Citrus Sinensis ID: 000630
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1382 | 2.2.26 [Sep-21-2011] | |||||||
| Q40392 | 1144 | TMV resistance protein N | N/A | no | 0.627 | 0.757 | 0.317 | 1e-123 | |
| O23530 | 1301 | Protein SUPPRESSOR OF npr | no | no | 0.740 | 0.786 | 0.296 | 1e-121 | |
| O82500 | 1095 | Putative disease resistan | no | no | 0.578 | 0.729 | 0.301 | 1e-102 | |
| Q9SZ67 | 1895 | Probable WRKY transcripti | no | no | 0.549 | 0.401 | 0.278 | 3e-74 | |
| Q9FL92 | 1372 | Probable WRKY transcripti | no | no | 0.583 | 0.588 | 0.269 | 8e-68 | |
| Q9FH83 | 1288 | Probable WRKY transcripti | no | no | 0.509 | 0.546 | 0.280 | 2e-63 | |
| Q9FKN7 | 1613 | Protein DA1-related 4 OS= | no | no | 0.516 | 0.442 | 0.256 | 3e-47 | |
| Q9RBS2 | 1024 | Protein PopC OS=Ralstonia | yes | no | 0.305 | 0.412 | 0.298 | 5e-32 | |
| Q9BTT6 | 524 | Leucine-rich repeat-conta | yes | no | 0.305 | 0.805 | 0.311 | 4e-31 | |
| Q80VQ1 | 524 | Leucine-rich repeat-conta | yes | no | 0.254 | 0.671 | 0.325 | 2e-28 |
| >sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 444 bits (1143), Expect = e-123, Method: Compositional matrix adjust.
Identities = 305/961 (31%), Positives = 496/961 (51%), Gaps = 94/961 (9%)
Query: 12 RLRWDVFLSFRGEDTRDTITRNLYNSLHDHGVRVFKDDYGLARGDEIAPSLIDAIYDSAA 71
R +DVFLSFRGEDTR T T +LY L+D G++ F+DD L G I L AI +S
Sbjct: 9 RWSYDVFLSFRGEDTRKTFTSHLYEVLNDKGIKTFQDDKRLEYGATIPGELCKAIEESQF 68
Query: 72 SIIILSPNYGSSRWCLEELAKICE----LNRLILPVFYKVDPSDVRRQQGPFKQDFERHQ 127
+I++ S NY +SRWCL EL KI E + ++P+FY VDPS VR Q+ F + FE H+
Sbjct: 69 AIVVFSENYATSRWCLNELVKIMECKTRFKQTVIPIFYDVDPSHVRNQKESFAKAFEEHE 128
Query: 128 DRFGEDT--VSQWRKAMMKVGGISGWVFN-NSEEEQLVQLLVKRVLAELSNTPMKVAAYN 184
++ +D + +WR A+ + + G N + + ++ +V ++ ++L +
Sbjct: 129 TKYKDDVEGIQRWRIALNEAANLKGSCDNRDKTDADCIRQIVDQISSKLCKISLSYLQNI 188
Query: 185 VGLDFRIKEVIRLLDVKSSNVLVLGLFGLGGIGKTTLAKAVYNKLVD------QFEHRSF 238
VG+D ++++ LL++ + V ++G++G+GG+GKTT+A+A+++ L+ QF+ F
Sbjct: 189 VGIDTHLEKIESLLEIGINGVRIMGIWGMGGVGKTTIARAIFDTLLGRMDSSYQFDGACF 248
Query: 239 ISNVRETSGQNDGLVSLQNKLIFDLSSGNKVPTENVPTENVVTANIAEIKNVVRERKVFV 298
+ +++E G+ SLQN L+ +L N ++ + +R +KV +
Sbjct: 249 LKDIKENK---RGMHSLQNALLSEL-------LREKANYNNEEDGKHQMASRLRSKKVLI 298
Query: 299 VLDDVDDPSQ-LNALCGDKEWFSEGSRIIITTRDRGALPEHYVNQLYEVQKLDSSRALQL 357
VLDD+D+ L L GD +WF GSRIIITTRD+ + ++ + +YEV L ++QL
Sbjct: 299 VLDDIDNKDHYLEYLAGDLDWFGNGSRIIITTRDKHLIEKNDI--IYEVTALPDHESIQL 356
Query: 358 FSYHALGRENPTDKFFKISEQIVSLTGGLPLALEVFGAFLFDKRRITEWEDALEKLRKIR 417
F HA G+E P + F K+S ++V+ GLPLAL+V+G+ L + R+TEW+ A+E ++
Sbjct: 357 FKQHAFGKEVPNENFEKLSLEVVNYAKGLPLALKVWGSLLHN-LRLTEWKSAIEHMKNNS 415
Query: 418 PNNLQEVLKISFDGLDQQDKCIFLDIACLFVKMGMNKEDAIDILKGCGFRAEIAIVVLMK 477
+ + + LKIS+DGL+ + + +FLDIAC G K+ + IL+ C AE + +L+
Sbjct: 416 YSGIIDKLKISYDGLEPKQQEMFLDIACFL--RGEEKDYILQILESCHIGAEYGLRILID 473
Query: 478 KSLIKITEDDTLWMHDQLRDMGRQIVQQESLLDPGNRSRLWDRDEIMTMLKLRKGTRSIQ 537
KSL+ I+E + + MHD ++DMG+ IV + DPG RSRLW E+ ++ GT +++
Sbjct: 474 KSLVFISEYNQVQMHDLIQDMGKYIVNFQK--DPGERSRLWLAKEVEEVMSNNTGTMAME 531
Query: 538 GIVLDFKKEMVKESSAETSSRDNLQRSDLTSAITYLKGRYKKCLQHRTRSEREMILHTKP 597
I + SS ++ R +
Sbjct: 532 AIWV---------SSYSSTLR----------------------------------FSNQA 548
Query: 598 FESMVSLRLLQINYTKLEGSFKFLPHELKWLQWKDCKMKTLPSDFRPFQLAVLDLSESGI 657
++M LR+ + + + +LP+ L+ + ++ PS F L L L + +
Sbjct: 549 VKNMKRLRVFNMGRSSTHYAIDYLPNNLRCFVCTNYPWESFPSTFELKMLVHLQLRHNSL 608
Query: 658 EYLWGSHTNKVAKNLMVLNLRGCWNLASIPDLSEHQKLEKLVLERCCRLTKIHESVGNLS 717
+LW K +L ++L L PD + LE + L +C L ++H S+G S
Sbjct: 609 RHLWTE--TKHLPSLRRIDLSWSKRLTRTPDFTGMPNLEYVNLYQCSNLEEVHHSLGCCS 666
Query: 718 SLLHLNLRDCRNLIELPSDVSGLKHLENLILSDCSKLKELPEDICSMRSLKELLVDGTAI 777
++ L L DC++L P ++ LE L L C L++LPE M+ ++ + G+ I
Sbjct: 667 KVIGLYLNDCKSLKRFP--CVNVESLEYLGLRSCDSLEKLPEIYGRMKPEIQIHMQGSGI 724
Query: 778 EKLPQSIFHL-VKLEKLNLGKCKSLKQLPNCIGTQLIALKELSFN-YSAVEELPDSVGHM 835
+LP SIF + KL L K+L LP+ I +L +L LS + S +E LP+ +G +
Sbjct: 725 RELPSSIFQYKTHVTKLLLWNMKNLVALPSSI-CRLKSLVSLSVSGCSKLESLPEEIGDL 783
Query: 836 GNLEKLSLIGCGSITTI---PDSIGHLKSLIEFLI----DGTAVKNLPASIGSLSYLKAF 888
NL S T I P SI L LI + DG + P + G L L+
Sbjct: 784 DNLRVFD----ASDTLILRPPSSIIRLNKLIILMFRGFKDGVHFEFPPVAEG-LHSLEYL 838
Query: 889 SVGRCQFL-SELPDSIEGLASLVELQLDGTSIRHLPDQIGGLKMLDKLVMRNCLSLKTLP 947
++ C + LP+ I L+SL +L L + HLP I L L L +++C L LP
Sbjct: 839 NLSYCNLIDGGLPEEIGSLSSLKKLDLSRNNFEHLPSSIAQLGALQSLDLKDCQRLTQLP 898
Query: 948 D 948
+
Sbjct: 899 E 899
|
Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth. Nicotiana glutinosa (taxid: 35889) |
| >sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9FL92|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9FH83|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3 | Back alignment and function description |
|---|
| >sp|Q9FKN7|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 | Back alignment and function description |
|---|
| >sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=2 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1382 | ||||||
| 359473396 | 1438 | PREDICTED: TMV resistance protein N-like | 0.973 | 0.936 | 0.622 | 0.0 | |
| 224121242 | 1360 | tir-nbs-lrr resistance protein [Populus | 0.976 | 0.991 | 0.607 | 0.0 | |
| 147774849 | 1478 | hypothetical protein VITISV_004764 [Viti | 0.970 | 0.907 | 0.599 | 0.0 | |
| 359473398 | 1378 | PREDICTED: protein SUPPRESSOR OF npr1-1, | 0.979 | 0.982 | 0.591 | 0.0 | |
| 356524097 | 1447 | PREDICTED: TMV resistance protein N-like | 0.979 | 0.935 | 0.572 | 0.0 | |
| 357516577 | 1406 | Tir-nbs-lrr resistance protein [Medicago | 0.953 | 0.937 | 0.571 | 0.0 | |
| 356497814 | 1376 | PREDICTED: TMV resistance protein N-like | 0.978 | 0.982 | 0.551 | 0.0 | |
| 255558310 | 1349 | leucine-rich repeat containing protein, | 0.968 | 0.991 | 0.544 | 0.0 | |
| 297850940 | 1385 | predicted protein [Arabidopsis lyrata su | 0.968 | 0.966 | 0.527 | 0.0 | |
| 297850938 | 1541 | hypothetical protein ARALYDRAFT_313276 [ | 0.974 | 0.874 | 0.523 | 0.0 |
| >gi|359473396|ref|XP_002268358.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1637 bits (4238), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 856/1374 (62%), Positives = 1062/1374 (77%), Gaps = 28/1374 (2%)
Query: 5 ATTPASFRLRWDVFLSFRGEDTRDTITRNLYNSLHDHGVRVFKDDYGLARGDEIAPSLID 64
A+TPA R RWDVFLSFRGEDTR T T LY L GVR F+D+ GL RGD+I L+D
Sbjct: 12 ASTPA-VRRRWDVFLSFRGEDTRGTFTDCLYTRLQHKGVRAFRDNEGLNRGDKIDRCLLD 70
Query: 65 AIYDSAASIIILSPNYGSSRWCLEELAKICELNRLILPVFYKVDPSDVRRQQGPFKQDFE 124
AI DSAA I I+SPNY +SRWCLEELAK+CE NRLILPVFY VDPS VR Q+GPF Q F+
Sbjct: 71 AIEDSAAFIAIISPNYANSRWCLEELAKVCECNRLILPVFYNVDPSHVRGQRGPFLQHFK 130
Query: 125 RHQDRFGEDTVSQWRKAMMKVGGISGWVFNN-SEEEQLVQLLVKRVLAELSNTPMKVAAY 183
+ RFGE+ VS+WRKAM VGG++G+V N +E ++Q L+ VLAELS VAA+
Sbjct: 131 DLEARFGEEDVSKWRKAMKYVGGLAGFVVNGFGDEADVIQTLLNNVLAELSKWS-GVAAF 189
Query: 184 NVGLDFRIKEVIRLLDVKSSNVLVLGLFGLGGIGKTTLAKAVYNKLVDQFEHRSFISNVR 243
VGLD R++EV+ LLD+KS+++ VLGL+G GG+GK+TLAKA+YNKLV FE+RSFISNV+
Sbjct: 190 TVGLDSRVEEVLELLDLKSNSIRVLGLYGPGGVGKSTLAKALYNKLVAHFENRSFISNVK 249
Query: 244 ETSGQNDGLVSLQNKLIFDLSSGNKVPTENVPTENVVTANIAEIKNVVRERKVFVVLDDV 303
+ Q +GL+SLQ KLI DLS N V A + IK++V+E++V ++LDDV
Sbjct: 250 KYLAQENGLLSLQIKLIGDLSG-------MASHVNEVNAGLVAIKSIVQEKRVLIILDDV 302
Query: 304 DDPSQLNALCGDKEW---FSEGSRIIITTRDRGALPEHYVNQLYEVQKLDSSRALQLFSY 360
DD SQL A+ G K+W F EGSRIIITTRDR L E + N+LYEV++L+S +LQLFS+
Sbjct: 303 DDASQLTAIAGRKKWRKWFYEGSRIIITTRDREVLHELHENELYEVKQLNSPESLQLFSH 362
Query: 361 HALGRENPTDKFFKISEQIVSLTGGLPLALEVFGAFLFDKRRITEWEDALEKLRKIRPNN 420
+ALGR PT + +S+QIVSLTGGLPLALEVFG+ L+DKR+I EWEDAL+KL++IRP +
Sbjct: 363 YALGRVKPTPDYLPLSKQIVSLTGGLPLALEVFGSSLYDKRKIEEWEDALQKLKQIRPMD 422
Query: 421 LQEVLKISFDGLDQQDKCIFLDIACLFVKMGMNKEDAIDILKGCGFRAEIAIVVLMKKSL 480
LQ VLKIS+DGLD+Q+KC+FLDIACLF+KMGM KEDAIDILKGCGFRAEI I VL+ KSL
Sbjct: 423 LQGVLKISYDGLDEQEKCVFLDIACLFIKMGMKKEDAIDILKGCGFRAEIGIKVLVDKSL 482
Query: 481 IKITEDDTLWMHDQLRDMGRQIVQQESLLDPGNRSRLWDRDEIMTMLKLRKGTRSIQGIV 540
+KI ED TLWMHDQLRDMGRQIV E+ D G RSRLWDR EI+ +L+ G+R IQG+V
Sbjct: 483 LKIAEDYTLWMHDQLRDMGRQIVLHENHEDLGMRSRLWDRSEILRVLQNNLGSRCIQGMV 542
Query: 541 LDFKKEMVKESSAETSSRDNLQRSDLTSAITYLKGRYKKCLQHRTRSEREMILHTKPFES 600
LDF ++ + SA R + T+A+T+LK YK+ QH ERE+IL TK FES
Sbjct: 543 LDFVSDIFMKDSAAAWGRFR-GTPNFTTAVTWLKETYKEYFQHAAEKERELILQTKSFES 601
Query: 601 MVSLRLLQINYTKLEGSFKFLPHELKWLQWKDCKMKTLPSDFRPFQLAVLDLSES-GIEY 659
M++LRLLQI+ +LEG FK +P ELKWLQW+ C +KTLPSDF P L VLDLSES IE
Sbjct: 602 MINLRLLQIDNVQLEGEFKLMPAELKWLQWRGCPLKTLPSDFCPQGLRVLDLSESKNIER 661
Query: 660 LWGSHTNKVAKNLMVLNLRGCWNLASIPDLSEHQKLEKLVLERCCRLTKIHESVGNLSSL 719
LWG + V +NLMV+NL GC NL +IPDLS +Q LEKL+L+ C L KIH+S+G++ SL
Sbjct: 662 LWGE--SWVGENLMVMNLHGCCNLTAIPDLSGNQALEKLILQHCHGLVKIHKSIGDIISL 719
Query: 720 LHLNLRDCRNLIELPSDVSGLKHLENLILSDCSKLKELPEDICSMRSLKELLVDGTAIEK 779
LHL+L +C+NL+E PSDVSGLK+L+ LILS CSKLKELPE+I M+SL+ELL+DGT IEK
Sbjct: 720 LHLDLSECKNLVEFPSDVSGLKNLQTLILSGCSKLKELPENISYMKSLRELLLDGTVIEK 779
Query: 780 LPQSIFHLVKLEKLNLGKCKSLKQLPNCIGTQLIALKELSFNYSAVEELPDSVGHMGNLE 839
LP+S+ L +LE+L+L C+SLKQLP CIG +L +L+ELSFN SA+EE+PDS G + NLE
Sbjct: 780 LPESVLRLTRLERLSLNNCQSLKQLPTCIG-KLESLRELSFNDSALEEIPDSFGSLTNLE 838
Query: 840 KLSLIGCGSITTIPDSIGHLKSLIEFLIDGTAVKNLPASIGSLSYLKAFSVGRCQFLSEL 899
+LSL+ C SI IPDS+ +LK L EFL++G+ V LPASIGSLS LK SVG C+FLS+L
Sbjct: 839 RLSLMRCQSIYAIPDSVRNLKLLTEFLMNGSPVNELPASIGSLSNLKDLSVGHCRFLSKL 898
Query: 900 PDSIEGLASLVELQLDGTSIRHLPDQIGGLKMLDKLVMRNCLSLKTLPDSIGSILTLTTL 959
P SIEGLAS+V LQLDGTSI LPDQIGGLK L +L MR C L++LP++IGS+ +L TL
Sbjct: 899 PASIEGLASMVVLQLDGTSIMDLPDQIGGLKTLRRLEMRFCKRLESLPEAIGSMGSLNTL 958
Query: 960 NIVNASITRMPESIGILENLVILRLNECKQLEKLPASMGKLKSLVHLLMEETAVTELPES 1019
IV+A +T +PESIG LENL++L LN+CK+L +LP S+G LKSL HL MEETAV +LPES
Sbjct: 959 IIVDAPMTELPESIGKLENLIMLNLNKCKRLRRLPGSIGNLKSLHHLKMEETAVRQLPES 1018
Query: 1020 FGMLSSLMVLKM-KKPSVKARNS---------SAREKQKLTVLPTSFCNLSSLEELDAQG 1069
FGML+SLM L M K+P ++ + A E +L VLPTSF NLS L ELDA+
Sbjct: 1019 FGMLTSLMRLLMAKRPHLELPQALGPTETKVLGAEENSELIVLPTSFSNLSLLYELDARA 1078
Query: 1070 WRIGGKIPDDFEKLSSLEILNLGNNNFCNLPSSLRGLSHLKNLLLPYCQELKSLPPLPSS 1129
W+I GKIPDDF+KLSSLEILNLG NNF +LPSSLRGLS L+ LLLP+C+ELK+LPPLPSS
Sbjct: 1079 WKISGKIPDDFDKLSSLEILNLGRNNFSSLPSSLRGLSILRKLLLPHCEELKALPPLPSS 1138
Query: 1130 LEEVNVANCFALESICDLSNLKSLKRLNLTNCEKLVDISGLESLKSLKWLYMSGCNACSA 1189
L EVN ANC+ALE I DLSNL+SL+ LNLTNC+KLVDI G+E LKSLK +MSGC++CS+
Sbjct: 1139 LMEVNAANCYALEVISDLSNLESLQELNLTNCKKLVDIPGVECLKSLKGFFMSGCSSCSS 1198
Query: 1190 AVKRRLSKVHFKNLRSLSMPGTEIPDWFSPDMVRFTERRNHKIEGVIIGVVVSLNHQIPD 1249
VKRRLSKV KNLR+LS+PG+ IPDWFS ++ F++R+N I+ VIIGVVVSL+H I D
Sbjct: 1199 TVKRRLSKVALKNLRTLSIPGSNIPDWFSRNVAIFSKRKNLVIKAVIIGVVVSLSHHIQD 1258
Query: 1250 EMRYELPSIVDIQAKILTPNTTLLNTALDLQGVPETDECQVYLCRFPGFRPLVSMLKDGY 1309
E+R +LPS+ I+AKIL N + T LDL GVP+TDE +YLCR+ F P+VSMLKDG
Sbjct: 1259 ELRDQLPSVPGIEAKILRMNRQVFGTMLDLTGVPKTDEDHLYLCRYREFHPIVSMLKDGD 1318
Query: 1310 TIQVTTRNPPFLKGIVMKKCGIYLVYENEDDYDGDEESLDVSQQSVSEKLARFF 1363
IQVT RNPP +KG+ +KK GI+L++EN+DDYD DE S D + Q+VSEK+ARFF
Sbjct: 1319 KIQVTMRNPPMVKGVELKKSGIHLIFENDDDYDEDERSFDENLQTVSEKIARFF 1372
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224121242|ref|XP_002318534.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222859207|gb|EEE96754.1| tir-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|147774849|emb|CAN69078.1| hypothetical protein VITISV_004764 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359473398|ref|XP_002268324.2| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356524097|ref|XP_003530669.1| PREDICTED: TMV resistance protein N-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357516577|ref|XP_003628577.1| Tir-nbs-lrr resistance protein [Medicago truncatula] gi|355522599|gb|AET03053.1| Tir-nbs-lrr resistance protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356497814|ref|XP_003517752.1| PREDICTED: TMV resistance protein N-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255558310|ref|XP_002520182.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223540674|gb|EEF42237.1| leucine-rich repeat containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|297850940|ref|XP_002893351.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297339193|gb|EFH69610.1| predicted protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|297850938|ref|XP_002893350.1| hypothetical protein ARALYDRAFT_313276 [Arabidopsis lyrata subsp. lyrata] gi|297339192|gb|EFH69609.1| hypothetical protein ARALYDRAFT_313276 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1382 | ||||||
| TAIR|locus:2205824 | 1384 | AT1G27170 [Arabidopsis thalian | 0.981 | 0.980 | 0.481 | 0.0 | |
| TAIR|locus:2205804 | 1556 | AT1G27180 [Arabidopsis thalian | 0.975 | 0.866 | 0.471 | 0.0 | |
| TAIR|locus:2175991 | 1294 | AT5G17680 [Arabidopsis thalian | 0.714 | 0.762 | 0.317 | 1.9e-115 | |
| TAIR|locus:2167457 | 1191 | AT5G36930 [Arabidopsis thalian | 0.643 | 0.746 | 0.322 | 1e-107 | |
| UNIPROTKB|Q40392 | 1144 | N "TMV resistance protein N" [ | 0.631 | 0.763 | 0.306 | 3.2e-104 | |
| TAIR|locus:2094498 | 1981 | AT3G25510 [Arabidopsis thalian | 0.539 | 0.376 | 0.317 | 5.2e-100 | |
| TAIR|locus:2163426 | 1187 | TAO1 "target of AVRB operation | 0.645 | 0.751 | 0.306 | 1.5e-99 | |
| TAIR|locus:2053405 | 1215 | AT2G14080 [Arabidopsis thalian | 0.683 | 0.777 | 0.3 | 7e-96 | |
| TAIR|locus:2147992 | 1189 | AT5G11250 [Arabidopsis thalian | 0.695 | 0.808 | 0.291 | 2.6e-92 | |
| TAIR|locus:2032602 | 1163 | AT1G72860 [Arabidopsis thalian | 0.510 | 0.607 | 0.314 | 2.9e-88 |
| TAIR|locus:2205824 AT1G27170 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 3138 (1109.7 bits), Expect = 0., P = 0.
Identities = 666/1382 (48%), Positives = 900/1382 (65%)
Query: 12 RLRWDVFLSFRGEDTRDTITRNLYNSLHDHGVRVFKDDYGLARGDEIAPXXXXXXXXXXX 71
RL++DVFLSFRG DTRD +LY +L D VRVF+D+ G+ RGDEI+
Sbjct: 11 RLKYDVFLSFRGADTRDNFGDHLYKALKDK-VRVFRDNEGMERGDEISSSLKAGMEDSAA 69
Query: 72 XXXXXXPNYGSSRWCLEELAKICE----LNRLILPVFYKVDPSDVRRQQGPFKQDFERHQ 127
NY SRWCL+ELA +C+ L+R ILP+FY VDPS VR+Q K+DFE HQ
Sbjct: 70 SVIVISRNYSGSRWCLDELAMLCKMKSSLDRRILPIFYHVDPSHVRKQSDHIKKDFEEHQ 129
Query: 128 DRFGEDT--VSQWRKAMMKVGGISGWVFN-NSEEEQLVQLLVKRVLAELSNTPMKVAAYN 184
RF E+ V +WR+A+ VG ++G+V + +S+++ +++L+VKRVLAELSNTP KV +
Sbjct: 130 VRFSEEKEKVQEWREALTLVGNLAGYVCDKDSKDDDMIELVVKRVLAELSNTPEKVGEFI 189
Query: 185 VGLDFRIKEVIRLLDVKSSNXXXXXXXXXXXXXXXXX-AKAVYNKLVDQFEHRSFISNVR 243
VGL+ +K++ L+D +SS+ AKA YNK+V FE R+FIS++R
Sbjct: 190 VGLESPLKDLTGLIDTESSSGVQVLGLYGMGGIGKTTLAKAFYNKIVGNFEQRAFISDIR 249
Query: 244 ETSGQNDGLVSLQNKLIFDLSSGNKVPTENVPTENVVTANIAEIKNVVRERKVFVVLDDV 303
E S +GLV+LQ LI +L VP V+ + +IK V E+K+ VVLDDV
Sbjct: 250 ERSSAENGLVTLQKTLIKELF-------RLVPEIEDVSIGLEKIKANVHEKKIIVVLDDV 302
Query: 304 DDPSQLNALCGDKEWFSEGSRIIITTRDRGALPEHYVNQLYEVQKLDSSRALQLFSYHAL 363
D Q++AL G+ W+ +G+ I+ITTRD L + VNQ YEV+ L +AL+LFSYH+L
Sbjct: 303 DHIDQVHALVGETRWYGQGTLIVITTRDSEILSKLSVNQQYEVKCLTEPQALKLFSYHSL 362
Query: 364 GRENPTDKFFKISEQIVSLTGGLPLALEVFGAFLFDKRRITEWEDALEKLRKIRPNNLQE 423
+E PT +S++IV ++G LPLA+EVFG+ L+DK+ +W+ L+KL+K +P NLQ+
Sbjct: 363 RKEEPTKNLLALSKKIVQISGLLPLAVEVFGSLLYDKKEEKDWQTQLDKLKKTQPGNLQD 422
Query: 424 VLKISFDGLDQQDKCIFLDIACLFVKMGMNKEDAIDILKGCGFRAEIAIVVLMKKSLIKI 483
VL++SF LD ++K +FLDIACLF+KM + K++ + +LKGCG AE A+ VL +KSL+KI
Sbjct: 423 VLELSFKSLDDEEKKVFLDIACLFLKMEIKKDEVVIVLKGCGLNAEAALSVLRQKSLVKI 482
Query: 484 TEDDTLWMHDQLRDMGRQIVQQESLLDPGNRSRLWDRDEIMTMLKLRKGTRSIQGIVLDF 543
+DTLWMHDQ+RDMGRQ+V +ES DPG RSRLWDR EIMT+L KGT SI+GIVLDF
Sbjct: 483 LANDTLWMHDQIRDMGRQMVLKESREDPGLRSRLWDRGEIMTVLNNMKGTSSIRGIVLDF 542
Query: 544 KKEMVKESSAETSSRDNLQRSD-LTSAITYLKGRYKKCLQHRTRSEREMILHTKPFESMV 602
KK+ ++ +A+ NL+ + + S YLK + + E+ + + F M
Sbjct: 543 KKKFARDPTADEIVSRNLRNNPGIYSVFNYLKNKLVRFPAEEKPKSSEITIPVESFAPMT 602
Query: 603 SLRLLQINYTKLEGSFKFLPHELKWLQWKDCKMKTLPSDFRPFQLAVLDLSESGIEYLWG 662
LRLLQIN +LEG+ K LP ELKW+QWK C ++ LP DF QL+VLDLSESGI +
Sbjct: 603 KLRLLQINNVELEGNLKLLPSELKWIQWKGCPLENLPPDFLARQLSVLDLSESGIRQVQT 662
Query: 663 SHTNKVAKNLMVLNLRGCWNLASIPDLSEHQKLEKLVLERCCRLTKIHESVGNLSSLLHL 722
V +NL V+ LRGC +L +IPDLS H+ LEKLV E+C L K+ +SVGNL L+HL
Sbjct: 663 LRNKMVDENLKVVILRGCHSLEAIPDLSNHEALEKLVFEQCTLLVKVPKSVGNLRKLIHL 722
Query: 723 NLRDCRNLIELPSDVSGLKHLENLILSDCSKLKELPEDICSMRSLKELLVDGTAIEKLPQ 782
+ R C L E DVSGLK LE L LS CS L LPE+I +M SLKELL+DGTAI+ LP+
Sbjct: 723 DFRRCSKLSEFLVDVSGLKLLEKLFLSGCSDLSVLPENIGAMTSLKELLLDGTAIKNLPE 782
Query: 783 SIFHLVKLEKLNLGKCKSLKQLPNCIGTQLIALKELSFNYSAVEELPDSVGHMGNLEKLS 842
SI L LE L+L CK +++LP CIGT L +L++L + +A++ LP S+G + NL+ L
Sbjct: 783 SINRLQNLEILSLRGCK-IQELPLCIGT-LKSLEKLYLDDTALKNLPSSIGDLKNLQDLH 840
Query: 843 LIGCGSITTIPDSIGHLKSLIEFLIDGTAVKNLPASIGSLSYLKAFSVGRCQFLSELPDS 902
L+ C S++ IPDSI LKSL + I+G+AV+ LP SL L FS G C+FL ++P S
Sbjct: 841 LVRCTSLSKIPDSINELKSLKKLFINGSAVEELPLKPSSLPSLYDFSAGDCKFLKQVPSS 900
Query: 903 IEGLASLVELQLDGTSIRHLPDQIGGLKMLDKLVMRNCLSLKTLPDSIGSILTLTTLNIV 962
I L SL++LQL T I LP++IG L + +L +RNC LK LP SIG + TL +LN+
Sbjct: 901 IGRLNSLLQLQLSSTPIEALPEEIGALHFIRELELRNCKFLKFLPKSIGDMDTLYSLNLE 960
Query: 963 NASITRMPESIGILENLVILRLNECKQLEKLPASMGKLKSLVHLLMEETAVTELPESFGM 1022
++I +PE G LE LV LR++ CK L++LP S G LKSL L M+ET V+ELPESFG
Sbjct: 961 GSNIEELPEEFGKLEKLVELRMSNCKMLKRLPESFGDLKSLHRLYMKETLVSELPESFGN 1020
Query: 1023 LSSLMVLKM-KKPSVKARNSSA---REKQKLTVLPTSFCNLSSLEELDAQGWRIGGKIPD 1078
LS+LMVL+M KKP + S+ E+ + +P SF L LEELDA WRI GKIPD
Sbjct: 1021 LSNLMVLEMLKKPLFRISESNVPGTSEEPRFVEVPNSFSKLLKLEELDACSWRISGKIPD 1080
Query: 1079 DFEKLSSLEILNLGNNNFCNLPSSLRGLSHLKNLLLPYCQXXXXXXXXXXXXXXVNVANC 1138
D EKLS L LNLGNN F +LPSSL LS+L+ L L C+ +N+ANC
Sbjct: 1081 DLEKLSCLMKLNLGNNYFHSLPSSLVKLSNLQELSLRDCRELKRLPPLPCKLEQLNLANC 1140
Query: 1139 FALESICDXXXXXXXXXXXXTNCEKLVDISGLESLKSLKWLYMSGCNA-CSAAVKRRLSK 1197
F+LES+ D TNC K+VDI GLE L +LK LYM+GCN+ S AVK+RLSK
Sbjct: 1141 FSLESVSDLSELTILTDLNLTNCAKVVDIPGLEHLTALKRLYMTGCNSNYSLAVKKRLSK 1200
Query: 1198 VHFKNLRSLSMPGTEIPDWFSPDMVRFTERRNHKIEGVIIGVVVSLNHQIPDEMRYELPS 1257
K +R+LS+PG +PDWFS V F+ + N ++ GVII VVV+LN + D+ Y+LP
Sbjct: 1201 ASLKMMRNLSLPGNRVPDWFSQGPVTFSAQPNRELRGVIIAVVVALNDETEDD-DYQLPD 1259
Query: 1258 IVDIQAKIXXXXXXXXXXXXXXQGVPETDECQVYLCRFPGFRPLVSMLKDGYTIQVTTRN 1317
++++QA+I GVP T+ Q+++CR+ F PLV+MLKDGYTIQV RN
Sbjct: 1260 VMEVQAQIHKLDHHKCTNTLHLSGVPRTNNDQLHICRYSAFHPLVTMLKDGYTIQVIKRN 1319
Query: 1318 PPFLKGIVMKKCGIYLVXXXXXXXXXXXXSLDVSQQSVSEKLARFFSSFQEDEKKSVSEQ 1377
PP +G+ +K GI+LV +L +QQ+VS+KLA FFSSF+E+E +++SE
Sbjct: 1320 PPIKQGVELKMHGIHLVYEGDDDLEGRENTLPETQQTVSQKLANFFSSFEEEEGETISES 1379
Query: 1378 RN 1379
+
Sbjct: 1380 ES 1381
|
|
| TAIR|locus:2205804 AT1G27180 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2167457 AT5G36930 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q40392 N "TMV resistance protein N" [Nicotiana glutinosa (taxid:35889)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2053405 AT2G14080 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2147992 AT5G11250 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2032602 AT1G72860 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1382 | |||
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 1e-124 | |
| pfam00931 | 285 | pfam00931, NB-ARC, NB-ARC domain | 9e-36 | |
| smart00255 | 140 | smart00255, TIR, Toll - interleukin 1 - resistance | 2e-30 | |
| pfam01582 | 135 | pfam01582, TIR, TIR domain | 6e-30 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 6e-17 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 2e-13 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 2e-13 | |
| PLN03194 | 187 | PLN03194, PLN03194, putative disease resistance pr | 2e-13 | |
| pfam13676 | 102 | pfam13676, TIR_2, TIR domain | 6e-12 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 8e-09 | |
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 1e-08 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 1e-07 | |
| PRK15370 | 754 | PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl | 3e-07 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 9e-07 | |
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 1e-06 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 5e-06 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 5e-05 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 7e-05 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 4e-04 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 5e-04 | |
| PRK15387 | 788 | PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss | 8e-04 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 0.002 | |
| pfam01637 | 223 | pfam01637, Arch_ATPase, Archaeal ATPase | 0.003 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 0.004 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 0.004 |
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
Score = 415 bits (1068), Expect = e-124
Identities = 312/983 (31%), Positives = 496/983 (50%), Gaps = 106/983 (10%)
Query: 15 WDVFLSFRGEDTRDTITRNLYNSLHDHGVRVFKDDYGLARGDEIAPSLIDAIYDSAASII 74
+DVF SF GED R T + L + FKD+ + R + P L AI DS +++
Sbjct: 13 YDVFPSFSGEDVRITFLSHFLKELDRKLIIAFKDNE-IERSQSLDPELKQAIRDSRIAVV 71
Query: 75 ILSPNYGSSRWCLEELAKI--C--ELNRLILPVFYKVDPSDVRRQQGPFKQDFERHQDRF 130
+ S NY SS WCL EL +I C EL +L++PVFY +DPS VR+Q G F + FE+
Sbjct: 72 VFSKNYASSSWCLNELLEIVRCKEELGQLVIPVFYGLDPSHVRKQTGDFGEAFEKTCQNK 131
Query: 131 GEDTVSQWRKAMMKVGGISGW-VFNNSEEEQLVQLLVKRVLAELSNTPMKVAAYNVGLDF 189
ED QW++A+ V I G+ N E ++++ + VL +L+ TP VG++
Sbjct: 132 TEDEKIQWKQALTDVANILGYHSQNWPNEAKMIEEIANDVLGKLNLTPSNDFEDFVGIED 191
Query: 190 RIKEVIRLLDVKSSNVLVLGLFGLGGIGKTTLAKAVYNKLVDQFE-----HRSFISNVRE 244
I ++ LL ++S V ++G++G GIGKTT+A+A++++L QF+ R+FIS E
Sbjct: 192 HIAKMSSLLHLESEEVRMVGIWGSSGIGKTTIARALFSRLSRQFQSSVFIDRAFISKSME 251
Query: 245 TSGQNDGLVSLQNKLIFDLSSGNKVPTENVPTENVVTANIAEIKNVVRERKVFVVLDDVD 304
+ KL +E + +++ ++ ++ ++ RKV + +DD+D
Sbjct: 252 IYSSAN-PDDYNMKLHLQ----RAFLSEILDKKDIKIYHLGAMEERLKHRKVLIFIDDLD 306
Query: 305 DPSQLNALCGDKEWFSEGSRIIITTRDRGALPEHYVNQLYEVQKLDSSRALQLFSYHALG 364
D L+AL G +WF GSRII+ T+D+ L H ++ +YEV + AL++F A
Sbjct: 307 DQDVLDALAGQTQWFGSGSRIIVITKDKHFLRAHGIDHIYEVCLPSNELALEMFCRSAFK 366
Query: 365 RENPTDKFFKISEQIVSLTGGLPLALEVFGAFLFDKRRITEWEDALEKLRKIRPNNLQEV 424
+ +P D F +++ ++ G LPL L V G++L R +W D L +LR +++
Sbjct: 367 KNSPPDGFMELASEVALRAGNLPLGLNVLGSYL-RGRDKEDWMDMLPRLRNGLDGKIEKT 425
Query: 425 LKISFDGL-DQQDKCIFLDIACLFVKMGMNKEDAIDI---LKGCGFRAEIAIVVLMKKSL 480
L++S+DGL +++DK IF IACLF N E DI L I + L+ KSL
Sbjct: 426 LRVSYDGLNNKKDKAIFRHIACLF-----NGEKVNDIKLLLANSDLDVNIGLKNLVDKSL 480
Query: 481 IKITEDDTLWMHDQLRDMGRQIVQQESLLDPGNRSRLWDRDEIMTMLKLRKGTRSIQGIV 540
I + E D + MH L++MG++IV+ +S +PG R L D +I +L+ GT+ + GI
Sbjct: 481 IHVRE-DIVEMHSLLQEMGKEIVRAQS-NEPGEREFLVDAKDICDVLEDNTGTKKVLGIT 538
Query: 541 LDFKKEMVKESSAETSSRDNLQRSDLTSAITYLKGRYKKCLQHRTRSEREMILHTKPFES 600
LD E E+ +H F+
Sbjct: 539 LDID---------EID---------------------------------ELHIHENAFKG 556
Query: 601 MVSLRLLQINYTK-----------LEGSFKFLPHELKWLQWKDCKMKTLPSDFRPFQLAV 649
M +L L+ YTK L F +LP +L+ L+W ++ +PS+FRP L
Sbjct: 557 MRNLLFLKF-YTKKWDQKKEVRWHLPEGFDYLPPKLRLLRWDKYPLRCMPSNFRPENLVK 615
Query: 650 LDLSESGIEYLW-GSHTNKVAKNLMVLNLRGCWNLASIPDLSEHQKLEKLVLERCCRLTK 708
L + S +E LW G H+ +N ++LRG NL IPDLS LE L L C L +
Sbjct: 616 LQMQGSKLEKLWDGVHSLTGLRN---IDLRGSKNLKEIPDLSMATNLETLKLSDCSSLVE 672
Query: 709 IHESVGNLSSLLHLNLRDCRNLIELPSDVSGLKHLENLILSDCSKLKELPEDICSMRSLK 768
+ S+ L+ L L++ C NL LP+ ++ LK L L LS CS+LK P DI + ++
Sbjct: 673 LPSSIQYLNKLEDLDMSRCENLEILPTGIN-LKSLYRLNLSGCSRLKSFP-DIST--NIS 728
Query: 769 ELLVDGTAIEKLPQSIFHLVKLEKLNLGKCKSLK-----QLPNCIGTQLI-ALKELSF-N 821
L +D TAIE+ P S L L++L L + KS K Q + T L +L L +
Sbjct: 729 WLDLDETAIEEFP-SNLRLENLDELILCEMKSEKLWERVQPLTPLMTMLSPSLTRLFLSD 787
Query: 822 YSAVEELPDSVGHMGNLEKLSLIGCGSITTIPDSIGHLKSLIEFLIDG-TAVKNLPASIG 880
++ ELP S+ ++ LE L + C ++ T+P I +L+SL + G + ++ P
Sbjct: 788 IPSLVELPSSIQNLHKLEHLEIENCINLETLPTGI-NLESLESLDLSGCSRLRTFPDIST 846
Query: 881 SLSYLKAFSVGRCQFLSELPDSIEGLASLVELQLDGTS-IRHLPDQIGGLKMLDKLVMRN 939
++S L G + E+P IE ++L L ++G + ++ + I LK L+ + +
Sbjct: 847 NISDLNLSRTG----IEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETVDFSD 902
Query: 940 CLSL-KTLPDSIGSILTLTTLNI 961
C +L + + S + + T NI
Sbjct: 903 CGALTEASWNGSPSEVAMATDNI 925
|
syringae 6; Provisional. Length = 1153 |
| >gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain | Back alignment and domain information |
|---|
| >gnl|CDD|214587 smart00255, TIR, Toll - interleukin 1 - resistance | Back alignment and domain information |
|---|
| >gnl|CDD|216585 pfam01582, TIR, TIR domain | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215626 PLN03194, PLN03194, putative disease resistance protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222311 pfam13676, TIR_2, TIR domain | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216619 pfam01637, Arch_ATPase, Archaeal ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1382 | |||
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 100.0 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 100.0 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 100.0 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 100.0 | |
| PLN03194 | 187 | putative disease resistance protein; Provisional | 100.0 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 100.0 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 100.0 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.97 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.97 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.96 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.96 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.96 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.96 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.96 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.9 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.77 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.75 | |
| smart00255 | 140 | TIR Toll - interleukin 1 - resistance. | 99.74 | |
| PF01582 | 141 | TIR: TIR domain; InterPro: IPR000157 In Drosophila | 99.74 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.72 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.72 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.7 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.69 | |
| PF13676 | 102 | TIR_2: TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_ | 99.54 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.53 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.51 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.51 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.46 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 99.36 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 99.17 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 99.14 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 99.1 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 99.06 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 99.04 | |
| COG2909 | 894 | MalT ATP-dependent transcriptional regulator [Tran | 99.04 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 99.04 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.97 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.93 | |
| KOG3678 | 832 | consensus SARM protein (with sterile alpha and arm | 98.91 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 98.9 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 98.9 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.9 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.89 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 98.87 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 98.86 | |
| PF05729 | 166 | NACHT: NACHT domain | 98.85 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.85 | |
| KOG1187 | 361 | consensus Serine/threonine protein kinase [Signal | 98.83 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.81 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 98.79 | |
| COG3899 | 849 | Predicted ATPase [General function prediction only | 98.73 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 98.63 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.62 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.62 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 98.6 | |
| COG3903 | 414 | Predicted ATPase [General function prediction only | 98.6 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 98.49 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.47 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.45 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 98.4 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 98.35 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 98.34 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 98.32 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.28 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 98.27 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 98.26 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 98.26 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 98.25 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.25 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 98.25 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 98.25 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.24 | |
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 98.24 | |
| PTZ00202 | 550 | tuzin; Provisional | 98.22 | |
| PRK08727 | 233 | hypothetical protein; Validated | 98.22 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 98.22 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 98.21 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.21 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 98.18 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 98.17 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 98.16 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 98.16 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 98.16 | |
| PF13173 | 128 | AAA_14: AAA domain | 98.15 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 98.12 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 98.12 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 98.11 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 98.1 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 98.1 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 98.1 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 98.09 | |
| PF14516 | 331 | AAA_35: AAA-like domain | 98.09 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 98.08 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 98.08 | |
| PF08937 | 130 | DUF1863: MTH538 TIR-like domain (DUF1863); InterPr | 98.08 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 98.07 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 98.07 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 98.06 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 98.05 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 98.05 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 98.04 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 98.02 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 98.02 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 98.01 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 98.01 | |
| PRK09087 | 226 | hypothetical protein; Validated | 98.0 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.99 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 97.99 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 97.99 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.98 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 97.98 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 97.98 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 97.94 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 97.93 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 97.92 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.91 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.91 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 97.9 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 97.89 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 97.87 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 97.85 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 97.84 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 97.83 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 97.78 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 97.77 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 97.77 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 97.76 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 97.75 | |
| PF08357 | 150 | SEFIR: SEFIR domain; InterPro: IPR013568 This doma | 97.73 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 97.71 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 97.71 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 97.7 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 97.7 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 97.7 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 97.69 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 97.69 | |
| KOG2543 | 438 | consensus Origin recognition complex, subunit 5 [R | 97.66 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 97.64 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 97.63 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 97.63 | |
| PRK06620 | 214 | hypothetical protein; Validated | 97.63 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 97.62 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 97.62 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 97.61 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 97.6 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 97.6 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 97.59 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 97.58 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 97.57 | |
| KOG0989 | 346 | consensus Replication factor C, subunit RFC4 [Repl | 97.57 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 97.56 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 97.52 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 97.51 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 97.51 | |
| PRK14971 | 614 | DNA polymerase III subunits gamma and tau; Provisi | 97.49 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 97.49 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 97.49 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 97.49 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 97.49 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 97.49 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 97.46 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 97.39 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 97.36 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 97.36 | |
| PRK08116 | 268 | hypothetical protein; Validated | 97.35 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 97.34 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 97.34 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 97.28 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 97.28 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 97.27 | |
| PRK07399 | 314 | DNA polymerase III subunit delta'; Validated | 97.26 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 97.26 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.24 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 97.2 | |
| KOG2227 | 529 | consensus Pre-initiation complex, subunit CDC6, AA | 97.19 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 97.18 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 97.18 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 97.17 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 97.15 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.15 | |
| PRK08181 | 269 | transposase; Validated | 97.15 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 97.14 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.12 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 97.1 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 97.09 | |
| PRK08769 | 319 | DNA polymerase III subunit delta'; Validated | 97.08 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.08 | |
| COG1373 | 398 | Predicted ATPase (AAA+ superfamily) [General funct | 97.06 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 97.05 | |
| PRK12377 | 248 | putative replication protein; Provisional | 97.04 | |
| PF10443 | 431 | RNA12: RNA12 protein; InterPro: IPR018850 Mitochon | 97.03 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 97.01 | |
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 97.0 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 96.97 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 96.95 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 96.91 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 96.89 | |
| COG3267 | 269 | ExeA Type II secretory pathway, component ExeA (pr | 96.88 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 96.87 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 96.85 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 96.85 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 96.84 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 96.82 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 96.8 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 96.79 | |
| PRK06526 | 254 | transposase; Provisional | 96.79 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 96.77 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 96.76 | |
| PRK06871 | 325 | DNA polymerase III subunit delta'; Validated | 96.73 | |
| PRK07993 | 334 | DNA polymerase III subunit delta'; Validated | 96.72 | |
| PRK06090 | 319 | DNA polymerase III subunit delta'; Validated | 96.71 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 96.71 | |
| KOG1026 | 774 | consensus Nerve growth factor receptor TRKA and re | 96.69 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 96.66 | |
| KOG0192 | 362 | consensus Tyrosine kinase specific for activated ( | 96.64 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 96.59 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 96.58 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 96.54 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 96.5 | |
| PRK06964 | 342 | DNA polymerase III subunit delta'; Validated | 96.5 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 96.49 | |
| PRK04132 | 846 | replication factor C small subunit; Provisional | 96.48 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 96.46 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.46 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 96.46 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 96.46 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 96.4 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 96.4 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 96.39 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 96.37 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 96.36 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 96.33 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 96.31 | |
| COG2607 | 287 | Predicted ATPase (AAA+ superfamily) [General funct | 96.31 | |
| PF13177 | 162 | DNA_pol3_delta2: DNA polymerase III, delta subunit | 96.27 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 96.27 | |
| KOG1514 | 767 | consensus Origin recognition complex, subunit 1, a | 96.26 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 96.25 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 96.24 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 96.23 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 96.23 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 96.21 | |
| KOG0730 | 693 | consensus AAA+-type ATPase [Posttranslational modi | 96.21 | |
| COG2812 | 515 | DnaX DNA polymerase III, gamma/tau subunits [DNA r | 96.19 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.19 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 96.18 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 96.18 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 96.17 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 96.14 | |
| cd01133 | 274 | F1-ATPase_beta F1 ATP synthase beta subunit, nucle | 96.14 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 96.09 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 96.08 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 96.07 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 96.07 | |
| KOG2228 | 408 | consensus Origin recognition complex, subunit 4 [R | 96.06 | |
| KOG4278 | 1157 | consensus Protein tyrosine kinase [Signal transduc | 96.01 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 96.0 | |
| KOG0728 | 404 | consensus 26S proteasome regulatory complex, ATPas | 96.0 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 95.98 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 95.97 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 95.97 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 95.95 | |
| PRK06696 | 223 | uridine kinase; Validated | 95.95 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 95.94 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 95.91 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 95.89 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 95.89 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 95.87 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 95.87 | |
| KOG0741 | 744 | consensus AAA+-type ATPase [Posttranslational modi | 95.84 | |
| PF07693 | 325 | KAP_NTPase: KAP family P-loop domain; InterPro: IP | 95.83 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 95.82 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 95.8 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 95.79 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 95.74 | |
| KOG0731 | 774 | consensus AAA+-type ATPase containing the peptidas | 95.74 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 95.72 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 95.68 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 95.65 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 95.6 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 95.57 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 95.56 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 95.55 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 95.54 | |
| PRK07667 | 193 | uridine kinase; Provisional | 95.53 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 95.5 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 95.49 | |
| PRK10733 | 644 | hflB ATP-dependent metalloprotease; Reviewed | 95.45 | |
| cd00561 | 159 | CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B | 95.38 | |
| PRK08699 | 325 | DNA polymerase III subunit delta'; Validated | 95.37 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 95.34 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 95.28 | |
| PF10137 | 125 | TIR-like: Predicted nucleotide-binding protein con | 95.28 | |
| PRK13695 | 174 | putative NTPase; Provisional | 95.27 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 95.26 | |
| COG0468 | 279 | RecA RecA/RadA recombinase [DNA replication, recom | 95.24 | |
| KOG0743 | 457 | consensus AAA+-type ATPase [Posttranslational modi | 95.2 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 95.2 | |
| KOG0736 | 953 | consensus Peroxisome assembly factor 2 containing | 95.19 | |
| PF14532 | 138 | Sigma54_activ_2: Sigma-54 interaction domain; PDB: | 95.19 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 95.18 | |
| KOG2004 | 906 | consensus Mitochondrial ATP-dependent protease PIM | 95.16 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 95.15 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 95.13 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 95.12 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 95.11 | |
| COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 95.11 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 95.04 | |
| PRK15455 | 644 | PrkA family serine protein kinase; Provisional | 95.03 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 94.96 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 94.95 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 94.93 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 94.92 | |
| KOG1094 | 807 | consensus Discoidin domain receptor DDR1 [Signal t | 94.9 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 94.88 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 94.87 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 94.82 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 94.82 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 94.82 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 94.81 | |
| PF08423 | 256 | Rad51: Rad51; InterPro: IPR013632 This domain is f | 94.81 | |
| cd01858 | 157 | NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei | 94.8 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 94.76 | |
| KOG0727 | 408 | consensus 26S proteasome regulatory complex, ATPas | 94.74 | |
| PF10236 | 309 | DAP3: Mitochondrial ribosomal death-associated pro | 94.69 | |
| KOG0196 | 996 | consensus Tyrosine kinase, EPH (ephrin) receptor f | 94.67 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 94.6 | |
| COG2842 | 297 | Uncharacterized ATPase, putative transposase [Gene | 94.59 | |
| KOG0652 | 424 | consensus 26S proteasome regulatory complex, ATPas | 94.52 | |
| PF00406 | 151 | ADK: Adenylate kinase; InterPro: IPR000850 Adenyla | 94.52 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 94.51 | |
| COG1066 | 456 | Sms Predicted ATP-dependent serine protease [Postt | 94.51 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 94.5 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 94.46 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 94.46 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 94.45 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 94.45 | |
| PRK03839 | 180 | putative kinase; Provisional | 94.45 | |
| KOG1969 | 877 | consensus DNA replication checkpoint protein CHL12 | 94.41 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 94.4 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 94.36 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 94.29 | |
| KOG0734 | 752 | consensus AAA+-type ATPase containing the peptidas | 94.28 | |
| cd01857 | 141 | HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t | 94.24 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 94.23 | |
| PRK07132 | 299 | DNA polymerase III subunit delta'; Validated | 94.17 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 94.14 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 94.13 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 94.13 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 94.07 | |
| COG0003 | 322 | ArsA Predicted ATPase involved in chromosome parti | 94.03 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 94.03 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 93.96 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 93.96 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 93.93 | |
| COG0465 | 596 | HflB ATP-dependent Zn proteases [Posttranslational | 93.92 | |
| COG0541 | 451 | Ffh Signal recognition particle GTPase [Intracellu | 93.91 | |
| COG1428 | 216 | Deoxynucleoside kinases [Nucleotide transport and | 93.91 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 93.9 | |
| KOG0651 | 388 | consensus 26S proteasome regulatory complex, ATPas | 93.9 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 93.9 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 93.89 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 93.87 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 93.82 | |
| PLN03187 | 344 | meiotic recombination protein DMC1 homolog; Provis | 93.82 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 93.82 | |
| TIGR03575 | 340 | selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti | 93.73 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 93.73 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 93.72 | |
| KOG0197 | 468 | consensus Tyrosine kinases [Signal transduction me | 93.69 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 93.69 | |
| KOG0729 | 435 | consensus 26S proteasome regulatory complex, ATPas | 93.68 | |
| TIGR03600 | 421 | phage_DnaB phage replicative helicase, DnaB family | 93.65 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 93.64 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 93.64 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 93.64 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 93.63 | |
| KOG0739 | 439 | consensus AAA+-type ATPase [Posttranslational modi | 93.62 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 93.62 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 93.61 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 93.58 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 93.58 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 93.56 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 93.56 | |
| COG3640 | 255 | CooC CO dehydrogenase maturation factor [Cell divi | 93.56 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 93.5 | |
| PRK15453 | 290 | phosphoribulokinase; Provisional | 93.5 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 93.47 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 93.46 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 93.45 | |
| TIGR02238 | 313 | recomb_DMC1 meiotic recombinase Dmc1. This model d | 93.45 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 93.32 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 93.28 | |
| TIGR01351 | 210 | adk adenylate kinases. Adenylate kinase (EC 2.7.4. | 93.26 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 93.23 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 93.18 | |
| COG5635 | 824 | Predicted NTPase (NACHT family) [Signal transducti | 93.18 | |
| PRK14528 | 186 | adenylate kinase; Provisional | 93.17 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 93.16 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 93.13 | |
| KOG2035 | 351 | consensus Replication factor C, subunit RFC3 [Cell | 93.1 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 93.09 | |
| PRK14526 | 211 | adenylate kinase; Provisional | 93.09 | |
| PHA02244 | 383 | ATPase-like protein | 93.09 | |
| PRK14529 | 223 | adenylate kinase; Provisional | 93.09 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 93.06 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 93.06 | |
| COG3854 | 308 | SpoIIIAA ncharacterized protein conserved in bacte | 93.05 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 93.02 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 93.01 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 93.0 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 93.0 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 92.99 | |
| COG1875 | 436 | NYN ribonuclease and ATPase of PhoH family domains | 92.98 | |
| PF00154 | 322 | RecA: recA bacterial DNA recombination protein; In | 92.98 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 92.95 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 92.9 | |
| PF02374 | 305 | ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ | 92.88 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 92.88 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 92.86 | |
| PHA02988 | 283 | hypothetical protein; Provisional | 92.77 | |
| COG3910 | 233 | Predicted ATPase [General function prediction only | 92.74 | |
| PRK13948 | 182 | shikimate kinase; Provisional | 92.72 | |
| PRK13765 | 637 | ATP-dependent protease Lon; Provisional | 92.7 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 92.68 | |
| COG0703 | 172 | AroK Shikimate kinase [Amino acid transport and me | 92.68 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 92.68 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 92.62 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 92.62 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 92.59 | |
| PTZ00494 | 664 | tuzin-like protein; Provisional | 92.58 | |
| PRK08356 | 195 | hypothetical protein; Provisional | 92.57 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 92.52 | |
| PRK06217 | 183 | hypothetical protein; Validated | 92.52 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 92.47 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 92.46 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 92.46 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 92.45 | |
| PRK08506 | 472 | replicative DNA helicase; Provisional | 92.45 | |
| PRK13946 | 184 | shikimate kinase; Provisional | 92.44 | |
| TIGR03596 | 276 | GTPase_YlqF ribosome biogenesis GTP-binding protei | 92.43 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 92.43 | |
| PTZ00035 | 337 | Rad51 protein; Provisional | 92.41 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 92.4 | |
| cd02024 | 187 | NRK1 Nicotinamide riboside kinase (NRK) is an enzy | 92.36 | |
| COG4618 | 580 | ArpD ABC-type protease/lipase transport system, AT | 92.35 | |
| PF06068 | 398 | TIP49: TIP49 C-terminus; InterPro: IPR010339 This | 92.33 | |
| KOG0580 | 281 | consensus Serine/threonine protein kinase [Cell cy | 92.33 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 92.33 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 92.32 | |
| cd02029 | 277 | PRK_like Phosphoribulokinase-like (PRK-like) is a | 92.31 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 92.3 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 92.28 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 92.27 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 92.25 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 92.25 | |
| KOG1970 | 634 | consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 | 92.23 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 92.2 | |
| PRK09280 | 463 | F0F1 ATP synthase subunit beta; Validated | 92.17 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 92.15 | |
| PLN03186 | 342 | DNA repair protein RAD51 homolog; Provisional | 92.14 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 92.13 | |
| TIGR02239 | 316 | recomb_RAD51 DNA repair protein RAD51. This eukary | 92.12 | |
| CHL00206 | 2281 | ycf2 Ycf2; Provisional | 92.09 | |
| TIGR00708 | 173 | cobA cob(I)alamin adenosyltransferase. Alternate n | 92.08 | |
| PF07714 | 259 | Pkinase_Tyr: Protein tyrosine kinase Protein kinas | 92.08 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 92.08 | |
| cd03240 | 204 | ABC_Rad50 The catalytic domains of Rad50 are simil | 92.07 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 92.06 | |
| COG2019 | 189 | AdkA Archaeal adenylate kinase [Nucleotide transpo | 91.99 | |
| KOG0927 | 614 | consensus Predicted transporter (ABC superfamily) | 91.99 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 91.98 | |
| PRK12339 | 197 | 2-phosphoglycerate kinase; Provisional | 91.94 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 91.93 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 91.93 | |
| KOG1532 | 366 | consensus GTPase XAB1, interacts with DNA repair p | 91.92 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 91.91 | |
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 91.89 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 91.86 | |
| COG4133 | 209 | CcmA ABC-type transport system involved in cytochr | 91.85 | |
| KOG3347 | 176 | consensus Predicted nucleotide kinase/nuclear prot | 91.83 | |
| PRK09519 | 790 | recA DNA recombination protein RecA; Reviewed | 91.82 | |
| PF03969 | 362 | AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 | 91.82 | |
| COG0305 | 435 | DnaB Replicative DNA helicase [DNA replication, re | 91.82 | |
| PF03796 | 259 | DnaB_C: DnaB-like helicase C terminal domain; Inte | 91.79 | |
| PLN02459 | 261 | probable adenylate kinase | 91.79 | |
| PRK05537 | 568 | bifunctional sulfate adenylyltransferase subunit 1 | 91.74 | |
| COG1224 | 450 | TIP49 DNA helicase TIP49, TBP-interacting protein | 91.73 | |
| PRK13975 | 196 | thymidylate kinase; Provisional | 91.72 | |
| PF00006 | 215 | ATP-synt_ab: ATP synthase alpha/beta family, nucle | 91.71 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 91.71 | |
| PRK15429 | 686 | formate hydrogenlyase transcriptional activator Fh | 91.68 | |
| KOG1095 | 1025 | consensus Protein tyrosine kinase [Signal transduc | 91.63 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 91.59 | |
| PLN02796 | 347 | D-glycerate 3-kinase | 91.55 | |
| PRK14738 | 206 | gmk guanylate kinase; Provisional | 91.55 | |
| KOG0066 | 807 | consensus eIF2-interacting protein ABC50 (ABC supe | 91.52 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 91.51 | |
| PRK08006 | 471 | replicative DNA helicase; Provisional | 91.45 | |
| COG0714 | 329 | MoxR-like ATPases [General function prediction onl | 91.45 |
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.7e-123 Score=1231.96 Aligned_cols=730 Identities=35% Similarity=0.619 Sum_probs=648.3
Q ss_pred CCCCCCCCCCCCCcccEEEccccccccchHHHHHHHHHHhCCcEEEEeCCCCCCCCcchHHHHHHHHhcceEEEEecCCc
Q 000630 1 MANDATTPASFRLRWDVFLSFRGEDTRDTITRNLYNSLHDHGVRVFKDDYGLARGDEIAPSLIDAIYDSAASIIILSPNY 80 (1382)
Q Consensus 1 m~~~~~~~~~~~~~~dvfis~~~~d~~~~~~~~l~~~l~~~g~~~~~d~~~~~~g~~~~~~~~~~i~~s~~~i~v~s~~y 80 (1382)
||+|||| +..|+||||+||||+|+|++|++||+.+|.++||++|+|+ ++++|+.+.+++.+||++|+++|||+|++|
T Consensus 1 ~~~~~~~--~~~~~~~vf~sfrg~d~r~~f~~hl~~~l~~~~i~~f~d~-~~~~g~~~~~~l~~~i~~s~~~ivv~s~~y 77 (1153)
T PLN03210 1 MASSSSS--SRNWVYDVFPSFSGEDVRITFLSHFLKELDRKLIIAFKDN-EIERSQSLDPELKQAIRDSRIAVVVFSKNY 77 (1153)
T ss_pred CCCCCCC--CCCCCCcEEeeCCCcccccCHHHHHHHHHHHCCCeEEccC-CccCCCcccHHHHHHHHhCeEEEEEecCCc
Confidence 5655443 3579999999999999999999999999999999999985 799999999999999999999999999999
Q ss_pred ccChhhHHHHHHHHHcC----CeEEEEEecCCCccccccccchHHHHHHHhhhcCchhHHHHHHHHHHHhcccccccCC-
Q 000630 81 GSSRWCLEELAKICELN----RLILPVFYKVDPSDVRRQQGPFKQDFERHQDRFGEDTVSQWRKAMMKVGGISGWVFNN- 155 (1382)
Q Consensus 81 ~~s~w~~~e~~~~~~~~----~~~ipv~~~v~p~~v~~~~~~~~~~~~~~~~~~~~~~~~~w~~al~~~~~~~g~~~~~- 155 (1382)
++|.||++||++|++|+ +.|+||||+|+|+|||+|+|.||++|++++++.+++++++||+||++||+++||++..
T Consensus 78 a~s~wcl~el~~i~~~~~~~~~~v~pvfy~v~p~~v~~~~g~f~~~f~~~~~~~~~~~~~~w~~al~~~~~~~g~~~~~~ 157 (1153)
T PLN03210 78 ASSSWCLNELLEIVRCKEELGQLVIPVFYGLDPSHVRKQTGDFGEAFEKTCQNKTEDEKIQWKQALTDVANILGYHSQNW 157 (1153)
T ss_pred ccchHHHHHHHHHHHhhhhcCceEEEEEecccHHHHhhccchHHHHHHHHhcccchhHHHHHHHHHHHHhCcCceecCCC
Confidence 99999999999999987 7899999999999999999999999999999888899999999999999999999976
Q ss_pred chHHHHHHHHHHHHHHhhcCCCccccCcccchhHHHHHHHHHhcCCCCCcEEEEEEcCCCChHHHHHHHHHHHHhccccc
Q 000630 156 SEEEQLVQLLVKRVLAELSNTPMKVAAYNVGLDFRIKEVIRLLDVKSSNVLVLGLFGLGGIGKTTLAKAVYNKLVDQFEH 235 (1382)
Q Consensus 156 ~~e~~~i~~i~~~v~~~l~~~~~~~~~~~vGr~~~l~~l~~~L~~~~~~~~vv~I~G~gGiGKTtLA~~~~~~~~~~f~~ 235 (1382)
..|+++|++||++|.+++..++....+.+|||+.+++++..+|..+.+++++|+||||||+||||||+++|+++..+|+.
T Consensus 158 ~~E~~~i~~Iv~~v~~~l~~~~~~~~~~~vG~~~~l~~l~~lL~l~~~~~~vvgI~G~gGiGKTTLA~~l~~~l~~~F~g 237 (1153)
T PLN03210 158 PNEAKMIEEIANDVLGKLNLTPSNDFEDFVGIEDHIAKMSSLLHLESEEVRMVGIWGSSGIGKTTIARALFSRLSRQFQS 237 (1153)
T ss_pred CCHHHHHHHHHHHHHHhhccccCcccccccchHHHHHHHHHHHccccCceEEEEEEcCCCCchHHHHHHHHHHHhhcCCe
Confidence 45999999999999999998888888999999999999999998777889999999999999999999999999999999
Q ss_pred ceeeeeccccccC----------CCCHHHHHHHHHHHhhCCCCCCCCCCCcccchhhcHHHHHHHHcCCcEEEEEcCCCC
Q 000630 236 RSFISNVRETSGQ----------NDGLVSLQNKLIFDLSSGNKVPTENVPTENVVTANIAEIKNVVRERKVFVVLDDVDD 305 (1382)
Q Consensus 236 ~~~~~~~~~~~~~----------~~~~~~l~~~ll~~l~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~r~LlVLDdv~~ 305 (1382)
.+|+..++..... ......++++++.++....+. .. .....++++++++|+||||||||+
T Consensus 238 ~vfv~~~~v~~~~~~~~~~~~~~~~~~~~l~~~~l~~il~~~~~------~~----~~~~~~~~~L~~krvLLVLDdv~~ 307 (1153)
T PLN03210 238 SVFIDRAFISKSMEIYSSANPDDYNMKLHLQRAFLSEILDKKDI------KI----YHLGAMEERLKHRKVLIFIDDLDD 307 (1153)
T ss_pred EEEeeccccccchhhcccccccccchhHHHHHHHHHHHhCCCCc------cc----CCHHHHHHHHhCCeEEEEEeCCCC
Confidence 9998643211100 112345666777776543211 11 113567888999999999999999
Q ss_pred hHHHhhHhcCCCcCCCCCeEEEEeCCCCccccCCCccEEEcCCCCHHHHHHHHHHhhcCCCCCCchHHHHHHHHHHHhCC
Q 000630 306 PSQLNALCGDKEWFSEGSRIIITTRDRGALPEHYVNQLYEVQKLDSSRALQLFSYHALGRENPTDKFFKISEQIVSLTGG 385 (1382)
Q Consensus 306 ~~~l~~l~~~~~~~~~gs~IliTTR~~~~~~~~~~~~~~~l~~L~~~ea~~Lf~~~a~~~~~~~~~~~~~~~~i~~~~~g 385 (1382)
..+++.+.+...|+++|++||||||++.++..+++.++|+|+.|+++||++||+++||+...+++++.+++++|+++|+|
T Consensus 308 ~~~l~~L~~~~~~~~~GsrIIiTTrd~~vl~~~~~~~~~~v~~l~~~ea~~LF~~~Af~~~~~~~~~~~l~~~iv~~c~G 387 (1153)
T PLN03210 308 QDVLDALAGQTQWFGSGSRIIVITKDKHFLRAHGIDHIYEVCLPSNELALEMFCRSAFKKNSPPDGFMELASEVALRAGN 387 (1153)
T ss_pred HHHHHHHHhhCccCCCCcEEEEEeCcHHHHHhcCCCeEEEecCCCHHHHHHHHHHHhcCCCCCcHHHHHHHHHHHHHhCC
Confidence 99999999888899999999999999999877777889999999999999999999999877778899999999999999
Q ss_pred ChHHHHHHHhhhCCCCCHHHHHHHHHHHHhcCCchHHHHHHhhccCCCc-cccceeeeeecccccCCCCHHHHHHHHhhC
Q 000630 386 LPLALEVFGAFLFDKRRITEWEDALEKLRKIRPNNLQEVLKISFDGLDQ-QDKCIFLDIACLFVKMGMNKEDAIDILKGC 464 (1382)
Q Consensus 386 ~PLal~~~g~~L~~~~~~~~w~~~l~~l~~~~~~~i~~~l~~sy~~L~~-~~k~~fl~~a~f~~~~~~~~~~l~~~~~~~ 464 (1382)
+|||++++|++|+++ +..+|+.++++++...+..|.++|++||+.|++ .+|.||+++|||| .+.+.+.+..++..+
T Consensus 388 LPLAl~vlgs~L~~k-~~~~W~~~l~~L~~~~~~~I~~~L~~SYd~L~~~~~k~~Fl~ia~ff--~~~~~~~v~~~l~~~ 464 (1153)
T PLN03210 388 LPLGLNVLGSYLRGR-DKEDWMDMLPRLRNGLDGKIEKTLRVSYDGLNNKKDKAIFRHIACLF--NGEKVNDIKLLLANS 464 (1153)
T ss_pred CcHHHHHHHHHHcCC-CHHHHHHHHHHHHhCccHHHHHHHHHhhhccCccchhhhhheehhhc--CCCCHHHHHHHHHhc
Confidence 999999999999986 489999999999988888999999999999986 5899999999999 667788888888888
Q ss_pred CCChhhhHHHHhcccceEEecCCeEEccHHHHHHHHHHHhhcCCCCCCCcccccchhhHHHHhccccCcccEEEEEeccc
Q 000630 465 GFRAEIAIVVLMKKSLIKITEDDTLWMHDQLRDMGRQIVQQESLLDPGNRSRLWDRDEIMTMLKLRKGTRSIQGIVLDFK 544 (1382)
Q Consensus 465 g~~~~~~l~~L~~~sLi~~~~~~~~~mHdll~~~~~~~~~~e~~~~~~~~~rl~~~~~~~~~l~~~~~~~~v~~i~~~~~ 544 (1382)
++.++.+++.|+++|||++ ..++++|||++|+||++++++++ .+|++++|+|+++|++.++..++|++.++||.+|+.
T Consensus 465 ~~~~~~~l~~L~~ksLi~~-~~~~~~MHdLl~~~~r~i~~~~~-~~~~~r~~l~~~~di~~vl~~~~g~~~v~~i~l~~~ 542 (1153)
T PLN03210 465 DLDVNIGLKNLVDKSLIHV-REDIVEMHSLLQEMGKEIVRAQS-NEPGEREFLVDAKDICDVLEDNTGTKKVLGITLDID 542 (1153)
T ss_pred CCCchhChHHHHhcCCEEE-cCCeEEhhhHHHHHHHHHHHhhc-CCCCcceeEeCHHHHHHHHHhCcccceeeEEEeccC
Confidence 9888899999999999996 45789999999999999999987 689999999999999999999999999999999874
Q ss_pred chhhhccccccccccccccccchhhHHhhhhhhhhcccccccccceeeeCccccCCCCCCcEEEeeCcc----------C
Q 000630 545 KEMVKESSAETSSRDNLQRSDLTSAITYLKGRYKKCLQHRTRSEREMILHTKPFESMVSLRLLQINYTK----------L 614 (1382)
Q Consensus 545 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~f~~l~~Lr~L~l~~~~----------l 614 (1382)
+ ..++.++..+|.+|.+|++|+++.+. +
T Consensus 543 ~------------------------------------------~~~~~i~~~aF~~m~~L~~L~~~~~~~~~~~~~~~~l 580 (1153)
T PLN03210 543 E------------------------------------------IDELHIHENAFKGMRNLLFLKFYTKKWDQKKEVRWHL 580 (1153)
T ss_pred c------------------------------------------cceeeecHHHHhcCccccEEEEecccccccccceeec
Confidence 3 23456778899999999999997652 5
Q ss_pred CCCcccccCcceEEEecCCCCCCCCCCCCcccceeEecCCCCccccccccCccccccccEEecCCCcCCCcCCCCCCCCc
Q 000630 615 EGSFKFLPHELKWLQWKDCKMKTLPSDFRPFQLAVLDLSESGIEYLWGSHTNKVAKNLMVLNLRGCWNLASIPDLSEHQK 694 (1382)
Q Consensus 615 ~~~~~~lp~~L~~L~~~~~~l~~lp~~~~~~~L~~L~Ls~~~i~~l~~~~~~~~l~~L~~L~L~~~~~~~~~~~l~~l~~ 694 (1382)
++++..+|++|++|+|.+++++.+|..|.+.+|+.|+|++|.+..+|. +...+++|+.|+|++|..++.+|+++.+++
T Consensus 581 p~~~~~lp~~Lr~L~~~~~~l~~lP~~f~~~~L~~L~L~~s~l~~L~~--~~~~l~~Lk~L~Ls~~~~l~~ip~ls~l~~ 658 (1153)
T PLN03210 581 PEGFDYLPPKLRLLRWDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWD--GVHSLTGLRNIDLRGSKNLKEIPDLSMATN 658 (1153)
T ss_pred CcchhhcCcccEEEEecCCCCCCCCCcCCccCCcEEECcCcccccccc--ccccCCCCCEEECCCCCCcCcCCccccCCc
Confidence 567888999999999999999999999999999999999999999987 678899999999999999999999999999
Q ss_pred ccEEeccCccccccccccccCCCCCceEeccCCCCCccCCccCCCCCCCCEEEccCCCCCCCCcccccccCCccEEEecC
Q 000630 695 LEKLVLERCCRLTKIHESVGNLSSLLHLNLRDCRNLIELPSDVSGLKHLENLILSDCSKLKELPEDICSMRSLKELLVDG 774 (1382)
Q Consensus 695 L~~L~L~~~~~~~~~~~~i~~l~~L~~L~L~~~~~~~~lp~~i~~l~~L~~L~Ls~~~~~~~~p~~l~~l~~L~~L~L~~ 774 (1382)
|++|+|++|.....+|..++++++|+.|++++|..++.+|..+ ++++|++|+|++|..++.+|.. ..+|+.|++++
T Consensus 659 Le~L~L~~c~~L~~lp~si~~L~~L~~L~L~~c~~L~~Lp~~i-~l~sL~~L~Lsgc~~L~~~p~~---~~nL~~L~L~~ 734 (1153)
T PLN03210 659 LETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGI-NLKSLYRLNLSGCSRLKSFPDI---STNISWLDLDE 734 (1153)
T ss_pred ccEEEecCCCCccccchhhhccCCCCEEeCCCCCCcCccCCcC-CCCCCCEEeCCCCCCccccccc---cCCcCeeecCC
Confidence 9999999999999999999999999999999999999999876 7999999999999887777754 35778888888
Q ss_pred ccccccCccccCCCCCcEEEcCC
Q 000630 775 TAIEKLPQSIFHLVKLEKLNLGK 797 (1382)
Q Consensus 775 ~~i~~lp~~l~~l~~L~~L~l~~ 797 (1382)
|.+..+|..+ .+++|+.|.+.+
T Consensus 735 n~i~~lP~~~-~l~~L~~L~l~~ 756 (1153)
T PLN03210 735 TAIEEFPSNL-RLENLDELILCE 756 (1153)
T ss_pred Cccccccccc-cccccccccccc
Confidence 8877777544 345555555543
|
syringae 6; Provisional |
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN03194 putative disease resistance protein; Provisional | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >smart00255 TIR Toll - interleukin 1 - resistance | Back alignment and domain information |
|---|
| >PF01582 TIR: TIR domain; InterPro: IPR000157 In Drosophila melanogaster the Toll protein is involved in establishment of dorso-ventral polarity in the embryo | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PF13676 TIR_2: TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_A 3UB2_A | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >COG2909 MalT ATP-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG3899 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG3903 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PTZ00202 tuzin; Provisional | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PF14516 AAA_35: AAA-like domain | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PF08937 DUF1863: MTH538 TIR-like domain (DUF1863); InterPro: IPR015032 This protein adopts the flavodoxin fold, that is, five parallel beta-strands and four helical segments | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PF08357 SEFIR: SEFIR domain; InterPro: IPR013568 This domain is found in IL17 receptors (IL17Rs, e | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14971 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07399 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK08769 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >PRK06871 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07993 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK06090 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >PRK06964 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK04132 replication factor C small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PRK10733 hflB ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP | Back alignment and domain information |
|---|
| >PRK08699 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF10137 TIR-like: Predicted nucleotide-binding protein containing TIR-like domain; InterPro: IPR019302 This entry represents a TIR-like domain found in a family of prokaryotic predicted nucleotide-binding proteins | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15455 PrkA family serine protein kinase; Provisional | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 | Back alignment and domain information |
|---|
| >cd01858 NGP_1 NGP-1 | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >COG2842 Uncharacterized ATPase, putative transposase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction |
Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01857 HSR1_MMR1 HSR1/MMR1 | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK07132 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03187 meiotic recombination protein DMC1 homolog; Provisional | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >PRK15453 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >TIGR01351 adk adenylate kinases | Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG5635 Predicted NTPase (NACHT family) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK14526 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >PRK14529 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] | Back alignment and domain information |
|---|
| >PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PHA02988 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG3910 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13948 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13765 ATP-dependent protease Lon; Provisional | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >PTZ00494 tuzin-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK08356 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >PRK08506 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK13946 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >PTZ00035 Rad51 protein; Provisional | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) | Back alignment and domain information |
|---|
| >COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] | Back alignment and domain information |
|---|
| >PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins | Back alignment and domain information |
|---|
| >KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >PRK09280 F0F1 ATP synthase subunit beta; Validated | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PLN03186 DNA repair protein RAD51 homolog; Provisional | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >TIGR02239 recomb_RAD51 DNA repair protein RAD51 | Back alignment and domain information |
|---|
| >CHL00206 ycf2 Ycf2; Provisional | Back alignment and domain information |
|---|
| >TIGR00708 cobA cob(I)alamin adenosyltransferase | Back alignment and domain information |
|---|
| >PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >PRK12339 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09519 recA DNA recombination protein RecA; Reviewed | Back alignment and domain information |
|---|
| >PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP | Back alignment and domain information |
|---|
| >COG0305 DnaB Replicative DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork | Back alignment and domain information |
|---|
| >PLN02459 probable adenylate kinase | Back alignment and domain information |
|---|
| >PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated | Back alignment and domain information |
|---|
| >COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >PRK13975 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional | Back alignment and domain information |
|---|
| >KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02796 D-glycerate 3-kinase | Back alignment and domain information |
|---|
| >PRK14738 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK08006 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >COG0714 MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1382 | ||||
| 3ozi_A | 204 | Crystal Structure Of The Tir Domain From The Flax D | 9e-28 | ||
| 3jrn_A | 176 | Crystal Structure Of Tir Domain From Arabidopsis Th | 5e-21 | ||
| 4fcg_A | 328 | Structure Of The Leucine-Rich Repeat Domain Of The | 3e-13 | ||
| 4fcg_A | 328 | Structure Of The Leucine-Rich Repeat Domain Of The | 3e-12 | ||
| 4fcg_A | 328 | Structure Of The Leucine-Rich Repeat Domain Of The | 4e-11 | ||
| 4fcg_A | 328 | Structure Of The Leucine-Rich Repeat Domain Of The | 2e-08 | ||
| 2o6s_A | 208 | Structural Diversity Of The Hagfish Variable Lympho | 4e-05 | ||
| 1ogq_A | 313 | The Crystal Structure Of Pgip (Polygalacturonase In | 6e-05 | ||
| 4g8a_A | 635 | Crystal Structure Of Human Tlr4 Polymorphic Variant | 4e-04 |
| >pdb|3OZI|A Chain A, Crystal Structure Of The Tir Domain From The Flax Disease Resistance Protein L6 Length = 204 | Back alignment and structure |
|
| >pdb|3JRN|A Chain A, Crystal Structure Of Tir Domain From Arabidopsis Thaliana Length = 176 | Back alignment and structure |
| >pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 | Back alignment and structure |
| >pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 | Back alignment and structure |
| >pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 | Back alignment and structure |
| >pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 | Back alignment and structure |
| >pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 | Back alignment and structure |
| >pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 | Back alignment and structure |
| >pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3jrn_A AT1G72930 protein; TIR domain arabidopsis thaliana, plant protein; 2.00A {Arabidopsis thaliana} Length = 176 | Back alignment and structure |
|---|
Score = 233 bits (598), Expect = 4e-71
Identities = 55/171 (32%), Positives = 88/171 (51%), Gaps = 5/171 (2%)
Query: 10 SFRLRWDVFLSFRGEDTRDTITRNLYNSLHDHGVRVFKDDYGLARGDEIAPSLIDAIYDS 69
++DVFLSFRG DTR LY L +R FKDD L G +P L I S
Sbjct: 4 HTATKYDVFLSFRGHDTRHNFISFLYKELVRRSIRTFKDDKELENGQRFSPELKSPIEVS 63
Query: 70 AASIIILSPNYGSSRWCLEELAKICE----LNRLILPVFYKVDPSDVRRQQGPFKQDFER 125
+++++S NY +S WCL+EL I + + ++P+FY V+P+ VR Q G + F++
Sbjct: 64 RFAVVVVSENYAASSWCLDELVTIMDFEKKGSITVMPIFYGVEPNHVRWQTGVLAEQFKK 123
Query: 126 HQDRFGEDTVSQWRKAMMKVGGISGWVFNNSEEEQLVQLLVKRVLAELSNT 176
H R + V +WR+A+ +SG + + + LV + + + +
Sbjct: 124 HASREDPEKVLKWRQALTNFAQLSGDCSGDDDSK-LVDKIANEISNKKTIY 173
|
| >3ozi_A L6TR; plant TIR domain, plant protein; 2.30A {Linum usitatissimum} Length = 204 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >3h16_A TIR protein; bacteria TIR domain, signaling protein; 2.50A {Paracoccus denitrificans PD1222} Length = 154 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >3ub2_A TOLL/interleukin-1 receptor domain-containing ADA protein; TIR domain, TLRS adaptor, immune system; 2.40A {Homo sapiens} PDB: 3ub3_A 3ub4_A 2y92_A Length = 146 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2j67_A TOLL like receptor 10; TIR, IL-1, TLR10, membrane, innate immunity, immune response, leucine-rich repeat, glycoprotein, transmembrane; 2.20A {Homo sapiens} PDB: 1fyv_A Length = 178 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >1fyx_A TOLL-like receptor 2; beta-alpha-beta fold, signaling protein; 2.80A {Homo sapiens} SCOP: c.23.2.1 PDB: 1fyw_A 1o77_A Length = 149 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 | Back alignment and structure |
|---|
| >2js7_A Myeloid differentiation primary response protein MYD88; MYD88_human, TIR domain, TOLL like receptor adaptor domain, innate immune signaling; NMR {Homo sapiens} PDB: 2z5v_A Length = 160 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >1t3g_A X-linked interleukin-1 receptor accessory protein-like 1; TIR, IL-1RAPL, IL-1R, TLR, membrane protein; 2.30A {Homo sapiens} Length = 159 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1382 | ||||
| d2a5yb3 | 277 | c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor | 2e-34 | |
| d1fyva_ | 161 | c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (H | 6e-16 | |
| d1fyxa_ | 149 | c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (H | 4e-15 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 7e-13 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 6e-12 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 3e-10 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 2e-09 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 4e-09 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 2e-11 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 3e-11 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 4e-09 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 2e-08 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 3e-08 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 8e-07 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 1e-04 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 2e-09 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 8e-05 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 3e-04 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 0.004 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 4e-07 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 6e-06 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 0.002 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 7e-07 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 0.001 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 0.002 | |
| d1xwdc1 | 242 | c.10.2.7 (C:18-259) Follicle-stimulating hormone r | 2e-06 | |
| d1xwdc1 | 242 | c.10.2.7 (C:18-259) Follicle-stimulating hormone r | 0.002 | |
| d1xwdc1 | 242 | c.10.2.7 (C:18-259) Follicle-stimulating hormone r | 0.002 | |
| d1a9na_ | 162 | c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom | 4e-06 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 4e-06 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 2e-04 | |
| d1h6ta2 | 210 | c.10.2.1 (A:31-240) Internalin B {Listeria monocyt | 1e-04 | |
| d1h6ta2 | 210 | c.10.2.1 (A:31-240) Internalin B {Listeria monocyt | 2e-04 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 2e-04 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 0.002 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 4e-04 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 0.001 | |
| d2ca6a1 | 344 | c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom | 6e-04 | |
| d2omxa2 | 199 | c.10.2.1 (A:37-235) Internalin B {Listeria monocyt | 0.001 | |
| d2omxa2 | 199 | c.10.2.1 (A:37-235) Internalin B {Listeria monocyt | 0.003 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Score = 131 bits (330), Expect = 2e-34
Identities = 46/281 (16%), Positives = 94/281 (33%), Gaps = 20/281 (7%)
Query: 163 QLLVKRVLAELSNTPMKVAAYNVGLDFRIKEVIRLLD-VKSSNVLVLGLFGLGGIGKTTL 221
Q+L +++L L N P ++ Y ++ + VI+ LD + + L L G G GK+ +
Sbjct: 5 QMLDRKLL--LGNVPKQMTCY--IREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVI 60
Query: 222 AKAVYNK----LVDQFEHRSFISNVRETSGQNDGLVSLQNKLIFDLSSGNKVPTENVPTE 277
A +K + ++ ++ + + L+ S + + +V
Sbjct: 61 ASQALSKSDQLIGINYDSIVWLKDSGTAP--KSTFDLFTDILLMLKSEDDLLNFPSVEHV 118
Query: 278 NVVTANIAEIKNVVRERKVFVVLDDVDDPSQLNALCGDKEWFSEGSRIIITTRDRG-ALP 336
V ++ V DDV + R ++TTRD +
Sbjct: 119 TSVVLKRMICNALIDRPNTLFVFDDVVQEET------IRWAQELRLRCLVTTRDVEISNA 172
Query: 337 EHYVNQLYEVQKLDSSRALQLFSYHALGRENPTDKFFKISEQIVSLTGGLPLALEVFGAF 396
+ EV L+ + + +K + + + L+ G P L +F
Sbjct: 173 ASQTCEFIEVTSLEIDECYDFLEAYGMPMPVG-EKEEDVLNKTIELSSGNPATLMMFFKS 231
Query: 397 LFDKRRITEWEDALEKLRKIRPNNLQEVLKISFDGLDQQDK 437
K + KL ++ + S+ L +
Sbjct: 232 CEPKTF-EKMAQLNNKLESRGLVGVECITPYSYKSLAMALQ 271
|
| >d1fyva_ c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 161 | Back information, alignment and structure |
|---|
| >d1fyxa_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens) [TaxId: 9606]} Length = 149 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1382 | |||
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 100.0 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.97 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.96 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.93 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.93 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.92 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.91 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.89 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.88 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.86 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.85 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.82 | |
| d1fyva_ | 161 | Toll-like receptor 1, TLR1 {Human (Homo sapiens) [ | 99.79 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.76 | |
| d1fyxa_ | 149 | Toll-like receptor 2, TLR2 {Human (Homo sapiens) [ | 99.76 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.73 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.71 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.71 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.68 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.67 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.67 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.65 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.64 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.55 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.52 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 99.51 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.49 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.43 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.27 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 99.23 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.16 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 99.06 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.95 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.94 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 98.93 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.91 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 98.91 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 98.89 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 98.87 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 98.85 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 98.84 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 98.75 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 98.71 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 98.71 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 98.68 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 98.65 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 98.6 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 98.59 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 98.59 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 98.59 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 98.55 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 98.52 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 98.5 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 98.43 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.9 | |
| d1sm2a_ | 263 | Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie | 97.41 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 97.4 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 97.38 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 97.32 | |
| d1byga_ | 262 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 97.25 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 97.21 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 97.21 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 97.17 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 97.16 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 97.13 | |
| d1k2pa_ | 258 | Bruton's tyrosine kinase (Btk) {Human (Homo sapien | 97.12 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 97.11 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 97.08 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 97.08 | |
| d1p4oa_ | 308 | Insulin-like growth factor 1 receptor {Human (Homo | 97.06 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 97.0 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 96.99 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 96.97 | |
| d1vjya_ | 303 | Type I TGF-beta receptor R4 {Human (Homo sapiens) | 96.92 | |
| d1lufa_ | 301 | Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax | 96.9 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 96.87 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 96.86 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 96.85 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 96.84 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 96.83 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 96.82 | |
| d1fvra_ | 309 | Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | 96.79 | |
| d1qpca_ | 272 | Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax | 96.78 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 96.73 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 96.68 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 96.67 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.67 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 96.67 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 96.66 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 96.66 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 96.65 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 96.61 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 96.61 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 96.6 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 96.56 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 96.54 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 96.51 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 96.5 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 96.47 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 96.47 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 96.47 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 96.45 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 96.44 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 96.42 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 96.39 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 96.37 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 96.37 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 96.37 | |
| d1rjba_ | 325 | Fl cytokine receptor {Human (Homo sapiens) [TaxId: | 96.33 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 96.31 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 96.27 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 96.26 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 96.14 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.14 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 96.07 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 96.01 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 95.98 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 95.95 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 95.93 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 95.84 | |
| d1koaa2 | 350 | Twitchin, kinase domain {Caenorhabditis elegans, p | 95.83 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 95.8 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 95.77 | |
| d1nvra_ | 271 | Cell cycle checkpoint kinase chk1 {Human (Homo sap | 95.71 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 95.7 | |
| d2jfla1 | 288 | STE20-like serine/threonine-protein kinase, SLK {H | 95.69 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 95.68 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 95.66 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 95.61 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 95.58 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 95.56 | |
| d1xkka_ | 317 | EGF receptor tyrosine kinase, Erbb-1 {Human (Homo | 95.54 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 95.54 | |
| d2java1 | 269 | Serine/threonine-protein kinase Nek2 {Human (Homo | 95.48 | |
| d1koba_ | 352 | Twitchin, kinase domain {California sea hare (Aply | 95.45 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 95.45 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 95.44 | |
| d1mp8a_ | 273 | Focal adhesion kinase 1 (fak) {Human (Homo sapiens | 95.41 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 95.38 | |
| d1uu3a_ | 288 | 3-phosphoinositide dependent protein kinase-1 Pdk1 | 95.3 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 95.21 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 95.15 | |
| d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 95.04 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 95.03 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 94.98 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 94.9 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 94.83 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 94.83 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 94.71 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 94.69 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 94.6 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 94.58 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 94.57 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 94.56 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 94.49 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 94.47 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 94.18 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 94.11 | |
| d1yhwa1 | 293 | pak1 {Human (Homo sapiens) [TaxId: 9606]} | 94.11 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 94.1 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 94.06 | |
| d1ua2a_ | 299 | Cell division protein kinase 7, CDK7 {Human (Homo | 94.04 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 94.04 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 94.04 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 93.84 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 93.84 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 93.68 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 93.53 | |
| d1fx0a3 | 276 | Central domain of alpha subunit of F1 ATP synthase | 93.5 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 93.24 | |
| d1rdqe_ | 350 | cAMP-dependent PK, catalytic subunit {Mouse (Mus m | 92.75 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 92.65 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 92.53 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 92.26 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 92.18 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 91.98 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 91.87 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 91.68 | |
| d1puja_ | 273 | Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 | 91.62 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 91.61 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 91.57 | |
| d1gz8a_ | 298 | Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T | 91.37 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 91.35 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 91.33 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 91.32 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 91.3 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 91.22 | |
| d1p6xa_ | 333 | Thymidine kinase {Equine herpesvirus type 4 [TaxId | 91.2 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 91.18 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 91.06 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 90.99 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 90.98 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 90.89 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 90.87 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 90.87 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 90.86 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 90.76 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 90.75 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 90.7 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 90.7 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 90.69 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 90.54 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 90.53 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 90.44 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 90.44 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 90.41 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 90.28 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 90.21 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 90.02 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 89.95 | |
| d2jdia3 | 285 | Central domain of alpha subunit of F1 ATP synthase | 89.9 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 89.82 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 89.7 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 89.65 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 89.62 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 89.57 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 89.54 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 89.54 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 89.51 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 89.33 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 89.32 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 89.32 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 89.31 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 89.28 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 89.25 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 89.23 | |
| d1osna_ | 331 | Thymidine kinase {Varicella-zoster virus [TaxId: 1 | 89.2 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 89.18 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 89.16 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 89.15 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 89.14 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 88.99 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 88.95 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 88.94 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 88.93 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 88.92 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 88.86 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 88.85 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 88.58 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 88.57 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 88.57 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 88.48 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 88.44 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 88.3 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 88.22 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 88.2 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 88.03 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 87.98 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 87.96 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 87.93 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 87.81 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 87.67 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 87.63 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 87.61 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 87.56 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 87.55 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 87.49 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 87.48 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 87.38 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 87.19 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 87.07 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 87.07 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 87.07 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 87.0 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 86.94 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 86.93 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 86.76 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 86.72 | |
| d3bqca1 | 328 | Protein kinase CK2, alpha subunit {Rattus norvegic | 86.66 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 86.45 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 86.39 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 86.38 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 86.09 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 86.0 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 85.83 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 85.43 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 85.12 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 84.93 | |
| d1e2ka_ | 329 | Thymidine kinase {Herpes simplex virus type 1, dif | 84.71 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 84.64 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 84.54 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 84.26 | |
| d3blha1 | 318 | Cell division protein kinase 9, CDK9 {Human (Homo | 84.12 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 83.7 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 83.44 | |
| d1vzoa_ | 322 | Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( | 83.28 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 82.84 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 82.65 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 82.14 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 81.89 | |
| d1jala1 | 278 | YchF GTP-binding protein N-terminal domain {Haemop | 80.91 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 80.31 | |
| d1cm8a_ | 346 | MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: | 80.21 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Probab=100.00 E-value=8.7e-44 Score=295.65 Aligned_cols=250 Identities=15% Similarity=0.136 Sum_probs=195.0
Q ss_pred CCCCCCCHHHHHHHHHHHHCC-CCCCCEEEEEECCCCCHHHHHHHHHHHH----HHCCCCCCEEEEECCCCCCCCCCHHH
Q ss_conf 248655416899999998217-8999279999749987178999999999----84035631223302010168887799
Q 000630 180 VAAYNVGLDFRIKEVIRLLDV-KSSNVLVLGLFGLGGIGKTTLAKAVYNK----LVDQFEHRSFISNVRETSGQNDGLVS 254 (1382)
Q Consensus 180 ~~~~~vGr~~~l~~l~~~L~~-~~~~~~vv~I~G~gGiGKTtLA~~~~~~----~~~~f~~~~~~~~~~~~~~~~~~~~~ 254 (1382)
..+.++||+.++++|.++|.. .+.+.++|+|+|||||||||||+++|++ ....|++++|+. ++.......
T Consensus 18 ~~~~~~gR~~~~~~i~~~L~~~~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~-----vs~~~~~~~ 92 (277)
T d2a5yb3 18 KQMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLK-----DSGTAPKST 92 (277)
T ss_dssp CCCCSCCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEE-----CCCCSTTHH
T ss_pred CCCCEECCHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEEE-----ECCCCCHHH
T ss_conf 988623739999999999873468784089997799788899999999855655401276489999-----368777778
Q ss_pred HHHHH---HHHHHCCCCCCCCCCCCCCCHHHCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHCCCCCCCCCCEEEEEECC
Q ss_conf 99999---988518999999899854301001999999880992799981799947785671699967999869999288
Q 000630 255 LQNKL---IFDLSSGNKVPTENVPTENVVTANIAEIKNVVRERKVFVVLDDVDDPSQLNALCGDKEWFSEGSRIIITTRD 331 (1382)
Q Consensus 255 l~~~l---l~~l~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~kr~LlVLDdv~~~~~~~~l~~~~~~~~~gs~IiiTTR~ 331 (1382)
+...+ +..+.......................+.+.+.++|+|+||||||+..+++.+. ..||+||||||+
T Consensus 93 l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~kr~LlVLDDv~~~~~~~~~~------~~~srilvTTR~ 166 (277)
T d2a5yb3 93 FDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQ------ELRLRCLVTTRD 166 (277)
T ss_dssp HHHHHHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHHHHHH------HTTCEEEEEESB
T ss_pred HHHHHHHHHHHHCCHHHCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCHHHHHHHHHHHC------CCCCEEEEEEEH
T ss_conf 99999999987220220278632123369999999999844688167525066776655520------457559999644
Q ss_pred CCCCCCCCCC-CEEECCCCCHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCHHHHHHHH
Q ss_conf 7864348986-099818999788999998820399999904999999999996999388999986418999888999999
Q 000630 332 RGALPEHYVN-QLYEVQKLDSSRALQLFSYHALGRENPTDKFFKISEQIVSLTGGLPLALEVFGAFLFDKRRITEWEDAL 410 (1382)
Q Consensus 332 ~~~~~~~~~~-~~~~l~~L~~~ea~~Lf~~~a~~~~~~~~~~~~~~~~iv~~~~g~PLal~~~g~~L~~~~~~~~w~~~l 410 (1382)
+.++...... ..|+|++|+.+||++||..++|....+ +...+++++|+++|+|+|||++++|+.|+.+. ...|....
T Consensus 167 ~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~~~-~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k~-~~~~~~~~ 244 (277)
T d2a5yb3 167 VEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVG-EKEEDVLNKTIELSSGNPATLMMFFKSCEPKT-FEKMAQLN 244 (277)
T ss_dssp GGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC---CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSS-HHHHHHHH
T ss_pred HHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHCCCCCC-HHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCC-HHHHHHHH
T ss_conf 89998637887168778899799999999984776674-25679999999995899899999999865598-99999999
Q ss_pred HHHHHCCCCHHHHHHHHHCCCCCCCCCCEEEE
Q ss_conf 99972399108998976314888012011343
Q 000630 411 EKLRKIRPNNLQEVLKISFDGLDQQDKCIFLD 442 (1382)
Q Consensus 411 ~~L~~~~~~~i~~~l~~s~~~L~~~~k~~fl~ 442 (1382)
..|.......+..++..||+.||.++|.||-+
T Consensus 245 ~~L~~~~~~~v~~il~~sY~~L~~~lk~c~~~ 276 (277)
T d2a5yb3 245 NKLESRGLVGVECITPYSYKSLAMALQRCVEV 276 (277)
T ss_dssp HHHHHHCSSTTCCCSSSSSSSHHHHHHHHHHT
T ss_pred HHHHCCCHHHHHHHHHHHHHCCCHHHHHHHHH
T ss_conf 99734867889999999885126999999973
|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fyva_ c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1fyxa_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|