITLSSCDFKDLNPVQVKLKQEVAGRKFLIVLDDVWSKNYGLW 276
            CVSDDFD++ ++KA+LES+T   C  K+LN VQVKL  E+ G+KFL+VLDD+W++NYGLW
Sbjct: 232  CVSDDFDVMMVTKALLESVTSQPCHLKELNEVQVKLASELEGKKFLLVLDDLWNENYGLW 291

Query: 277  EVLKSPFMAGAPGSKIIVTTRDENVALTLGCPGECHNLELLSDNDCWSVFKKHAFASREF 336
            E L  PF AGA GS+IIVTTR+ +V   +G   + +NL+ +S+NDCW++F +H+  +  F
Sbjct: 292  EALLPPFRAGAAGSRIIVTTRNASVGKVMGAV-QSYNLDFISNNDCWAIFVQHSLMNENF 350

Query: 337  VASSRLCNSEFVRRKVVEKCKGLPLAARTLGGLLRCKQRDAEWQDILNSNIWDLSDDG-E 395
                R  NS  +R +++E+C+GLPLAARTLGGL R K+ D EW+DI+NS +W  S+ G +
Sbjct: 351  ---GRPGNSGLIRERILERCRGLPLAARTLGGLFRGKELD-EWEDIMNSKLWSSSNMGSD 406

Query: 396  IPAVLQLSYHHLPSHLKRCFAYCAIFPKDYEFEEKEVVLLWIAEGLIPQSTDYKQLEDVG 455
            I  +L+LSYHHLP HLKRCFAYC++FP+DYEFEEK+++LLW+AEGLI Q+   K +ED+G
Sbjct: 407  IFPILRLSYHHLPHHLKRCFAYCSLFPRDYEFEEKQLILLWMAEGLIYQAEGDKPMEDLG 466

Query: 456  VGYFRDLLSRSIFQQVNGDVSKFVMHDLINDLARSVSGETSFRLEDVSGANNRSQRFERA 515
              YFRDLLSRS FQQ + + S+FVMHDLI DLA+ V+G + FRLE     N +S+   +A
Sbjct: 467  GEYFRDLLSRSFFQQSSSNKSRFVMHDLITDLAQWVAGISYFRLETKLKGNEQSKVSSKA 526

Query: 516  RHSSFISGDFDGKSKFEVFNKVEHLRTFWPIIL-HEGTRYITNFVLSEVLSKFKKLRVLS 574
            RH SF+   +DG  KFE  ++ +HLRTF P++  + G  Y++  +++++L K + LRVLS
Sbjct: 527  RHLSFVGSRYDGAKKFEAISEFKHLRTFLPLMAPYVGYSYLSYHIINQLLPKLQNLRVLS 586

Query: 575  LRNYYITEVPNSIRLLTHLRYLNFSGTRICHIPESVGFLSHLQILLLKDCHRLKKLPTNV 634
            L  Y I  +P +I  L HLRYL+ S T++  +P S+  L +LQ LLL++C  LK LP + 
Sbjct: 587  LSGYRIVYLPQTIGDLKHLRYLDLSCTQLRSLPTSISTLYNLQTLLLENCTSLKFLPPDF 646

Query: 635  ENLIDLLYFDISGQNLITEMPVGMNKLKCLLTLSNFVVG-LNTGSGLEDLKSLKFLRGKL 693
              L +L + +I G NL+  MP+ +  L  L TLSNFVVG  ++   + +L  L  LRG L
Sbjct: 647  GKLFNLRHLNIFGSNLLEGMPLSIGNLSSLQTLSNFVVGKADSFCVIRELGPLVHLRGTL 706

Query: 694  CISKLRNV--VQDITEPILSDKEDLEVLQLEWESLYLHESSECSRVPDINVLDRLRPHGN 751
            CISKL NV   Q+  +  L  K+DL  + +EW S  L+ES +      + VL+ L+P+  
Sbjct: 707  CISKLENVTKAQEARDSYLYGKQDLNEVVMEWSS-NLNESQD--EETQLEVLNMLQPNVK 763

Query: 752  LKELSINFYGGTKFPSWVGDPSFSSMVDLRLENCEKCTCLPALGALPSLKELTIKGLREL 811
            LKEL++  YGGTKFP+W+GDPSFS++V LR ENC+ C  LP +G LP LK+L IKG+  +
Sbjct: 764  LKELTVKCYGGTKFPTWIGDPSFSNLVLLRFENCDNCNSLPPVGQLPFLKDLLIKGMAGV 823

Query: 812  ITIGSEIYGDDCLKPFQSLETLCFQNLGVWSHWDPIGEDGQVEKFPVLRKLSILNCPRLS 871
             ++G E YG+ C +PFQSLETL F+++  W +W P+G +   E F  L KLSI+ C  L 
Sbjct: 824  KSVGREFYGESCSRPFQSLETLHFEDMPRWVNWIPLGVN---EAFACLHKLSIIRCHNLV 880

Query: 872  ERLPDHLPSLEELEVRGCEKLVVSLSGLPLLCKLELSSCKRMVCR-SIDSQSIKHATLSN 930
             +LPDHLPSL++L + GC  +VVS+S LP+LC L +  CKR+ C  S+   S      S 
Sbjct: 881  RKLPDHLPSLKKLVIHGCWNMVVSVSNLPMLCVLVIEGCKRVECESSVGFGSPYSMAFSK 940

Query: 931  VSEFSRLSR---HNFQKVECLKIIGCEELEHLWNEICLEELPHGLHSVASLRKLFVANCQ 987
            +SEF   +    H   KVE LKI+  E+L  LW     E++P GLH +  LR+L + +C 
Sbjct: 941  ISEFGNATAGLMHGVSKVEYLKIVDSEKLTTLW-----EKIPEGLHRLKFLRELSIEDCP 995

Query: 988  SLVSFLEACFLSNLSELVIQNCSALIS-LNEVTKHNYLH--LKSLQIEGCQSLMLIARRQ 1044
            +LVSF  + F S L  + I++CS L S L E T H+  +  L+ L +  C S+  IAR Q
Sbjct: 996  TLVSFPASGFPSMLKVIQIKSCSGLKSLLPEGTLHSRENACLERLCVVRCDSMKSIARGQ 1055

Query: 1045 LPSSLTKVEIRNCENLQ-------------LTHGENINNTSLSLLESLDISGCQSLMCLS 1091
            LP++L K+EI +C NLQ               H E+INN S + L+ LDI  C SL  L+
Sbjct: 1056 LPTTLKKLEISHCMNLQCVLDEGEGSSSSSGMHDEDINNRSKTHLQYLDIKSCPSLTTLT 1115

Query: 1092 RRGRLSTVLRRLKIQTCPKLKSLSSSEGQLPVAIKHLEVQNCAELTTLSSTGKLPEALQY 1151
              G+L   L  L ++ CPKL  LSS+ G+LP A+++LE+Q+ +                 
Sbjct: 1116 SSGKLPATLTHLLLRECPKLMCLSST-GKLPAALQYLEIQSIS----------------- 1157

Query: 1152 LSIADCPQLESIAESFHDNAALVFILIGNCRKLQSVPNALHKLVSLDQMYIGNCPSLVSF 1211
                   +L+ IAE  H N +L  I I NC  L+S+P  LH L  L Q  I  C S  SF
Sbjct: 1158 -------KLQKIAERLHQNTSLECIKIWNCHGLKSLPEDLHNLSKLRQFLIFWCQSFSSF 1210

Query: 1212 PDERLPNQNLRVIEISRCEELRPLPSGVERLNSLQELDI-----SLCIPASGLPTNLTSL 1266
            P   LP+ NLRV+ I  C+ L+ LP+G+  L SLQ+LDI     SL  P  GLPTNL  L
Sbjct: 1211 PAAGLPS-NLRVLGIKNCKNLKALPNGMRNLTSLQKLDISHRLDSLPSPQEGLPTNLIEL 1269

Query: 1267 SIEDLKM--PLSCWGLHKLTSLRKLEIRG-CPGALSFP---EVSVRMRLPTTLTELNIAR 1320
            ++ DLK   P+  WGL + TSL KL I G C    S+P   E  V M LP +L+ L I+ 
Sbjct: 1270 NMHDLKFYKPMFEWGLQQPTSLIKLSIHGECLDVDSYPGERENGVMMLLPNSLSILCISY 1329

Query: 1321 FPMLHCLSSRGFQNLTSLEYLSISECPRLKSFPWEGLPSSLQQLYVEDCPQLGANC-KRY 1379
            F  L CLS +GFQNLTSL  L I  C +L S P EGLP SL QL + +CP L  +C    
Sbjct: 1330 FQNLECLSPKGFQNLTSLNQLKIYNCLKLTSLPKEGLPPSLTQLEIRNCPLLSQHCNNEK 1389

Query: 1380 GPEWSKIAHIPCVMIDMNFIHDPPIHD 1406
            G EWSKIAHIPCV+ID  FIH+    D
Sbjct: 1390 GQEWSKIAHIPCVLIDNKFIHETVTTD 1416

Source: Quercus suber

Species: Quercus suber

Genus: Quercus

Family: Fagaceae

Order: Fagales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225449649\|ref\|XP_002262753.1\| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356554923\|ref\|XP_003545790.1\| PREDICTED: putative disease resistance RPP13-like protein 1-like [Glycine max]	Back alignment and taxonomy information

>gi\|225450003\|ref\|XP_002272221.1\| PREDICTED: putative disease resistance RPP13-like protein 1 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359495024\|ref\|XP_002267933.2\| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225450019\|ref\|XP_002272632.1\| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] gi\|451798996\|gb\|AGF69196.1\| disease resistance protein At3g14460-like protein 3 [Vitis labrusca]	Back alignment and taxonomy information

>gi\|225450005\|ref\|XP_002272291.1\| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359487424\|ref\|XP_002271822.2\| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359487422\|ref\|XP_002271916.2\| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359487416\|ref\|XP_002272889.2\| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1422
TAIR\|locus:2091672		1054	AT3G14470 [Arabidopsis thalian	0.606	0.817	0.393	2.7e-167
TAIR\|locus:2091662		1424	AT3G14460 [Arabidopsis thalian	0.593	0.592	0.358	1.1e-126
UNIPROTKB\|O48647		1802	O48647 "XA1" [Oryza sativa (ta	0.793	0.625	0.290	3.8e-84
TAIR\|locus:2078012		852	ZAR1 "HOPZ-ACTIVATED RESISTANC	0.488	0.814	0.309	2.4e-66
TAIR\|locus:504956186		1138	AT1G58602 [Arabidopsis thalian	0.620	0.775	0.266	4.9e-49
TAIR\|locus:504956483		847	AT3G46730 [Arabidopsis thalian	0.525	0.881	0.269	7.9e-49
TAIR\|locus:2075170		835	RPP13 "RECOGNITION OF PERONOSP	0.519	0.885	0.268	9.5e-47
TAIR\|locus:2037623		899	AT1G58410 [Arabidopsis thalian	0.533	0.843	0.249	1.4e-46
TAIR\|locus:504956182		1049	AT1G58848 [Arabidopsis thalian	0.507	0.688	0.273	2.7e-46
TAIR\|locus:2826978		1049	AT1G59218 [Arabidopsis thalian	0.507	0.688	0.273	2.7e-46

TAIR\|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1582 (562.0 bits), Expect = 2.7e-167, Sum P(2) = 2.7e-167
 Identities = 366/931 (39%), Positives = 556/931 (59%)

Query:     3 VGEVFLGAFLDILFDRLAPDNLRLFPSEDGIRAEL-KKWEKNLVMIQAVLEDAEEKQLSN 61
             +GE+FL AFL  LF  L  +  R F     +   L ++    L+ I AVL DAEEKQ++N
Sbjct:     4 IGEMFLAAFLQALFQTLVSEPFRSFFKRRELNENLLERLSTALLTITAVLIDAEEKQITN 63

Query:    62 RAVKIWLDDLRALAYDVEDILDEQQLTTRPSLSI-LQNLPSNLVSQI----NLG------ 110
               V+ W+++LR + Y  ED LD+   T    L+I  ++  SN + Q+    +LG      
Sbjct:    64 PVVEKWVNELRDVVYHAEDALDDIA-TEALRLNIGAESSSSNRLRQLRGRMSLGDFLDGN 122

Query:   111 -----SKIKEVTSRLEELCDRRNVLQLENTSSGTGRAASVSTVSWQRLHTTCLATEPAVY 165
                  +++++VT RLE L  +RN+L L+  ++          +  QRL TT L  E  V+
Sbjct:   123 SEHLETRLEKVTIRLERLASQRNILGLKELTA---------MIPKQRLPTTSLVDESEVF 173

Query:   166 GRDGDKAKVLDMVLSHDTNNDDVNF-------RVGKTTLARLVYNDLAVED-FNSRAWVC 217
             GRD DK +++  ++  +  ++ +          VGKTTL++L+YND  V   F ++ W  
Sbjct:   174 GRDDDKDEIMRFLIPENGKDNGITVVAIVGIGGVGKTTLSQLLYNDQHVRSYFGTKVWAH 233

Query:   218 VSDDFDILRISKAILESITLSSCDFKDLNPVQVKLKQEVAGR--KFLIVLDDVWSKNYGL 275
             VS++FD+ +I+K + ES+T   C+F DL+ +QVKLK+ + G    FL+VLDD+W++N+  
Sbjct:   234 VSEEFDVFKITKKVYESVTSRPCEFTDLDVLQVKLKERLTGTGLPFLLVLDDLWNENFAD 293

Query:   276 WEVLKSPFMAGAPGSKIIVTTRDENVALTLGCPGECHNLELLSDNDCWSVFKKHAFASRE 335
             W++L+ PF+  A GS+I+VTTR + VA ++ C    HNL+ LSD DCWS+F K  F ++E
Sbjct:   294 WDLLRQPFIHAAQGSQILVTTRSQRVA-SIMCAVHVHNLQPLSDGDCWSLFMKTVFGNQE 352

Query:   336 FVASSRLCNSEFVRRKVVEKCKGLPLAARTLGGLLRCKQRDAEWQDILNSNIWDL-SDDG 394
                +  + +   +  ++V KC+GLPLA +TLGG+LR + +  EW+ +L+S IWDL +D  
Sbjct:   353 PCLNREIGD---LAERIVHKCRGLPLAVKTLGGVLRFEGKVIEWERVLSSRIWDLPADKS 409

Query:   395 EIPAVLQLSYHHLPSHLKRCFAYCAIFPKDYEFEEKEVVLLWIAEGLIPQSTDYKQLEDV 454
              +  VL++SY++LP+HLKRCFAYC+IFPK + FE+ +VVLLW+AEG + Q+   K LE++
Sbjct:   410 NLLPVLRVSYYYLPAHLKRCFAYCSIFPKGHAFEKDKVVLLWMAEGFLQQTRSSKNLEEL 469

Query:   455 GVGYFRDLLSRSIFQQVNGDVSKFVMHDLINDLARSVSGETSFRLEDVSGANNRSQRFER 514
             G  YF +L SRS+ Q+     ++++MHD IN+LA+  SGE S + ED  G   + Q  ER
Sbjct:   470 GNEYFSELESRSLLQKTK---TRYIMHDFINELAQFASGEFSSKFED--GC--KLQVSER 522

Query:   515 ARHSSFISGDFDGKSKFEVFNKVEHLRTFWPIILHEGTRY--ITNFVLSEVLSKFKKLRV 572
              R+ S++  ++    +FE   +V+ LRTF P+ L   +R   +   V  ++L    +LRV
Sbjct:   523 TRYLSYLRDNYAEPMEFEALREVKFLRTFLPLSLTNSSRSCCLDQMVSEKLLPTLTRLRV 582

Query:   573 LSLRNYYITEVP-NSIRLLTHLRYLNFSGTRICHIPESVGFLSHLQILLLKDCHRLKKLP 631
             LSL +Y I  +P +  + ++H R+L+ S T +  +P+S+ ++ +LQ LLL  C  LK+LP
Sbjct:   583 LSLSHYKIARLPPDFFKNISHARFLDLSRTELEKLPKSLCYMYNLQTLLLSYCSSLKELP 642

Query:   632 TNVENLIDLLYFDISGQNLITEMPVGMNKLKCLLTLSNFVVGLNTGSGLEDLKSLKFLRG 691
             T++ NLI+L Y D+ G  L  +MP    +LK L TL+ F V  + GS + +L  L  L G
Sbjct:   643 TDISNLINLRYLDLIGTKL-RQMPRRFGRLKSLQTLTTFFVSASDGSRISELGGLHDLHG 701

Query:   692 KLCISKLRNVVQ--DITEPILSDKEDLEVLQLEWESLYLHESSECSRVP-----DINVLD 744
             KL I +L+ VV   D  E  L+ K+ L  +   W +     SSE +  P     +  V +
Sbjct:   702 KLKIVELQRVVDVADAAEANLNSKKHLREIDFVWRTG--SSSSENNTNPHRTQNEAEVFE 759

Query:   745 RLRPHGNLKELSINFYGGTKFPSWVGDPSFSSMVDLRLENCEKCTCLPALGALPSLKELT 804
             +LRPH ++++L+I  Y G +FP W+ DPSFS +V +RL  C+ CT LP+LG LP LKEL 
Sbjct:   760 KLRPHRHIEKLAIERYKGRRFPDWLSDPSFSRIVCIRLRECQYCTSLPSLGQLPCLKELH 819

Query:   805 IKGLRELITIGSEIY-GDDCLK-----PFQSLETLCFQNLGVWSHWDPIGEDGQVEKFPV 858
             I G+  L +IG + Y  D  L+     PF+SLETL F NL  W  W  +    + + FP 
Sbjct:   820 ISGMVGLQSIGRKFYFSDQQLRDQDQQPFRSLETLRFDNLPDWQEWLDVRVT-RGDLFPS 878

Query:   859 LRKLSILNCPRLSERLPDHLPSLEELEVRGC 889
             L+KL IL CP L+  LP  LPSL  L +  C
Sbjct:   879 LKKLFILRCPELTGTLPTFLPSLISLHIYKC 909

GO:0005576 "extracellular region" evidence=ISM

GO:0006952 "defense response" evidence=IEA;ISS

GO:0043531 "ADP binding" evidence=IEA

GO:0005515 "protein binding" evidence=IPI

GO:0009627 "systemic acquired resistance" evidence=RCA

GO:0009697 "salicylic acid biosynthetic process" evidence=RCA

TAIR\|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)]	Back alignment and assigned GO terms

TAIR\|locus:2078012 ZAR1 "HOPZ-ACTIVATED RESISTANCE 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:504956186 AT1G58602 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:504956483 AT3G46730 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2075170 RPP13 "RECOGNITION OF PERONOSPORA PARASITICA 13" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2037623 AT1G58410 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:504956182 AT1G58848 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2826978 AT1G59218 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00010803001	SubName- Full=Chromosome chr13 scaffold_286, whole genome shotgun sequence; (1418 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		1422
pfam00931		285	pfam00931, NB-ARC, NB-ARC domain	3e-71
PLN03210		1153	PLN03210, PLN03210, Resistant to P	2e-10
PLN03210		1153	PLN03210, PLN03210, Resistant to P	3e-10
PLN03210		1153	PLN03210, PLN03210, Resistant to P	1e-06
PRK15386		426	PRK15386, PRK15386, type III secretion protein Gog	3e-06
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	8e-06
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	1e-05
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	0.001
PLN03210		1153	PLN03210, PLN03210, Resistant to P	0.003

>gnl\|CDD\|216202 pfam00931, NB-ARC, NB-ARC domain	Back alignment and domain information

 Score =  239 bits (613), Expect = 3e-71
 Identities = 106/260 (40%), Positives = 152/260 (58%), Gaps = 12/260 (4%)

Query: 192 VGKTTLARLVYNDLAVED-FNSRAWVCVSDDFDILRISKAILESI--TLSSCDFKDLNPV 248
           VGKTTLA+ +YND +V   F+S AWV VS  +   R+ K IL+ +    S    K+ + +
Sbjct: 30  VGKTTLAKQIYNDDSVGGHFDSVAWVVVSKTYTEFRLQKDILQELGLDDSDWVEKNESEL 89

Query: 249 QVKLKQEVAGRKFLIVLDDVWSKNYGLWEVLKSPFMAGAPGSKIIVTTRDENVALTLGCP 308
            VK+K+ +  ++FL+VLDDVW KN   W+ +  PF  G  GS++IVTTR E+VA  +G  
Sbjct: 90  AVKIKEALLRKRFLLVLDDVWEKN--DWDKIGVPFPDGENGSRVIVTTRSESVAGRMGGT 147

Query: 309 GECHNLELLSDNDCWSVFKKHAFASREFVASSRLCNSEFVRRKVVEKCKGLPLAARTLGG 368
            + H +E L   + W +F    F              E V +++VEKCKGLPLA + LGG
Sbjct: 148 SKPHEVESLEPEESWELFSNKVFEKE----LPPCPELEEVAKEIVEKCKGLPLALKVLGG 203

Query: 369 LLRCKQRDAEWQDILNSNIWDL---SDDGEIPAVLQLSYHHLPSHLKRCFAYCAIFPKDY 425
           LL  K    EW+ +L     +L       E+ ++L LSY +LP HLKRCF Y A+FP+DY
Sbjct: 204 LLAFKSTVQEWEHVLEQLNNELAGRDGLNEVLSILSLSYDNLPMHLKRCFLYLALFPEDY 263

Query: 426 EFEEKEVVLLWIAEGLIPQS 445
              +++++ LWIAEG +  S
Sbjct: 264 NIRKEQLIKLWIAEGFVIPS 283

Length = 285

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|237954 PRK15386, PRK15386, type III secretion protein GogB; Provisional	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		1422
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	100.0
PLN03210		1153	Resistant to P. syringae 6; Provisional	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
PF00931		287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.93
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.93
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.91
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.91
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.9
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.88
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.88
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.87
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.82
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.57
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.51
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.48
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.46
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.41
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.39
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.33
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.31
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.21
PRK04841		903	transcriptional regulator MalT; Provisional	99.04
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	98.86
PRK00411		394	cdc6 cell division control protein 6; Reviewed	98.84
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	98.83
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	98.64
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	98.64
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.58
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.54
KOG4341		483	consensus F-box protein containing LRR [General fu	98.52
KOG4341		483	consensus F-box protein containing LRR [General fu	98.51
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.5
PF01637		234	Arch_ATPase: Archaeal ATPase; InterPro: IPR011579	98.49
COG2909		894	MalT ATP-dependent transcriptional regulator [Tran	98.48
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.46
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.41
PRK15386		426	type III secretion protein GogB; Provisional	98.41
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.38
PLN03150		623	hypothetical protein; Provisional	98.37
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.36
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	98.32
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.31
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.3
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	98.3
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.28
PRK15386		426	type III secretion protein GogB; Provisional	98.24
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.24
PLN03150		623	hypothetical protein; Provisional	98.23
PF05729		166	NACHT: NACHT domain	98.22
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.16
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.15
PTZ00112		1164	origin recognition complex 1 protein; Provisional	98.15
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	98.04
COG3903		414	Predicted ATPase [General function prediction only	98.03
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	97.96
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	97.94
COG2256		436	MGS1 ATPase related to the helicase subunit of the	97.82
PRK06893		229	DNA replication initiation factor; Validated	97.81
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	97.8
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.78
COG3899		849	Predicted ATPase [General function prediction only	97.76
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	97.74
PRK13342		413	recombination factor protein RarA; Reviewed	97.71
PF13173		128	AAA_14: AAA domain	97.7
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	97.66
PRK05564		313	DNA polymerase III subunit delta'; Validated	97.65
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	97.63
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	97.61
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	97.6
cd01128		249	rho_factor Transcription termination factor rho is	97.58
TIGR02903		615	spore_lon_C ATP-dependent protease, Lon family. Me	97.54
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.52
PRK04195		482	replication factor C large subunit; Provisional	97.51
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.51
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	97.5
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	97.49
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	97.49
PRK09376		416	rho transcription termination factor Rho; Provisio	97.46
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	97.45
PRK12402		337	replication factor C small subunit 2; Reviewed	97.44
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.43
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	97.42
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	97.41
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	97.4
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	97.37
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	97.33
PF13191		185	AAA_16: AAA ATPase domain; PDB: 2V1U_A.	97.32
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	97.31
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	97.29
PRK07471		365	DNA polymerase III subunit delta'; Validated	97.26
PLN03025		319	replication factor C subunit; Provisional	97.23
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	97.23
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	97.23
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	97.22
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	97.2
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	97.19
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.17
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	97.15
PRK09112		351	DNA polymerase III subunit delta'; Validated	97.12
PRK00440		319	rfc replication factor C small subunit; Reviewed	97.1
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	97.09
PRK07940		394	DNA polymerase III subunit delta'; Validated	97.09
PRK13341		725	recombination factor protein RarA/unknown domain f	97.06
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.05
PF05621		302	TniB: Bacterial TniB protein; InterPro: IPR008868	97.05
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.04
PRK14959		624	DNA polymerase III subunits gamma and tau; Provisi	97.03
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	97.03
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	97.03
PTZ00202		550	tuzin; Provisional	97.02
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	97.01
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	96.99
PRK08903		227	DnaA regulatory inactivator Hda; Validated	96.99
PF14516		331	AAA_35: AAA-like domain	96.99
PRK14954		620	DNA polymerase III subunits gamma and tau; Provisi	96.98
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	96.93
PRK08727		233	hypothetical protein; Validated	96.93
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	96.89
COG2255		332	RuvB Holliday junction resolvasome, helicase subun	96.89
KOG2028		554	consensus ATPase related to the helicase subunit o	96.88
PRK14087		450	dnaA chromosomal replication initiation protein; P	96.86
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	96.82
PRK09087		226	hypothetical protein; Validated	96.81
KOG2982		418	consensus Uncharacterized conserved protein [Funct	96.79
PRK08084		235	DNA replication initiation factor; Provisional	96.78
KOG2227		529	consensus Pre-initiation complex, subunit CDC6, AA	96.78
TIGR00767		415	rho transcription termination factor Rho. Members	96.74
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	96.73
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	96.71
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	96.7
TIGR01242		364	26Sp45 26S proteasome subunit P45 family. Many pro	96.61
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	96.55
PRK14971		614	DNA polymerase III subunits gamma and tau; Provisi	96.54
PHA02544		316	44 clamp loader, small subunit; Provisional	96.54
PRK14953		486	DNA polymerase III subunits gamma and tau; Provisi	96.52
KOG2543		438	consensus Origin recognition complex, subunit 5 [R	96.46
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	96.43
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	96.43
PRK14970		367	DNA polymerase III subunits gamma and tau; Provisi	96.42
PRK06305		451	DNA polymerase III subunits gamma and tau; Validat	96.39
PRK05642		234	DNA replication initiation factor; Validated	96.34
KOG1947		482	consensus Leucine rich repeat proteins, some prote	96.34
PRK14948		620	DNA polymerase III subunits gamma and tau; Provisi	96.26
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	96.23
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	96.19
PRK11331		459	5-methylcytosine-specific restriction enzyme subun	96.11
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	96.09
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	96.06
PRK06647		563	DNA polymerase III subunits gamma and tau; Validat	96.04
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	96.02
CHL00181		287	cbbX CbbX; Provisional	96.0
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	95.99
PRK14086		617	dnaA chromosomal replication initiation protein; P	95.95
CHL00095		821	clpC Clp protease ATP binding subunit	95.9
COG1373		398	Predicted ATPase (AAA+ superfamily) [General funct	95.89
PRK14088		440	dnaA chromosomal replication initiation protein; P	95.89
PRK00149		450	dnaA chromosomal replication initiation protein; R	95.82
PRK05707		328	DNA polymerase III subunit delta'; Validated	95.8
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	95.78
PRK07399		314	DNA polymerase III subunit delta'; Validated	95.76
PRK03992		389	proteasome-activating nucleotidase; Provisional	95.76
KOG2123		388	consensus Uncharacterized conserved protein [Funct	95.68
KOG1947		482	consensus Leucine rich repeat proteins, some prote	95.65
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	95.65
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	95.65
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	95.64
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	95.62
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	95.21
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	95.16
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	95.16
COG0593		408	DnaA ATPase involved in DNA replication initiation	95.09
PRK12608		380	transcription termination factor Rho; Provisional	95.01
PF05659		147	RPW8: Arabidopsis broad-spectrum mildew resistance	95.01
PRK04132		846	replication factor C small subunit; Provisional	94.97
PRK06620		214	hypothetical protein; Validated	94.94
PRK12422		445	chromosomal replication initiation protein; Provis	94.75
PRK08769		319	DNA polymerase III subunit delta'; Validated	94.63
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	94.62
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	94.62
PRK08058		329	DNA polymerase III subunit delta'; Validated	94.61
COG3267		269	ExeA Type II secretory pathway, component ExeA (pr	94.6
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	94.59
PRK08116		268	hypothetical protein; Validated	94.39
PF00004		132	AAA: ATPase family associated with various cellula	94.38
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	94.38
PRK06871		325	DNA polymerase III subunit delta'; Validated	94.24
PF05673		249	DUF815: Protein of unknown function (DUF815); Inte	94.18
PRK10865		857	protein disaggregation chaperone; Provisional	93.98
KOG0473		326	consensus Leucine-rich repeat protein [Function un	93.88
PF04665		241	Pox_A32: Poxvirus A32 protein; InterPro: IPR006758	93.85
TIGR03689		512	pup_AAA proteasome ATPase. In the Actinobacteria,	93.77
smart00382		148	AAA ATPases associated with a variety of cellular	93.67
TIGR00763		775	lon ATP-dependent protease La. This protein is ind	93.66
PRK10787		784	DNA-binding ATP-dependent protease La; Provisional	93.59
KOG2123		388	consensus Uncharacterized conserved protein [Funct	93.54
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	93.47
TIGR00602		637	rad24 checkpoint protein rad24. This family is bas	93.45
PTZ00454		398	26S protease regulatory subunit 6B-like protein; P	93.37
PTZ00361		438	26 proteosome regulatory subunit 4-like protein; P	93.3
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	93.17
CHL00176		638	ftsH cell division protein; Validated	93.01
PRK10865		857	protein disaggregation chaperone; Provisional	93.0
PRK08118		167	topology modulation protein; Reviewed	92.9
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	92.89
cd01133		274	F1-ATPase_beta F1 ATP synthase beta subunit, nucle	92.88
PRK08939		306	primosomal protein DnaI; Reviewed	92.7
PF07693		325	KAP_NTPase: KAP family P-loop domain; InterPro: IP	92.6
PF13177		162	DNA_pol3_delta2: DNA polymerase III, delta subunit	92.59
TIGR01241		495	FtsH_fam ATP-dependent metalloprotease FtsH. HflB(	92.43
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	92.43
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	92.31
PRK10536		262	hypothetical protein; Provisional	92.28
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	92.21
PRK07952		244	DNA replication protein DnaC; Validated	92.1
PRK07993		334	DNA polymerase III subunit delta'; Validated	91.97
KOG0741		744	consensus AAA+-type ATPase [Posttranslational modi	91.97
PRK06090		319	DNA polymerase III subunit delta'; Validated	91.75
cd00561		159	CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B	91.7
KOG0473		326	consensus Leucine-rich repeat protein [Function un	91.42
CHL00095		821	clpC Clp protease ATP binding subunit	91.35
COG2812		515	DnaX DNA polymerase III, gamma/tau subunits [DNA r	91.34
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	91.29
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	91.14
PRK06921		266	hypothetical protein; Provisional	90.82
KOG3864		221	consensus Uncharacterized conserved protein [Funct	90.6
PRK07261		171	topology modulation protein; Provisional	90.6
PF08423		256	Rad51: Rad51; InterPro: IPR013632 This domain is f	90.47
PRK06526		254	transposase; Provisional	90.36
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	90.21
COG1222		406	RPT1 ATP-dependent 26S proteasome regulatory subun	90.2
COG0470		325	HolB ATPase involved in DNA replication [DNA repli	90.1
PF02562		205	PhoH: PhoH-like protein; InterPro: IPR003714 PhoH	89.69
KOG0735		952	consensus AAA+-type ATPase [Posttranslational modi	89.65
PRK12377		248	putative replication protein; Provisional	89.51
PRK09183		259	transposase/IS protein; Provisional	89.43
cd01123		235	Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r	89.42
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	89.39
PRK06964		342	DNA polymerase III subunit delta'; Validated	89.35
PRK08181		269	transposase; Validated	89.29
KOG3864		221	consensus Uncharacterized conserved protein [Funct	89.25
PF00158		168	Sigma54_activat: Sigma-54 interaction domain; Inte	89.17
KOG1514		767	consensus Origin recognition complex, subunit 1, a	89.13
cd01393		226	recA_like RecA is a bacterial enzyme which has rol	89.06
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	89.0
PF14532		138	Sigma54_activ_2: Sigma-54 interaction domain; PDB:	88.95
KOG2228		408	consensus Origin recognition complex, subunit 4 [R	88.81
PF12061		402	DUF3542: Protein of unknown function (DUF3542); In	88.81
PRK09361		225	radB DNA repair and recombination protein RadB; Pr	88.22
PRK04296		190	thymidine kinase; Provisional	88.17
PLN03187		344	meiotic recombination protein DMC1 homolog; Provis	87.93
COG2607		287	Predicted ATPase (AAA+ superfamily) [General funct	87.71
TIGR02238		313	recomb_DMC1 meiotic recombinase Dmc1. This model d	87.55
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	87.54
TIGR02237		209	recomb_radB DNA repair and recombination protein R	87.46
smart00370		26	LRR Leucine-rich repeats, outliers.	87.43
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	87.43
PRK08699		325	DNA polymerase III subunit delta'; Validated	87.35
PRK07132		299	DNA polymerase III subunit delta'; Validated	87.22
PF07728		139	AAA_5: AAA domain (dynein-related subfamily); Inte	86.7
PF00006		215	ATP-synt_ab: ATP synthase alpha/beta family, nucle	86.6
cd01394		218	radB RadB. The archaeal protein radB shares simila	86.4
COG1875		436	NYN ribonuclease and ATPase of PhoH family domains	86.28
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	86.19
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	86.17
cd01135		276	V_A-ATPase_B V/A-type ATP synthase (non-catalytic)	86.16
TIGR02239		316	recomb_RAD51 DNA repair protein RAD51. This eukary	85.9
PRK11608		326	pspF phage shock protein operon transcriptional ac	85.82
KOG1051		898	consensus Chaperone HSP104 and related ATP-depende	85.68
PRK15429		686	formate hydrogenlyase transcriptional activator Fh	85.23
PRK13695		174	putative NTPase; Provisional	85.03
cd03221		144	ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is	84.88
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	84.87
CHL00195		489	ycf46 Ycf46; Provisional	84.76
cd00983		325	recA RecA is a bacterial enzyme which has roles in	84.68
TIGR02012		321	tigrfam_recA protein RecA. This model describes or	84.52
COG1484		254	DnaC DNA replication protein [DNA replication, rec	84.23
PRK04301		317	radA DNA repair and recombination protein RadA; Va	84.1
TIGR00708		173	cobA cob(I)alamin adenosyltransferase. Alternate n	84.08
PRK09354		349	recA recombinase A; Provisional	84.02
TIGR01040		466	V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit. Th	83.98
TIGR02902		531	spore_lonB ATP-dependent protease LonB. Members of	83.91
PTZ00185		574	ATPase alpha subunit; Provisional	83.63
TIGR02974		329	phageshock_pspF psp operon transcriptional activat	83.6
smart00763		361	AAA_PrkA PrkA AAA domain. This is a family of PrkA	83.51
PRK09280		463	F0F1 ATP synthase subunit beta; Validated	83.48
PLN03186		342	DNA repair protein RAD51 homolog; Provisional	83.39
PRK06835		329	DNA replication protein DnaC; Validated	83.35
cd03247		178	ABCC_cytochrome_bd The CYD subfamily implicated in	83.26
cd03214		180	ABC_Iron-Siderophores_B12_Hemin ABC transporters,	82.8
PRK05541		176	adenylylsulfate kinase; Provisional	82.71
KOG0731		774	consensus AAA+-type ATPase containing the peptidas	82.62
PRK05022		509	anaerobic nitric oxide reductase transcription reg	82.57
PHA02244		383	ATPase-like protein	82.56
TIGR00150		133	HI0065_YjeE ATPase, YjeE family. Members of this f	82.29
TIGR02236		310	recomb_radA DNA repair and recombination protein R	82.26
PRK06067		234	flagellar accessory protein FlaH; Validated	81.88
KOG1969		877	consensus DNA replication checkpoint protein CHL12	81.74
cd03238		176	ABC_UvrA The excision repair protein UvrA; Nucleot	81.43
PRK12597		461	F0F1 ATP synthase subunit beta; Provisional	81.27
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	81.25
COG1157		441	FliI Flagellar biosynthesis/type III secretory pat	80.94
TIGR03305		449	alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit	80.87
KOG0734		752	consensus AAA+-type ATPase containing the peptidas	80.81
COG0468		279	RecA RecA/RadA recombinase [DNA replication, recom	80.58
cd03228		171	ABCC_MRP_Like The MRP (Mutidrug Resistance Protein	80.56
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	80.49
cd03222		177	ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi	80.43
COG1066		456	Sms Predicted ATP-dependent serine protease [Postt	80.32
cd03223		166	ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass	80.01

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

Probab=100.00  E-value=3.8e-82  Score=780.41  Aligned_cols=800  Identities=28%  Similarity=0.421  Sum_probs=577.6

Q ss_pred             cccccchHHHHHHHHHHHHHHHHHHHHHHhhccCcHHHHHHHHHHHHHHHhhhhhhhhhhhcC---C--CCCC---Cccc
Q 000559           27 FPSEDGIRAELKKWEKNLVMIQAVLEDAEEKQLSNRAVKIWLDDLRALAYDVEDILDEQQLTT---R--PSLS---ILQN   98 (1422)
Q Consensus        27 ~~~~~~v~~~~~~L~~~l~~i~~~l~~a~~~~~~~~~~~~wl~~lr~~~yd~ed~ld~~~~~~---~--~~~~---~~~~   98 (1422)
                      +....++++.+..|++++..++++++||++++.....+..|.+.+++++|++||.++.+.+..   .  ....   ....
T Consensus        20 ~~~~~~~~~~i~~Lk~~L~~l~~~l~d~~a~~~~~~~~~~~~e~~~~~~~~~e~~~~~~~v~~~~~~~~~~l~~~~~~~~   99 (889)
T KOG4658|consen   20 SECLDGKDNYILELKENLKALQSALEDLDAKRDDLERRVNWEEDVGDLVYLAEDIIWLFLVEEIERKANDLLSTRSVERQ   99 (889)
T ss_pred             HHHHhchHHHHHHHHHHHHHHHHHHHHHHhhcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHhhhhHHHHH
Confidence            334467788999999999999999999999999889999999999999999999999998621   1  0000   0111


Q ss_pred             CCCchhhhhhHHHHHHHHHHHHHHHHhhhhccccccCCCCCCCcccccccccccccccccCCCCcccccchhHHHHHHHh
Q 000559           99 LPSNLVSQINLGSKIKEVTSRLEELCDRRNVLQLENTSSGTGRAASVSTVSWQRLHTTCLATEPAVYGRDGDKAKVLDMV  178 (1422)
Q Consensus        99 ~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vGr~~~~~~i~~~l  178 (1422)
                      ......+.++.+..+..+.+++..+.+....++....-...+.   . .......++.+...+.. ||.++.++++++.|
T Consensus       100 ~~c~~~~~~~~~~~~~~~~~rv~~~l~~ve~l~~~~~~~~~~~---~-~~~~~~~e~~~~~~~~~-VG~e~~~~kl~~~L  174 (889)
T KOG4658|consen  100 RLCLCGFCSKNVSDSYKYGKRVSKVLREVESLGSKGVFEVVGE---S-LDPREKVETRPIQSESD-VGLETMLEKLWNRL  174 (889)
T ss_pred             HHhhhhhHhHhhhhhHhHHHHHHHHHHHHHHhccccceecccc---c-ccchhhcccCCCCcccc-ccHHHHHHHHHHHh
Confidence            1111245556666777777777777766666654432110110   0 11111223444444555 99999999999999


Q ss_pred             cCCCCCCCcccc----cccHHHHHHHHhcccc-ccc-CCcEEEEEEcCcccHHHHHHHHHHHhcCCCCCC--CChhHHHH
Q 000559          179 LSHDTNNDDVNF----RVGKTTLARLVYNDLA-VED-FNSRAWVCVSDDFDILRISKAILESITLSSCDF--KDLNPVQV  250 (1422)
Q Consensus       179 ~~~~~~~~~v~i----GvGKTtLa~~v~~~~~-~~~-F~~~~wv~~s~~~~~~~~~~~i~~~l~~~~~~~--~~~~~~~~  250 (1422)
                      .+++.  +++||    |+||||||++++|+.. ++. ||.++||+||+.++...++++|++.++......  ...++.+.
T Consensus       175 ~~d~~--~iv~i~GMGGvGKTTL~~qi~N~~~~v~~~Fd~~iWV~VSk~f~~~~iq~~Il~~l~~~~~~~~~~~~~~~~~  252 (889)
T KOG4658|consen  175 MEDDV--GIVGIYGMGGVGKTTLARQIFNKFDEVGNHFDGVIWVVVSKEFTTRKIQQTILERLGLLDEEWEDKEEDELAS  252 (889)
T ss_pred             ccCCC--CEEEEECCCcccHHHHHHHHhcccchhcccCceEEEEEEcccccHHhHHHHHHHHhccCCcccchhhHHHHHH
Confidence            98876  56666    9999999999999998 777 999999999999999999999999998744322  23468889


Q ss_pred             HHHHHhccceeEEEeccCCCCCccchhhhhccCCCCCCCcEEEEEcCChHHHHh-hCCCCceeeCCCCChhhHHHHHHHh
Q 000559          251 KLKQEVAGRKFLIVLDDVWSKNYGLWEVLKSPFMAGAPGSKIIVTTRDENVALT-LGCPGECHNLELLSDNDCWSVFKKH  329 (1422)
Q Consensus       251 ~l~~~l~~k~~LlVlDdv~~~~~~~~~~l~~~~~~~~~gs~ilvTtR~~~v~~~-~~~~~~~~~l~~l~~~~~~~lf~~~  329 (1422)
                      .+.+.|++|||+|||||||+.  .+|+.++.++|....||||++|||++.|+.. +++. ..+++++|+.+|||+||++.
T Consensus       253 ~i~~~L~~krfllvLDDIW~~--~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~~-~~~~v~~L~~~eaW~LF~~~  329 (889)
T KOG4658|consen  253 KLLNLLEGKRFLLVLDDIWEE--VDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGVD-YPIEVECLTPEEAWDLFQKK  329 (889)
T ss_pred             HHHHHhccCceEEEEeccccc--ccHHhcCCCCCCccCCeEEEEEeccHhhhhccccCC-ccccccccCccccHHHHHHh
Confidence            999999999999999999999  7799999999999899999999999999988 6664 89999999999999999999


Q ss_pred             hhcCCCccccccccchHHHHHHHHHHhCCCchHHHHHHHHHhcCCChHHHHHHHhccccCCCC-----CCChhHHHHHhh
Q 000559          330 AFASREFVASSRLCNSEFVRRKVVEKCKGLPLAARTLGGLLRCKQRDAEWQDILNSNIWDLSD-----DGEIPAVLQLSY  404 (1422)
Q Consensus       330 a~~~~~~~~~~~~~~~~~~~~~i~~~c~glPLai~~~~~~l~~~~~~~~w~~~l~~~~~~~~~-----~~~i~~~l~~sy  404 (1422)
                      ||..... .++   .++++|++|+++|+|+|||++++|+.|+.|.+..+|+++.+...+....     .+.+++++++||
T Consensus       330 v~~~~~~-~~~---~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSy  405 (889)
T KOG4658|consen  330 VGPNTLG-SHP---DIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEESILPILKLSY  405 (889)
T ss_pred             hcccccc-ccc---cHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhhhHHhhhccH
Confidence            9875332 233   5889999999999999999999999999999999999999876555221     237999999999


Q ss_pred             ccCchhhhHHhhhhccCCCCcccChHHHHHHHHHhCCcCCCCCchhHHHHHHHHHHHHHhcccccccc--CCccccchhH
Q 000559          405 HHLPSHLKRCFAYCAIFPKDYEFEEKEVVLLWIAEGLIPQSTDYKQLEDVGVGYFRDLLSRSIFQQVN--GDVSKFVMHD  482 (1422)
Q Consensus       405 ~~L~~~~k~cfl~~~~fp~~~~i~~~~li~~w~a~g~i~~~~~~~~~~~~~~~~~~~L~~~~ll~~~~--~~~~~~~mH~  482 (1422)
                      +.||++.|.||+|||+||+||.|+++.|+.+|+||||+.+...+..++++|+.|+.+||+++|++...  ++..+|+|||
T Consensus       406 d~L~~~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~~~~~~~kmHD  485 (889)
T KOG4658|consen  406 DNLPEELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDEGRKETVKMHD  485 (889)
T ss_pred             hhhhHHHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccccceeEEEeeH
Confidence            99999999999999999999999999999999999999887778899999999999999999999865  4668899999


Q ss_pred             HHHHHHHHhcc-----cceEEeccc--cCCCCcccccccceEEeeeeCCCCCcccccccccCcccceecccccccCcccc
Q 000559          483 LINDLARSVSG-----ETSFRLEDV--SGANNRSQRFERARHSSFISGDFDGKSKFEVFNKVEHLRTFWPIILHEGTRYI  555 (1422)
Q Consensus       483 l~~~~~~~~~~-----~~~~~~~~~--~~~~~~~~~~~~~r~l~~~~~~~~~~~~~~~~~~~~~Lr~l~~~~~~~~~~~~  555 (1422)
                      +||++|.++++     ++...+..+  .........+..+|+++++.......   ..-.+.++|+||.+..+..    .
T Consensus       486 vvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~---~~~~~~~~L~tLll~~n~~----~  558 (889)
T KOG4658|consen  486 VVREMALWIASDFGKQEENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHI---AGSSENPKLRTLLLQRNSD----W  558 (889)
T ss_pred             HHHHHHHHHhccccccccceEEECCcCccccccccchhheeEEEEeccchhhc---cCCCCCCccceEEEeecch----h
Confidence            99999999999     444444432  11123344556789999987765433   2334566899999887521    1


Q ss_pred             chhhhHHHhcCCCcccEEEecccc-cCccCccccCCCCcceeeecCccccccCcccccCcccceeecccccccCcccccc
Q 000559          556 TNFVLSEVLSKFKKLRVLSLRNYY-ITEVPNSIRLLTHLRYLNFSGTRICHIPESVGFLSHLQILLLKDCHRLKKLPTNV  634 (1422)
Q Consensus       556 ~~~~~~~~~~~~~~Lr~L~L~~~~-i~~lp~~i~~L~~L~~L~L~~n~i~~lp~~~~~L~~L~~L~L~~~~~~~~lP~~i  634 (1422)
                      ...+...+|..++.||||||++|. +.++|++|+.|.+||||+|+++.|+.+|..+++|++|.+||+..+.....+|..+
T Consensus       559 l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~i~  638 (889)
T KOG4658|consen  559 LLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTGISHLPSGLGNLKKLIYLNLEVTGRLESIPGIL  638 (889)
T ss_pred             hhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCCCccccchHHHHHHhhheeccccccccccccchh
Confidence            244566779999999999999876 7899999999999999999999999999999999999999999987777777777


Q ss_pred             ccccccCeEeecCCCccccccccccccccccccceeEeccCCCCChhcccccccCC---ceeEEeCccccccccccccCC
Q 000559          635 ENLIDLLYFDISGQNLITEMPVGMNKLKCLLTLSNFVVGLNTGSGLEDLKSLKFLR---GKLCISKLRNVVQDITEPILS  711 (1422)
Q Consensus       635 ~~L~~L~~L~l~~~~~~~~~p~~i~~L~~L~~L~~~~~~~~~~~~i~~l~~L~~L~---~~l~i~~l~~~~~~~~~~~l~  711 (1422)
                      ..|.+||+|.+.... ...-...++.+.+|++|........+...+..+..+..|+   ..+.+   ...........+.
T Consensus       639 ~~L~~Lr~L~l~~s~-~~~~~~~l~el~~Le~L~~ls~~~~s~~~~e~l~~~~~L~~~~~~l~~---~~~~~~~~~~~~~  714 (889)
T KOG4658|consen  639 LELQSLRVLRLPRSA-LSNDKLLLKELENLEHLENLSITISSVLLLEDLLGMTRLRSLLQSLSI---EGCSKRTLISSLG  714 (889)
T ss_pred             hhcccccEEEeeccc-cccchhhHHhhhcccchhhheeecchhHhHhhhhhhHHHHHHhHhhhh---cccccceeecccc
Confidence            889999999997654 1111122555566666654444433332223333333332   11111   1122334455667


Q ss_pred             CCCccCcEEEEEeccccCCCcccCCcchHHHhcccCCCCCccEEEEEeECCCCCCCCCCCCCCCcccEEEEeCCCCCCcC
Q 000559          712 DKEDLEVLQLEWESLYLHESSECSRVPDINVLDRLRPHGNLKELSINFYGGTKFPSWVGDPSFSSMVDLRLENCEKCTCL  791 (1422)
Q Consensus       712 ~~~~L~~L~l~~n~~~~~~~~~~~~~~~~~~l~~l~~~~~L~~L~l~~~~~~~~p~~~~~~~l~~L~~L~L~~~~~~~~l  791 (1422)
                      .+.+|+.|.+...........   .......+.   .++++..+.+.++.....+.|...  .++|+.|.+..|...+.+
T Consensus       715 ~l~~L~~L~i~~~~~~e~~~~---~~~~~~~~~---~f~~l~~~~~~~~~~~r~l~~~~f--~~~L~~l~l~~~~~~e~~  786 (889)
T KOG4658|consen  715 SLGNLEELSILDCGISEIVIE---WEESLIVLL---CFPNLSKVSILNCHMLRDLTWLLF--APHLTSLSLVSCRLLEDI  786 (889)
T ss_pred             cccCcceEEEEcCCCchhhcc---cccccchhh---hHHHHHHHHhhccccccccchhhc--cCcccEEEEecccccccC
Confidence            778888888775543211000   000000000   123444455555555556666532  578888888887755433


Q ss_pred             -CCCCCCCCcchhhhcCCcceeEecccccCCCCCCCCCcccee-ecccCCccccccccCCCCccccCcccceeecccCcc
Q 000559          792 -PALGALPSLKELTIKGLRELITIGSEIYGDDCLKPFQSLETL-CFQNLGVWSHWDPIGEDGQVEKFPVLRKLSILNCPR  869 (1422)
Q Consensus       792 -~~l~~l~~L~~L~l~~~~~~~~i~~~~~~~~~~~~f~~L~~L-~l~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~c~~  869 (1422)
                       |....+..++.+.+                    +|.+++.+ .+.+.+.+......+..     ++.|+.+.+..||+
T Consensus       787 i~~~k~~~~l~~~i~--------------------~f~~~~~l~~~~~l~~l~~i~~~~l~-----~~~l~~~~ve~~p~  841 (889)
T KOG4658|consen  787 IPKLKALLELKELIL--------------------PFNKLEGLRMLCSLGGLPQLYWLPLS-----FLKLEELIVEECPK  841 (889)
T ss_pred             CCHHHHhhhcccEEe--------------------cccccccceeeecCCCCceeEecccC-----ccchhheehhcCcc
Confidence             33333333333111                    14444444 34444443332222221     55577777777777


Q ss_pred             ccccCCCCCCCccEEEEeCC
Q 000559          870 LSERLPDHLPSLEELEVRGC  889 (1422)
Q Consensus       870 l~~~~p~~l~~L~~L~l~~~  889 (1422)
                      +. .    +|.+.++.+.+|
T Consensus       842 l~-~----~P~~~~~~i~~~  856 (889)
T KOG4658|consen  842 LG-K----LPLLSTLTIVGC  856 (889)
T ss_pred             cc-c----Cccccccceecc
Confidence            65 3    344555555554

>PLN03210 Resistant to P	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP	Back alignment and domain information

>COG2909 MalT ATP-dependent transcriptional regulator [Transcription]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>COG3903 Predicted ATPase [General function prediction only]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>COG3899 Predicted ATPase [General function prediction only]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK05564 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase	Back alignment and domain information

>TIGR02903 spore_lon_C ATP-dependent protease, Lon family	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK09376 rho transcription termination factor Rho; Provisional	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>PRK14959 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PTZ00202 tuzin; Provisional	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>PF14516 AAA_35: AAA-like domain	Back alignment and domain information

>PRK14954 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>TIGR00767 rho transcription termination factor Rho	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR01242 26Sp45 26S proteasome subunit P45 family	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>PRK14971 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>PRK14953 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14970 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06305 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>PRK14948 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>PRK06647 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>PRK05707 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>PRK07399 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK03992 proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK12608 transcription termination factor Rho; Provisional	Back alignment and domain information

>PF05659 RPW8: Arabidopsis broad-spectrum mildew resistance protein RPW8; InterPro: IPR008808 This entry represents the RPW8 domain found in several broad-spectrum mildew resistance proteins from Arabidopsis thaliana and other dicots	Back alignment and domain information

>PRK04132 replication factor C small subunit; Provisional	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK08769 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>PRK08058 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion]	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>PRK06871 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein	Back alignment and domain information

>TIGR03689 pup_AAA proteasome ATPase	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>TIGR00763 lon ATP-dependent protease La	Back alignment and domain information

>PRK10787 DNA-binding ATP-dependent protease La; Provisional	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>TIGR00602 rad24 checkpoint protein rad24	Back alignment and domain information

>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>CHL00176 ftsH cell division protein; Validated	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>PRK08118 topology modulation protein; Reviewed	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain	Back alignment and domain information

>PRK08939 primosomal protein DnaI; Reviewed	Back alignment and domain information

>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals	Back alignment and domain information

>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A	Back alignment and domain information

>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>PRK10536 hypothetical protein; Provisional	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>PRK07993 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK06090 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK07261 topology modulation protein; Provisional	Back alignment and domain information

>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]	Back alignment and domain information

>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli []	Back alignment and domain information

>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>PRK06964 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor	Back alignment and domain information

>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair]	Back alignment and domain information

>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H	Back alignment and domain information

>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair]	Back alignment and domain information

>PF12061 DUF3542: Protein of unknown function (DUF3542); InterPro: IPR021929 R1 is a gene for resistance to late blight, the most destructive disease in potato cultivation worldwide	Back alignment and domain information

>PRK09361 radB DNA repair and recombination protein RadB; Provisional	Back alignment and domain information

>PRK04296 thymidine kinase; Provisional	Back alignment and domain information

>PLN03187 meiotic recombination protein DMC1 homolog; Provisional	Back alignment and domain information

>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>TIGR02237 recomb_radB DNA repair and recombination protein RadB	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>PRK08699 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK07132 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane	Back alignment and domain information

>cd01394 radB RadB	Back alignment and domain information

>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only]	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B	Back alignment and domain information

>TIGR02239 recomb_RAD51 DNA repair protein RAD51	Back alignment and domain information

>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional	Back alignment and domain information

>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional	Back alignment and domain information

>PRK13695 putative NTPase; Provisional	Back alignment and domain information

>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>CHL00195 ycf46 Ycf46; Provisional	Back alignment and domain information

>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>TIGR02012 tigrfam_recA protein RecA	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK04301 radA DNA repair and recombination protein RadA; Validated	Back alignment and domain information

>TIGR00708 cobA cob(I)alamin adenosyltransferase	Back alignment and domain information

>PRK09354 recA recombinase A; Provisional	Back alignment and domain information

>TIGR01040 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit	Back alignment and domain information

>TIGR02902 spore_lonB ATP-dependent protease LonB	Back alignment and domain information

>PTZ00185 ATPase alpha subunit; Provisional	Back alignment and domain information

>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF	Back alignment and domain information

>smart00763 AAA_PrkA PrkA AAA domain	Back alignment and domain information

>PRK09280 F0F1 ATP synthase subunit beta; Validated	Back alignment and domain information

>PLN03186 DNA repair protein RAD51 homolog; Provisional	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis	Back alignment and domain information

>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea	Back alignment and domain information

>PRK05541 adenylylsulfate kinase; Provisional	Back alignment and domain information

>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional	Back alignment and domain information

>PHA02244 ATPase-like protein	Back alignment and domain information

>TIGR00150 HI0065_YjeE ATPase, YjeE family	Back alignment and domain information

>TIGR02236 recomb_radA DNA repair and recombination protein RadA	Back alignment and domain information

>PRK06067 flagellar accessory protein FlaH; Validated	Back alignment and domain information

>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion	Back alignment and domain information

>PRK12597 F0F1 ATP synthase subunit beta; Provisional	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1157 FliI Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta	Back alignment and domain information

>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair]	Back alignment and domain information

>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids	Back alignment and domain information

>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		1422
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	1e-112
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	7e-91
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-46
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	7e-11
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	9e-05
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-22
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	3e-19
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	6e-18
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	3e-17
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	3e-17
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-15
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	3e-13
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-09
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-09
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	6e-06
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	2e-16
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	4e-09
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	1e-06
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	3e-04
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	7e-16
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	6e-15
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	5e-07
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	7e-07
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	6e-05
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	4e-15
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-10
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	7e-10
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	3e-09
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-08
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-08
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-08
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	7e-07
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	6e-14
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	2e-11
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	4e-05
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	1e-13
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	4e-08
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	6e-07
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	8e-07
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-13
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-10
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	8e-09
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	5e-08
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	3e-07
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-06
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	4e-13
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	5e-11
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-07
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-06
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	4e-06
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-04
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	5e-13
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	1e-09
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	5e-09
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	6e-08
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	1e-04
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	5e-13
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	7e-13
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	4e-12
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-04
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-04
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-12
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	6e-10
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-09
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	7e-06
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-11
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	8e-11
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	4e-09
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	8e-07
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-05
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	2e-11
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-11
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-07
1o6v_A		466	Internalin A; bacterial infection, extracellular r	4e-07
1o6v_A		466	Internalin A; bacterial infection, extracellular r	3e-06
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	6e-11
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-10
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-10
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	3e-08
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	4e-10
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	8e-08
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-07
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-06
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-06
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-05
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	5e-10
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-07
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	9e-07
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	3e-06
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	1e-09
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	1e-09
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	3e-08
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	7e-05
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	7e-04
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	3e-09
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	3e-08
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	1e-05
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	8e-09
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	6e-07
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	1e-08
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	1e-08
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	4e-08
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	6e-08
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	4e-07
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	7e-06
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	6e-05
3qfl_A		115	MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-	1e-08
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	1e-08
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	5e-06
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	4e-08
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	8e-07
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	2e-06
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	3e-06
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	5e-05
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	5e-08
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	3e-07
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	4e-07
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	5e-07
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	2e-06
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	1e-04
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	7e-08
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	6e-05
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	2e-04
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	7e-08
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	6e-07
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	4e-05
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	8e-08
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	3e-07
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	9e-08
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	6e-05
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	9e-08
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	2e-06
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	2e-05
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	2e-05
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	2e-04
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	2e-07
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	8e-07
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	2e-04
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	3e-07
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	3e-06
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	4e-06
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	1e-04
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	5e-07
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	9e-07
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	5e-06
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	8e-07
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	3e-05
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-06
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-05
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	4e-04
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	2e-06
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	5e-05
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-06
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	5e-06
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	9e-05
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-04
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-04
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	3e-06
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	4e-06
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	3e-04
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	3e-04
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	4e-04
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	4e-04
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	9e-04
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	3e-06
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	2e-05
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	3e-05
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	6e-04
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	4e-06
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	9e-06
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-05
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-04
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	7e-04
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	9e-04
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	5e-06
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	3e-04
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	6e-06
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	2e-04
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	2e-04
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	4e-04
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	7e-06
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	1e-04
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	8e-06
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	4e-05
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	3e-04
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	6e-04
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	9e-04
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	2e-05
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	3e-05
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	8e-05
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	5e-04
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	7e-05
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	2e-04
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	2e-04
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	6e-04
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	6e-04

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591	Back alignment and structure

 Score =  366 bits (941), Expect = e-112
 Identities = 83/618 (13%), Positives = 194/618 (31%), Gaps = 96/618 (15%)

Query: 48  QAVLEDAEEKQLSNRAVKIWLDDLRA---LAYDVEDILDEQQLTTRPSLSILQNLPS--- 101
           +  L    E    +      +D + +   L    E+ +  +    + +  +++ +     
Sbjct: 6   RNCLLQHREALEKDIKTSYIMDHMISDGFLTISEEEKVRNEPTQQQRAAMLIKMILKKDN 65

Query: 102 ---NLVSQINLGSKIKEVTSRLEELCDRRNVLQLENTSSGTGRAASVSTVSWQRLHTTCL 158
                     L    K++ + L +     +    +++ SG      +++     L    +
Sbjct: 66  DSYVSFYNALLHEGYKDLAALLHDGIPVVSSSSGKDSVSG------ITSYVRTVLCEGGV 119

Query: 159 ATEPAVY-GRDGDKAKVLDMVLSHDTNNDDVNFRV---------GKTTLARLVYNDLAVE 208
              P V+  R      +   +                       GK+ LA     D ++ 
Sbjct: 120 PQRPVVFVTRKKLVNAIQQKLSK-----LKGEPGWVTIHGMAGCGKSVLAAEAVRDHSLL 174

Query: 209 D---FNSRAWVCVSDDFDILRISK------AILESITLSSCDFKDLNPVQVKLKQEVAGR 259
           +        WV V        + K       + +  + S     ++   + +L+  +  +
Sbjct: 175 EGCFPGGVHWVSVGKQDKSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLRK 234

Query: 260 --KFLIVLDDVWSKNYGLWEVLKSPFMAGAPGSKIIVTTRDENVALTLGCPGEC-HNLEL 316
             + L++LDDVW               A     +I++TTRD++V  ++  P         
Sbjct: 235 HPRSLLILDDVWDSWV---------LKAFDSQCQILLTTRDKSVTDSVMGPKYVVPVESS 285

Query: 317 LSDNDCWSVFKKHAFASREFVASSRLCNSEFVRRKVVEKCKGLPLAARTLGGLLRCKQRD 376
           L       +        +         +       ++++CKG PL    +G LLR     
Sbjct: 286 LGKEKGLEILSLFVNMKKA--------DLPEQAHSIIKECKGSPLVVSLIGALLRDFPNR 337

Query: 377 AE-WQDILNSNIWDLSDDGEIP------AVLQLSYHHLPSHLKRCFAYCAIFPKDYEFEE 429
            E +   L +  +                 + +S   L   +K  +   +I  KD +   
Sbjct: 338 WEYYLKQLQNKQFKRIRKSSSYDYEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPT 397

Query: 430 KEVVLLWIAEGLIPQSTDYKQLEDVGVGYFRDLLSRSIFQQV-NGDVSKFVMHDLINDLA 488
           K + +LW  E             +      ++ +++S+     NG   ++ +HDL  D  
Sbjct: 398 KVLCILWDME------------TEEVEDILQEFVNKSLLFCDRNGKSFRYYLHDLQVDFL 445

Query: 489 RSVSGETSFRLEDVSGANNRSQRFERARHSSFISGDFDGKSKFEVFN-KVEHLRTFWPII 547
              +     +L+D     ++    +  R+    +   D +     +N    H+ +    +
Sbjct: 446 TEKNC---SQLQD----LHKKIITQFQRYHQPHTLSPDQEDCMYWYNFLAYHMASA--KM 496

Query: 548 LHEGTRYITNFV-LSEVLSKFKKLRVLSLRNYY--ITEVPNSIRLLTHLRYLNFSGTRIC 604
             E    + +   +           ++     Y  I +  +         +L+ +G  + 
Sbjct: 497 HKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCAVSENFQEFLSLNGHLLG 556

Query: 605 HIPESVGFLSHLQILLLK 622
             P    F + +Q+ L +
Sbjct: 557 RQP----FPNIVQLGLCE 570

PyMOL of 1z6t

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} Length = 115	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		1422
d2a5yb3		277	c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor	6e-46
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	1e-05
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	0.001
d1a9na_		162	c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom	1e-05
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	9e-05
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	1e-04
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	0.003
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	0.004
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	4e-04
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	0.002

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score =  164 bits (417), Expect = 6e-46
 Identities = 42/285 (14%), Positives = 82/285 (28%), Gaps = 35/285 (12%)

Query: 151 QRLHTTCLATEPAVYGRDGDKAKVLDMVLSHDTNNDDVNF-----RVGKTTLARLVYND- 204
           ++L    +  +   Y R+    +V+  +      +    F       GK+ +A    +  
Sbjct: 9   RKLLLGNVPKQMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKS 68

Query: 205 --LAVEDFNSRAWVCVSDDFDILRISKAILESITLSSCDFKDLNP----------VQVKL 252
             L   +++S  W+  S               + L S D     P           ++  
Sbjct: 69  DQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMIC 128

Query: 253 KQEVAGRKFLIVLDDVWSKNYGLWEVLKSPFMAGAPGSKIIVTTRDENVALTLGCPGECH 312
              +     L V DDV  +    W              + +VTTRD  ++       E  
Sbjct: 129 NALIDRPNTLFVFDDVVQEETIRWAQ--------ELRLRCLVTTRDVEISNAASQTCEFI 180

Query: 313 NLELLSDNDCWSVFKKHAFASREFVASSRLCNSEFVRRKVVEKCKGLPLAARTLGGLLRC 372
            +  L  ++C+   + +            +        K +E   G P            
Sbjct: 181 EVTSLEIDECYDFLEAYGMPMPVGEKEEDVL------NKTIELSSGNPATLMMFFKSCEP 234

Query: 373 KQRDAEWQDILNSNIWDLSDDGEIPAVLQLSYHHLPSHLKRCFAY 417
           K  + +   + N    +      +  +   SY  L   L+RC   
Sbjct: 235 KTFE-KMAQLNNK--LESRGLVGVECITPYSYKSLAMALQRCVEV 276

PyMOL of d2a5yb3

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		1422
d2a5yb3		277	CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI	100.0
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.94
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.91
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.87
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.86
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.86
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.85
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.83
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.82
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.8
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.79
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.79
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.78
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.65
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.64
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.63
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.58
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.56
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.55
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.55
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.49
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.48
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.41
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.38
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.37
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.35
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.34
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.28
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.26
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.22
d2fnaa2		283	Archaeal ATPase SSO1545 {Sulfolobus solfataricus [	99.11
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.03
d2ifga3		156	High affinity nerve growth factor receptor, N-term	99.03
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.98
d1fnna2		276	CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T	98.75
d1sxjd2		237	Replication factor C2 {Baker's yeast (Saccharomyce	98.57
d1sxjb2		224	Replication factor C4 {Baker's yeast (Saccharomyce	98.56
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.54
d1sxjc2		227	Replication factor C3 {Baker's yeast (Saccharomyce	98.53
d1njfa_		239	delta prime subunit of DNA polymerase III, N-domai	98.43
d1r6bx2		268	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	98.39
d1iqpa2		231	Replication factor C {Archaeon Pyrococcus furiosus	98.31
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	98.29
d1sxje2		252	Replication factor C5 {Baker's yeast (Saccharomyce	98.17
d1w5sa2		287	CDC6-like protein APE0152, N-terminal domain {Aero	98.1
d1sxja2		253	Replication factor C1 {Baker's yeast (Saccharomyce	98.08
d1qvra2		387	ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2	98.07
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	98.0
d1a5ta2		207	delta prime subunit of DNA polymerase III, N-domai	97.98
d1jbka_		195	ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	97.83
d1in4a2		238	Holliday junction helicase RuvB {Thermotoga mariti	97.62
d1l8qa2		213	Chromosomal replication initiation factor DnaA {Aq	97.58
d1lv7a_		256	AAA domain of cell division protein FtsH {Escheric	97.53
d1ixsb2		239	Holliday junction helicase RuvB {Thermus thermophi	97.49
d1d2na_		246	Hexamerization domain of N-ethylmalemide-sensitive	97.43
d1ixza_		247	AAA domain of cell division protein FtsH {Thermus	97.32
d1e32a2		258	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	97.22
d1r7ra3		265	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	97.2
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	96.54
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	96.34
d1qvra3		315	ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2	96.23
d1mo6a1		269	RecA protein, ATPase-domain {Mycobacterium tubercu	96.01
d1r6bx3		315	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	95.65
d2gnoa2		198	gamma subunit of DNA polymerase III, N-domain {The	95.63
d1u94a1		263	RecA protein, ATPase-domain {Escherichia coli [Tax	95.25
d1xp8a1		268	RecA protein, ATPase-domain {Deinococcus radiodura	95.12
d2jdid3		276	Central domain of beta subunit of F1 ATP synthase	94.89
d1xpua3		289	Transcription termination factor Rho, ATPase domai	93.76
d2qy9a2		211	GTPase domain of the signal recognition particle r	93.12
d1okkd2		207	GTPase domain of the signal recognition particle r	93.04
d1j8yf2		211	GTPase domain of the signal sequence recognition p	93.0
d1ls1a2		207	GTPase domain of the signal sequence recognition p	92.56
d1ny5a2		247	Transcriptional activator sigm54 (NtrC1), C-termin	92.35
d1vmaa2		213	GTPase domain of the signal recognition particle r	92.35
d1m8pa3		183	ATP sulfurylase C-terminal domain {Fungus (Penicil	91.45
d1rz3a_		198	Hypothetical protein rbstp0775 {Bacillus stearothe	91.26
d1ofha_		309	HslU {Haemophilus influenzae [TaxId: 727]}	90.97
d1tf7a2		242	Circadian clock protein KaiC {Synechococcus sp. st	90.91
d1odfa_		286	Hypothetical protein Ygr205W {Baker's yeast (Sacch	90.03
d1g8pa_		333	ATPase subunit of magnesium chelatase, BchI {Rhodo	89.92
d1kaga_		169	Shikimate kinase (AroK) {Escherichia coli [TaxId:	89.01
d1lw7a2		192	Transcriptional regulator NadR, ribosylnicotinamid	88.97
d1um8a_		364	ClpX {Helicobacter pylori [TaxId: 210]}	88.31
d1gvnb_		273	Plasmid maintenance system epsilon/zeta, toxin zet	87.65
d1sq5a_		308	Pantothenate kinase PanK {Escherichia coli [TaxId:	87.54
d1fx0a3		276	Central domain of alpha subunit of F1 ATP synthase	87.06
d1xjca_		165	Molybdopterin-guanine dinucleotide biosynthesis pr	87.03
d1np6a_		170	Molybdopterin-guanine dinucleotide biosynthesis pr	86.72
d1rkba_		173	Adenylate kinase {Human (Homo sapiens), isoenzyme	86.22
d2iyva1		165	Shikimate kinase (AroK) {Mycobacterium tuberculosi	86.0
d2bdta1		176	Hypothetical protein BH3686 {Bacillus halodurans [	85.62
d1bifa1		213	6-phosphofructo-2-kinase/fructose-2,6-bisphosphata	85.53
d4tmka_		210	Thymidylate kinase {Escherichia coli [TaxId: 562]}	85.46
d1e6ca_		170	Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax	85.43
d2qm8a1		323	Metallochaperone MeaB {Methylobacterium extorquens	84.76
d1yj5a2		172	5' polynucleotide kinase-3' phosphatase, C-termina	84.75
d1x6va3		195	Adenosine-5'phosphosulfate kinase (APS kinase) {Hu	84.48
d1nn5a_		209	Thymidylate kinase {Human (Homo sapiens) [TaxId: 9	84.19
d2i3ba1		189	Cancer-related NTPase, C1orf57 {Human (Homo sapien	83.93
d1viaa_		161	Shikimate kinase (AroK) {Campylobacter jejuni [Tax	83.72
d1gsia_		208	Thymidylate kinase {Mycobacterium tuberculosis [Ta	83.63
d1ly1a_		152	Polynucleotide kinase, kinase domain {Bacteriophag	83.57
d2p67a1		327	LAO/AO transport system kinase ArgK {Escherichia c	83.54
d1uj2a_		213	Uridine-cytidine kinase 2 {Human (Homo sapiens) [T	83.23
d2vp4a1		197	Deoxyribonucleoside kinase {Fruit fly (Drosophila	82.73
d1qhxa_		178	Chloramphenicol phosphotransferase {Streptomyces v	82.45
d1knqa_		171	Gluconate kinase {Escherichia coli [TaxId: 562]}	82.29
d2ocpa1		241	Deoxyguanosine kinase {Human (Homo sapiens) [TaxId	82.07
d1m7ga_		208	Adenosine-5'phosphosulfate kinase (APS kinase) {Fu	81.56
d1nksa_		194	Adenylate kinase {Archaeon Sulfolobus acidocaldari	81.4
d1y63a_		174	Probable kinase LmjF30.1890 {Leishmania major [Tax	80.31
d1htwa_		158	Hypothetical protein HI0065 {Haemophilus influenza	80.05
d1khta_		190	Adenylate kinase {Archaeon Methanococcus voltae [T	80.04

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=100.00  E-value=8.4e-45  Score=277.67  Aligned_cols=246  Identities=15%  Similarity=0.116  Sum_probs=185.2

Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHCCC-CCCCCCCCC----CCCHHHHHHHHHCCCC--CCC-CCCEEEEEECCCCCHHHH
Q ss_conf             44688983002302399999996079-999996431----3309999999935434--456-873899997686557899
Q 000559          156 TCLATEPAVYGRDGDKAKVLDMVLSH-DTNNDDVNF----RVGKTTLARLVYNDLA--VED-FNSRAWVCVSDDFDILRI  227 (1422)
Q Consensus       156 ~~~~~~~~~vgr~~~~~~i~~~l~~~-~~~~~~i~i----G~GKTtLa~~v~~~~~--~~~-f~~~~wv~~~~~~~~~~~  227 (1422)
                      ...+.++.++||+.++++|+++|... +...++|+|    |+||||||+++|++..  ... |++++||++++.++...+
T Consensus        14 ~~~p~~~~~~gR~~~~~~i~~~L~~~~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs~~~~~~~l   93 (277)
T d2a5yb3          14 GNVPKQMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTF   93 (277)
T ss_dssp             TTCBCCCCSCCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHH
T ss_pred             CCCCCCCCEECCHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCHHHH
T ss_conf             68999886237399999999998734687840899977997888999999998556554012764899993687777789


Q ss_pred             HHHHHHHH---CCCCC-----CC--CCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHCCCCCCCCCCEEEEECC
Q ss_conf             99999981---18889-----98--9924899999998516113799346777891105563024788999967999828
Q 000559          228 SKAILESI---TLSSC-----DF--KDLNPVQVKLKQEVAGRKFLIVLDDVWSKNYGLWEVLKSPFMAGAPGSKIIVTTR  297 (1422)
Q Consensus       228 ~~~i~~~l---~~~~~-----~~--~~~~~~~~~l~~~l~~k~~LlVlDdv~~~~~~~~~~l~~~~~~~~~~s~iivTtR  297 (1422)
                      ...+...+   +....     ..  .........+...+.++|+|+||||||+.  ..|+.+..      .||+||||||
T Consensus        94 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~kr~LlVLDDv~~~--~~~~~~~~------~~srilvTTR  165 (277)
T d2a5yb3          94 DLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQE--ETIRWAQE------LRLRCLVTTR  165 (277)
T ss_dssp             HHHHHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCH--HHHHHHHH------TTCEEEEEES
T ss_pred             HHHHHHHHHHHCCHHHCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCHHHHH--HHHHHHCC------CCCEEEEEEE
T ss_conf             999999998722022027863212336999999999984468816752506677--66555204------5755999964


Q ss_pred             CHHHHHHHCCCCCEEECCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCHH
Q ss_conf             73899761889962609999935399999984505887432313664389999999970798158999988771189768
Q 000559          298 DENVALTLGCPGECHNLELLSDNDCWSVFKKHAFASREFVASSRLCNSEFVRRKVVEKCKGLPLAARTLGGLLRCKQRDA  377 (1422)
Q Consensus       298 ~~~v~~~~~~~~~~~~l~~l~~~~~~~lf~~~~~~~~~~~~~~~~~~~~~~~~~i~~~c~glPlai~~~~~~l~~~~~~~  377 (1422)
                      +..++..+....+++++++|+.++||+||.+++|....   .+   ...+++++|+++|||+|||++++|+.++.+ ..+
T Consensus       166 ~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~~---~~---~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k-~~~  238 (277)
T d2a5yb3         166 DVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPV---GE---KEEDVLNKTIELSSGNPATLMMFFKSCEPK-TFE  238 (277)
T ss_dssp             BGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC-----C---HHHHHHHHHHHHHTTCHHHHHHHHTTCCSS-SHH
T ss_pred             HHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHCCCCC---CH---HHHHHHHHHHHHHCCCHHHHHHHHHHHCCC-CHH
T ss_conf             48999863788716877889979999999998477667---42---567999999999589989999999986559-899


Q ss_pred             HHHHHHHCCCCCCCCCCCHHHHHHHHHCCCCHHHHHHHHHH
Q ss_conf             99999820146999999925999996405956566796451
Q 000559          378 EWQDILNSNIWDLSDDGEIPAVLQLSYHHLPSHLKRCFAYC  418 (1422)
Q Consensus       378 ~w~~~l~~~~~~~~~~~~i~~~l~~s~~~L~~~~k~~f~~~  418 (1422)
                      +|.+.......  ....++..++.+||++||+++|.||.++
T Consensus       239 ~~~~~~~~L~~--~~~~~v~~il~~sY~~L~~~lk~c~~~l  277 (277)
T d2a5yb3         239 KMAQLNNKLES--RGLVGVECITPYSYKSLAMALQRCVEVL  277 (277)
T ss_dssp             HHHHHHHHHHH--HCSSTTCCCSSSSSSSHHHHHHHHHHTS
T ss_pred             HHHHHHHHHHC--CCHHHHHHHHHHHHHCCCHHHHHHHHHC
T ss_conf             99999999734--8678899999998851269999999739

PyMOL of d2a5yb3

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}	Back information, alignment and structure

>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}	Back information, alignment and structure

>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]}	Back information, alignment and structure

>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]}	Back information, alignment and structure

>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]}	Back information, alignment and structure

>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}	Back information, alignment and structure

>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]}	Back information, alignment and structure

>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]}	Back information, alignment and structure

>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]}	Back information, alignment and structure

>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure

>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]}	Back information, alignment and structure

>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]}	Back information, alignment and structure

>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]}	Back information, alignment and structure

>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]}	Back information, alignment and structure

>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]}	Back information, alignment and structure

>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]}	Back information, alignment and structure

>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]}	Back information, alignment and structure